SMED30032562

Overview
NameSMED30032562
Smed IDSMED30032562
Length (bp)1471
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30032562 (SMED30032562) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30032562 (SMED30032562) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032562

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30032562 dd_Smed_v4_16672_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032562 dd_Smed_v4_16672_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30032562 dd_Smed_v4_16672_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30032562 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002806:59627..61097 -7283
Homology
BLAST of SMED30032562 vs. TrEMBL
Match: G4V7W3 (Putative monocarboxylate transporter OS=Schistosoma mansoni OX=6183 GN=Smp_079640 PE=4 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 3.347e-20
Identity = 113/465 (24.30%), Postives = 195/465 (41.94%), Query Frame = 1
Query:  115 IVCLTISLCVV-LNGKTRCFSVLAAELQNQTCNTIKDTCGMATLNWIAFLSEMIIVGGNPFITNMFIRVH-----SGVLGGKVTFQFCXXXXXXXXXXXFVGDPESLFVTDTLIQGISTSVLLGLVSFKLVHMYPDDNPNHKTVLLLSEIAPWFGVILCPLYGTLVSVYGWQSSYLLISFLIMVICVLAGIIEPKVSATXXXXXXXXXXXXXXXXTEEI--DSQTYFDKSDYWEIEDVGEMECQHPSLLQLLLN------------VNISQVVGKSEVVVWFIERALMIIAEFNLIINLVHYMTSVLLEPILEASMIMITLGAGNIMGFLTIYVLGSKIRKYLPRIYILASVMLVISFIVWQIYGSQTDLILFTVPDAHFVVIV---IGAFSAISTAQSYYVAEDIIERPRIISVSLTKLAQSLGLLIGPISSGMLIQIDFFHSFFSVQAFIHSVRIMLLSFIVY 1440
            +V L  +L VV + GK R F +  A L     +T      M  LNW+      +     PF T   IR +     + VL G + F  C+   +       V  P  LF+T TLI G+ ++++L   S      +   +  H          P+  +I  PLY  L+  YGWQ ++ L   L + +  LAG++                       + +I   +Q   + SD +E E+      Q  SLL  LLN             ++  +    +V VW  ER L  +  + L++N+  Y++  L + ++  + + +  G G  + F    ++G +IR YL   Y++ ++   +  ++ Q           T  D + V ++    GA   +     Y  +E+I+     I+  +TK+   +G+L+ P+ SG +I    +  FF   A + S+R +LL FI Y
Sbjct:   38 LVLLVAALNVVCIGGKRRAFGIFVAALHKAYNDT-----SMTELNWVGDSYAAVGFFLMPFATTAIIRWNRPYRCTMVLAGLLIFISCMTSAV-------VPSPGYLFLTHTLIHGLGSTLILCGTSLVTEEYFDRSHRFHVLATAFVSGGPYGVLIFGPLYSNLIQSYGWQVTFQLSGLLFLFVTCLAGVV---------------------FISRDIFEYNQAMLEISDTFE-ENTMNKALQKDSLL--LLNSPKASDGRGWAFCSVEHLKNNPQVFVWGFERLLHNLVIYGLLMNMTAYVSEALNDQLVLGARVNLYFGIGESVVFTLGALIGDRIRGYLAYAYLIGALFAALFLVIMQN----------TYEDLNVVYVLAGFTGATVGVGNTFLYATSEEIMMVHGSIAFPMTKMIAGIGMLLAPLFSGAIIDGFGYGGFFISMAILVSIRAILLGFICY 456          
BLAST of SMED30032562 vs. TrEMBL
Match: A0A183REE3 (MFS domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 2.455e-19
Identity = 110/464 (23.71%), Postives = 195/464 (42.03%), Query Frame = 1
Query:  115 IVCLTISLCVV-LNGKTRCFSVLAAELQNQTCNTIKDTCGMATLNWIAFLSEMIIVGGNPFITNMFIRVH-----SGVLGGKVTFQFCXXXXXXXXXXXFVGDPESLFVTDTLIQGISTSVLLGLVSFKLVHMYPDDNPNHKTVLLLSEIAPWFGVILCPLYGTLVSVYGWQSSYLLISFLIMVICVLAGIIEPKVSATXXXXXXXXXXXXXXXXTEEI--DSQTYFDKSDYWEIEDVGEMECQHPSLL----------QLLLNVNISQVVGKSEVVVWFIERALMIIAEFNLIINLVHYMTSVLLEPILEASMIMITLGAGNIMGFLTIYVLGSKIRKYLPRIYILASVMLVISFIVWQIYGSQTDLILFTVPDAHFVVIVIGAFSAISTAQS----YYVAEDIIERPRIISVSLTKLAQSLGLLIGPISSGMLIQIDFFHSFFSVQAFIHSVRIMLLSFIVY 1440
            +V L  +L VV + GK R F +  A L     +T      M  LNW+      +     PF T   IR +     + VL G + F  C+   +       V  P  LF+T TLI G+ ++++L   S      +   +  H          P+  +I  PLY  L+  YGWQ ++ L   L +++  LAG++                       + +I   +Q   + SD +E E+      +  SLL          +     ++  +    +V VW  ER L  +  + L++N+  Y++  L + ++  + + +  G G  + F    ++G +IR YL   Y++ ++   +  ++ Q   +  DL          VV V+  F+  +        Y  +E+I+     I+  +TK+   +G+L+ P+ SG +I    +  FF   A + S+R +LL FI Y
Sbjct:   38 LVLLVAALNVVCIGGKRRAFGIFVAALHKAYNDT-----SMTELNWVGDSYAAVGFFLMPFATTAIIRWNRPYRCTMVLAGLLIFISCMTSAV-------VPSPGYLFLTHTLIHGLGSTLILCGTSLVTEEYFDRSHRFHVLATAFVSGGPYGVLIFGPLYSNLIQSYGWQVTFQLSGLLFLLVTCLAGVV---------------------FISRDIFEYNQAMLEISDTFE-ENTMNKALRKDSLLLHNSPKASDGRRWAFCSVEHLKNNPQVFVWGFERLLHNLVIYGLLMNMTAYVSEALNDQLVMGARVNLYFGIGESVVFTLGALIGDRIRGYLAYAYLIGALFAALFLVIMQ--NTYEDLN---------VVYVLAGFTGATVGVGNTFLYATSEEIMMVHGSIAFPMTKMIAGIGMLLAPLFSGAIIDGFGYGGFFISMAILVSIRAILLGFICY 456          
BLAST of SMED30032562 vs. TrEMBL
Match: A0A0H3YK65 (Slc16a-3 OS=Schmidtea mediterranea OX=79327 GN=slc16a-3 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 1.616e-18
Identity = 109/463 (23.54%), Postives = 197/463 (42.55%), Query Frame = 1
Query:   64 NTPRKIFASLKSLKVISIVCLTISLCVVLNGKTRCFSVLAAELQNQTCNTIKDTCGMATLNWIAFLSEMIIVGGNPFITNMFIRVHS---GVLGGKVTFQFCXXXXXXXXXXXFVGDPESLFVTDTLIQGISTSVLLGLVSFKLVHMYPDDNPNHKTVLLLSEIAPWFGVILCPLYGTLVSVYGWQSSYLLISFLIMVICVLAGIIEPKVSATXXXXXXXXXXXXXXXXTEEIDSQTYFDKSDYWEIEDVGEMECQHPSLLQLLLNVNISQVVGKSEVVVWFIERALMIIAEFNLIINLVHYMTSVL--LEPILEASMIMITLGAGNIMGFLTIYVLGSKIRKYLPRIYILASVMLVISFIVWQIYGSQTDLILFTVPDAHFVVIV----IGAFSAISTAQSYYVAEDIIERPRIISVSLTKLAQSLGLLIGPISSGMLIQIDFFHSFFSVQAFIHSVRIMLL 1425
            N   +IF ++K L +  +V  TI++ + + GK R F +  +  ++    T      M  LNW+      +     PFIT+   R  S   G+L   +   FC  +        FV +   LF+T T++ GI ++ +L   +  +   +  ++  H     L+   P+  +I  PLYG +V  Y W+ ++ +I+ L  V  + AGI+                               Y  K DY + E++   E   PSL  L+ N          ++ +W I+R       + L++NL   + S+L   E +   + I + +G G  + F    V+G KIR  LP  +++ +   ++  I+ +           TV    + +I     +GA + +     Y  +E+I      IS+ L+ +  + G++I PI SG+LI +  F   FS    +  +R++ L
Sbjct:    6 NILLRIF-TIKQLSIFILVVATINI-IFIGGKRRTFGIFISAFRSTFNGT-----SMVELNWVGDSYSAVAFFLMPFITSFVHRNRSYQKGMLAASI-LVFCSCMLTS-----FVTNAAELFITHTVLHGIGSAFILSTSALIIGEYFDKNHRYHVLATSLTTGGPYGSLIFGPLYGFMVQHYDWRFTFRVIAILFFV-EISAGIL------------------------------AYVPKPDYQKSEEIENYEGAFPSLKYLIQN---------KQIFLWGIDRICTSSILYGLLMNLTDLLRSMLNGTENLEGGAKINLMMGVGESIIFTISAVIGDKIRGKLPFFHLIGAAFTLLMLILMK-----------TVSYYPYAIIAFSIFLGAGAGVGNCMLYASSEEITFLHGSISLPLSNMMMAFGMIIAPIFSGLLIDMYGFLGLFSSLIILACIRMLCL 404          
BLAST of SMED30032562 vs. TrEMBL
Match: A0A2H1C2Q1 (Monocarboxylate transporter OS=Fasciola hepatica OX=6192 GN=D915_007048 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.866e-18
Identity = 102/456 (22.37%), Postives = 181/456 (39.69%), Query Frame = 1
Query:  142 VVLNGKTRCFSVLAAELQNQTCNTIKDTCGMATLNWIA------------FLSEMIIVGGNPFITNMFIRVHSGVLGGKVTFQFCXXXXXXXXXXXFVGDPESLFVTDTLIQGISTSVLLGLVSFKLVHMYPDDNPNHKTVLLLSEIAPWFGVILCPLYGTLVSVYGWQSSYLLISFLIMVICVLAGI-IEPKVSATXXXXXXXXXXXXXXXXTEEIDSQTYFDKSDYWEIEDVGEMECQHPSLLQLLLNVN---------ISQVVGKSEVVVWFIERALMIIAEFNLIINLVHYMTSVLLEPILEASMIMITLGAGNIMGFLTIYVLGSKIRKYLPRIYILASVMLVISFIVWQIYGSQTDLILFTVPDAHFVVIVIG-AFSAISTAQS--YYVAEDIIERPRIISVSLTKLAQSLGLLIGPISSGMLIQIDFFHSFFSVQAFIHSVRIMLLSFI 1434
            + + GK R F +  A L     +T  +   M  LNWI             F + +I+    P+   MF       L G   F  C+           V DP  LF+T T++ GI ++++L   S      +   +  H          P+  +I  PL+   +  YGWQ +++    L +++  L  I   PK +                        Q   D S+  +I+  G  +   P LL+     +         ++ +    +V +W +ER L  I  + L++NL  Y++  L   ++  + + +  G G  + F     +G +IR YLP  Y++ +    +  ++ Q           T  D + V I+ G    A+    +  Y  AE+++     I+  +TK+   +G+LI P  SG +I    +  FF   A +  +R+ LL+ I
Sbjct:   48 ICIGGKRRAFGIFVAAL-----HTAYNETSMTELNWIGDSYASLGFFLMPFATTLIVQTNRPYRFTMF-------LAGVTIFLSCMTSAS-------VPDPSYLFLTHTILHGIGSTLVLCGTSLVTGDYFDKTHRFHVLATTFVSGGPYGVLIFGPLFSHWIQHYGWQQAFIYSGILFLLVTWLGTITFLPKSTVEY--------------------QQAVTDDSE--QIDQSGNKDSHAPLLLRNAPKASDGRGWAFCSVAHLRANPQVFLWGMERFLQNIVVYGLLMNLTAYVSQALDNELIRGAKVNLYFGIGESLVFTVGAFIGDRIRGYLPFTYLIGAGFAAVFLLIVQT----------TYTDINVVYILAGFTGGAVGVGNTFLYATAEEVMLVHGSIAFPMTKMVAGIGMLIAPAFSGAVIDGYGYRGFFISMAVLVCLRVGLLTVI 452          
BLAST of SMED30032562 vs. TrEMBL
Match: A0A183KF85 (MFS domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS13679 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.450e-18
Identity = 107/462 (23.16%), Postives = 192/462 (41.56%), Query Frame = 1
Query:  115 IVCLTISLCVV-LNGKTRCFSVLAAELQNQTCNTIKDTCGMATLNWIAFLSEMIIVGGNPFITNMFIRVH-----SGVLGGKVTFQFCXXXXXXXXXXXFVGDPESLFVTDTLIQGISTSVLLGLVSFKLVHMYPDDNPNHKTVLLLSEIAPWFGVILCPLYGTLVSVYGWQSSYLLISFLIMVICVLAGIIEPKVSATXXXXXXXXXXXXXXXXTEEI--DSQTYFDKSDYWEIEDVGEMECQHPSLLQLLLNVN---------ISQVVGKSEVVVWFIERALMIIAEFNLIINLVHYMTSVLLEPILEASMIMITLGAGNIMGFLTIYVLGSKIRKYLPRIYILASVMLVISFIVWQIYGSQTDLILFTVPDAHFVVIV---IGAFSAISTAQSYYVAEDIIERPRIISVSLTKLAQSLGLLIGPISSGMLIQIDFFHSFFSVQAFIHSVRIMLLSFIVY 1440
            +V L  +L VV + GK R F +  A L     +T      M  LNW+      +     PF T   IR +     + +L G + F  C+   +       V  P  LF+T TLI G+ ++++L   S      +   +  H          P+  +I  PLY  L+  YGWQ ++ L   L +++  LAGI+                       + +I   +Q   + SD +E   + +   + P LL+     +         +  +    +V VW  ER L  +  + L++N+  Y++  L + ++  + + +  G G  + F    ++G +IR YL   Y + ++   +  ++ Q           T  D + V ++    GA   +     Y  +E+I+     I+  +TK+   +G+L+ P+ SG +I    +  FF   A + S+R +LL  I Y
Sbjct:   38 LVLLVAALNVVCIGGKRRAFGIFVAALHKAYNDT-----SMTELNWVGDSYAAVGFFLMPFATTAIIRWNRPYRCTMLLAGLLIFISCMTSAV-------VPSPGYLFLTHTLIHGLGSTLILCGTSLVTEEYFDRSHRFHVLATAFVSGGPYGVLIFGPLYSNLIQSYGWQVAFQLSGLLFLLVTSLAGIV---------------------FISRDIFEYNQAILELSDSFEENTMNKALRKDPLLLRNSPKASDGRGWAFCSVEHLKNNPQVFVWGFERLLHNLVIYGLLMNMTAYVSQALNDQLVLGARVNLYFGIGESIVFTLGALIGDRIRGYLAVAYFIGALFAALFLVIMQN----------TYEDLNVVYVLAGFTGATVGVGNTFLYATSEEIMMVHGSIAFPMTKMIAGIGMLLAPLFSGAIIDGFGYGGFFISMAILVSIRAILLGLICY 456          
BLAST of SMED30032562 vs. Planmine SMEST
Match: SMESG000014825.1 (SMESG000014825.1)

HSP 1 Score: 889.797 bits (2298), Expect = 0.000e+0
Identity = 472/473 (99.79%), Postives = 473/473 (100.00%), Query Frame = 1
Query:   31 MNTFFRNIPTLNTPRKIFASLKSLKVISIVCLTISLCVVLNGKTRCFSVLAAELQNQTCNTIKDTCGMATLNWIAFLSEMIIVGGNPFITNMFIRVHSGVLGGKVTFQFCXXXXXXXXXXXFVGDPESLFVTDTLIQGISTSVLLGLVSFKLVHMYPDDNPNHKTVLLLSEIAPWFGVILCPLYGTLVSVYGWQSSYLLISFLIMVICVLAGIIEPKVSATXXXXXXXXXXXXXXXXTEEIDSQTYFDKSDYWEIEDVGEMECQHPSLLQLLLNVNISQVVGKSEVVVWFIERALMIIAEFNLIINLVHYMTSVLLEPILEASMIMITLGAGNIMGFLTIYVLGSKIRKYLPRIYILASVMLVISFIVWQIYGSQTDLILFTVPDAHFVVIVIGAFSAISTAQSYYVAEDIIERPRIISVSLTKLAQSLGLLIGPISSGMLIQIDFFHSFFSVQAFIHSVRIMLLSFIVYKKS 1449
            MNTFFRNIPTLNTPRKIFASLKSLKVISIVCLTISLCVVLNGKTRCFSVLAAELQNQTCNTIKDTCGMATLNWIAFLSEMIIVGGNPFITNMFIRVHSGVLGGKVTFQFCLILTLGTLLTGFVGDPESLFVTDTLIQGISTSVLLGLVSFKLVHMYPDDNPNHKTVLLLSEIAPWFGVILCPLYGTLVSVYGWQSSYLLISFLIMVICVLAGIIEPKVSATEEQEENEDSDNSSIQNTEEIDSQTYFDKSDYWEIEDVGEMECQHPSLLQLLLNVNISQVVGKSEVVVWFIERALMIIAEFNLIINLVHYMTSVLLEPIL+ASMIMITLGAGNIMGFLTIYVLGSKIRKYLPRIYILASVMLVISFIVWQIYGSQTDLILFTVPDAHFVVIVIGAFSAISTAQSYYVAEDIIERPRIISVSLTKLAQSLGLLIGPISSGMLIQIDFFHSFFSVQAFIHSVRIMLLSFIVYKKS
Sbjct:    1 MNTFFRNIPTLNTPRKIFASLKSLKVISIVCLTISLCVVLNGKTRCFSVLAAELQNQTCNTIKDTCGMATLNWIAFLSEMIIVGGNPFITNMFIRVHSGVLGGKVTFQFCLILTLGTLLTGFVGDPESLFVTDTLIQGISTSVLLGLVSFKLVHMYPDDNPNHKTVLLLSEIAPWFGVILCPLYGTLVSVYGWQSSYLLISFLIMVICVLAGIIEPKVSATEEQEENEDSDNSSIQNTEEIDSQTYFDKSDYWEIEDVGEMECQHPSLLQLLLNVNISQVVGKSEVVVWFIERALMIIAEFNLIINLVHYMTSVLLEPILQASMIMITLGAGNIMGFLTIYVLGSKIRKYLPRIYILASVMLVISFIVWQIYGSQTDLILFTVPDAHFVVIVIGAFSAISTAQSYYVAEDIIERPRIISVSLTKLAQSLGLLIGPISSGMLIQIDFFHSFFSVQAFIHSVRIMLLSFIVYKKS 473          
BLAST of SMED30032562 vs. Planmine SMEST
Match: SMESG000065239.1 (SMESG000065239.1)

HSP 1 Score: 152.525 bits (384), Expect = 6.389e-42
Identity = 93/318 (29.25%), Postives = 174/318 (54.72%), Query Frame = 1
Query:  568 LCPLYGTLVSVYGWQSSYLLISFLIMVICVLAGIIEPK------VSATXXXXXXXXXXXXXXXXTEEIDSQTY--FDKSDYWEIE--------DVGEMECQHPSLL----------QLLLNVNISQVVGKSEVVVWFIERALMIIAEFNLIINLVHYMTSVLLEPILEASMIMITLGAGNIMGFLTIYVLGSKIRKYLPRIYILASVMLVISFIVWQIYGSQTDLILFTVPDAHFVVIVIGAFSAISTAQSYYVAEDIIERPRIISVSLTKLAQSLGLLIGPISSGMLIQIDFFHSFFSVQAFIHSVRIMLLSFIVYK 1443
            +CPL+G ++    WQ  YL  + L+++  ++  I+EPK      VS    ++  +   +S   +  +   ++Y   ++ ++WE +        D    E + PS+               N     V+ +S  ++W IERAL  +  +N+++NLV YM   + E + +AS+IM++ G G ++GF+    LG ++R +L  IY +A+ +L + F+ W I  +   +  F+  DAHF+ ++ G   A ++  +Y +AED++ RP II+  LT+  Q+LGL+  P++SG++IQ D + SFF +Q  +  +R++LL  +++K
Sbjct:    1 MCPLFGVILQTTHWQQVYLFFAILLVIAIIITSIVEPKNYDQPAVSTFRIEKSFKAESSSKCPDHPDQQCKSYEEVNEIEFWENDQSIYSVSSDEASEEVKRPSIASEVPHAPEIRNFFFNPETWNVLRESSSIIWLIERALHTMILYNVVLNLVDYMVVEIQESLEKASLIMMSFGGGEVIGFVIAVGLGDQLRHHLLHIYTIATGILTVIFMSWHITQA-IHIDSFSNGDAHFLALICGLVMAFTSGYTYALAEDVLCRPGIIAYPLTRFCQALGLIFAPLTSGLVIQFDQYKSFFLIQTILTFIRLVLLIVLIFK 317          
BLAST of SMED30032562 vs. Planmine SMEST
Match: SMESG000011418.1 (SMESG000011418.1)

HSP 1 Score: 98.5969 bits (244), Expect = 4.495e-22
Identity = 109/463 (23.54%), Postives = 197/463 (42.55%), Query Frame = 1
Query:   64 NTPRKIFASLKSLKVISIVCLTISLCVVLNGKTRCFSVLAAELQNQTCNTIKDTCGMATLNWIAFLSEMIIVGGNPFITNMFIRVHS---GVLGGKVTFQFCXXXXXXXXXXXFVGDPESLFVTDTLIQGISTSVLLGLVSFKLVHMYPDDNPNHKTVLLLSEIAPWFGVILCPLYGTLVSVYGWQSSYLLISFLIMVICVLAGIIEPKVSATXXXXXXXXXXXXXXXXTEEIDSQTYFDKSDYWEIEDVGEMECQHPSLLQLLLNVNISQVVGKSEVVVWFIERALMIIAEFNLIINLVHYMTSVL--LEPILEASMIMITLGAGNIMGFLTIYVLGSKIRKYLPRIYILASVMLVISFIVWQIYGSQTDLILFTVPDAHFVVIV----IGAFSAISTAQSYYVAEDIIERPRIISVSLTKLAQSLGLLIGPISSGMLIQIDFFHSFFSVQAFIHSVRIMLL 1425
            N   +IF ++K L +  +V  TI++ + + GK R F +  +  ++    T      M  LNW+      +     PFIT+   R  S   G+L   +   FC  +        FV +   LF+T T++ GI ++ +L   +  +   +  ++  H     L+   P+  +I  PLYG +V  Y W+ ++ +I+ L  V  + AGI+                               Y  K DY + E++   E   PSL  L+ N          ++ +W I+R       + L++NL   + S+L   E +   + I + +G G  + F    V+G KIR  LP  +++ +   ++  I+ +           TV    + +I     +GA + +     Y  +E+I      IS+ L+ +  + G++I PI SG+LI +  F   FS    +  +R++ L
Sbjct:    6 NILLRIF-TIKQLSIFILVVATINI-IFIGGKRRTFGIFISAFRSTFNGT-----SMVELNWVGDSYSAVAFFLMPFITSFVHRNRSYQKGMLAASI-LVFCSCMLTS-----FVTNAAELFITHTVLHGIGSAFILSTSALIIGEYFDKNHRYHVLATSLTTGGPYGSLIFGPLYGFMVQHYDWRFTFRVIAILFFV-EISAGIL------------------------------AYVPKPDYQKSEEIENYEGAFPSLKYLIQN---------KQIFLWGIDRICTSSILYGLLMNLTDLLRSMLNGTENLEGGAKINLMMGVGESIIFTISAVIGDKIRGKLPFFHLIGAAFTLLMLILMK-----------TVSYYPYAIIAFSIFLGAGAGVGNCMLYASSEEITFLHGSISLPLSNMMMAFGMIIAPIFSGLLIDMYGFLGLFSSLIILACIRMLCL 404          
BLAST of SMED30032562 vs. Planmine SMEST
Match: SMESG000021812.1 (SMESG000021812.1)

HSP 1 Score: 77.7962 bits (190), Expect = 3.537e-15
Identity = 103/468 (22.01%), Postives = 197/468 (42.09%), Query Frame = 1
Query:   88 SLKSLKVISI-VCLTISLCVV-LNGKTRCFSVLAAELQ---NQTC----NTIKDTCGMATLNWIAFLSEMIIVGGNPFITNMFIRVHSGVLGGKVTFQFCXXXXXXXXXXXFVGDPESLFVTDTLIQGISTSVLLGLVSFKLVHMYPDDNPNHKTVLLLSEIAPWFGVILCPLYGTLVSVYGWQSSYLLISFLIMVICVLAGIIE-PKVSATXXXXXXXXXXXXXXXXTEEIDSQTYFDKSDYWEIEDVGEMECQHPSLLQLLLNVNISQVVGKSEVVVWFIERALMIIAEFNLIINLVHY--MTSVLLEPILEASMIMITLGAGNIMGFLTIYVLGSKIRKYLPRIYILASVMLVISFIVWQIYGSQTDLILFTVPDAHFVVIVIGAFSAISTAQSYYVAEDIIERPRIISVSLTKLAQSLGLLIGPISSGMLIQIDFFHSFFSVQAFIHSVRIMLLS---FIVYKK 1446
            SL   KV SI V L I+L ++ + GK R F +  +      N T     N + D+        + FL+  I    + +   MFI   +G+      F FC  +    + + ++     LF+T TL+ GI + ++L   +  +   +   +P H     L+    +  +IL PL+  L+  YGW++++ +I  L +++  LA I   P+ +                    EI  ++  D++  W+                       + V+   + + WF++RAL     F L++NL  Y   + ++   I   S I I LG G    F    ++G  IR  L  + ++ +    +S I+ +        +  ++   + + +++G    ++    Y  + + +     IS+ ++K+  + G L+ P  SG++I    F   F     +  +RI+ LS   FI+Y+K
Sbjct:   10 SLMPEKVFSICVLLVITLNMIFIGGKRRNFGLFVSAFYRSFNGTSLFELNMVGDSYSSLAFILMPFLTSGIAYWNSAYQLAMFI---AGI------FIFCSSMLTSIVTSAWM-----LFLTHTLLHGIGSGIVLASCTLVVADYFNKKHPYHVLATSLASSGAYGVLILTPLFAHLIQAYGWRTAFQIIGILFVIVIGLAVIFYVPEENPYT-----------------EIGEKSQIDQTK-WKF-------------------TTWNHVMENKQTLFWFVDRALNGAIFFALLMNLTEYRRQSGIVDMEIESGSTINIMLGIGECFTFTVTMIIGDHIRGRLVVVQLIGACFSFLSTILMRA-------VTHSIVATNVITVMLGGSVGMANCVLYASSSEAMNIDGSISLPMSKMMSAFGALLSPFFSGLIIDGYGFEGLFVSLILLTFLRIVCLSTINFILYQK 419          
BLAST of SMED30032562 vs. Planmine SMEST
Match: SMESG000026516.1 (SMESG000026516.1)

HSP 1 Score: 59.6918 bits (143), Expect = 2.484e-9
Identity = 81/424 (19.10%), Postives = 164/424 (38.68%), Query Frame = 1
Query:  142 VVLNGKTRCFSVLAAELQNQTCNTIKDTCGMATLNWIAFLSEMIIVGGNPFITNMFIRVHSGVLGGKVTFQFCXXXXXXXXXXXFVGDPESLFVTDTLIQGISTSVLLGLVSFKLVHMYPDDNPNHKTVLLLSEIAPWFGVILCPLYGTLVSVYGWQSSYLLISFLIMVICVLAGIIEPKVSATXXXXXXXXXXXXXXXXTEEIDSQTYFDKSDYWEIEDVGEMECQHPSLLQLLLNVNISQVVGKSEVVVWFIERALMIIAEFNLIINLVHYMTSVLLEPILEASMIMITLGAGNIMGFLTIYVLGSKIRKYLPRIYILASVMLVISFIVWQIYGSQTDLILFTVPDAHFVVI--VIGAFSAISTAQS----YYVAEDIIERPRIISVSLTKLAQSLGLLIGPISSGMLIQIDFFHSFFSVQA 1395
            + L GK R F    A+   +  N       +  LNWI        +G      ++ I ++     G   F   L + +  + + FV +P  LF+T TL  GI +S+++      +   +   +  H     L        ++   L+  L+  YGW+ +++++  +  V+C LA     K                                 D  EI   G+M CQ         N+   Q+     ++ WF +R +  +  + L++NL  Y+     + ++++S++ I   +G  + +L   V+ +  + +      L  ++LV S        S +  ++     +H V I  ++  F+  S   S    +   E+    P  ++  ++      G++I P+ +  +I++  +  FF VQ 
Sbjct:   30 IFLGGKRRAFGSFVAQFHKEYPNI-----SLTELNWIG--DSYSAIGYMSTSLSISIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVTLFSKLIEHYGWRKTFIILGIIYFVVCSLAAFFFKK-------------------------------NKDLKEISSKGKMLCQGQ------WNIKSIQI---PLIIFWFTDRIMTSVVTYGLLLNLTDYVYQG-HKDLMKSSILTIIFASGEAVTYLIGSVITAITKDFFKE--KLRYILLVTSL-------SMSICLIILEYTSHIVSIRRLLCFFAGFSLGPSITFLFPAGEEFTRLPGHLAYPVSLGGMGFGMIISPLLTAKIIELLDYRWFFFVQG 396          
The following BLAST results are available for this feature:
BLAST of SMED30032562 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032562 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032562 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032562 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032562 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032562 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032562 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032562 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4V7W33.347e-2024.30Putative monocarboxylate transporter OS=Schistosom... [more]
A0A183REE32.455e-1923.71MFS domain-containing protein OS=Schistosoma rodha... [more]
A0A0H3YK651.616e-1823.54Slc16a-3 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A2H1C2Q11.866e-1822.37Monocarboxylate transporter OS=Fasciola hepatica O... [more]
A0A183KF852.450e-1823.16MFS domain-containing protein OS=Schistosoma curas... [more]
back to top
BLAST of SMED30032562 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032562 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032562 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032562 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032562 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032562 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014825.10.000e+099.79SMESG000014825.1[more]
SMESG000065239.16.389e-4229.25SMESG000065239.1[more]
SMESG000011418.14.495e-2223.54SMESG000011418.1[more]
SMESG000021812.13.537e-1522.01SMESG000021812.1[more]
SMESG000026516.12.484e-919.10SMESG000026516.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032562 ID=SMED30032562|Name=SMED30032562|organism=Schmidtea mediterranea sexual|type=transcript|length=1471bp
ATACAAGTGTCATAAATAAGACTAATAGCAATGAATACGTTTTTCCGTAA
TATTCCCACATTAAACACTCCAAGAAAAATTTTTGCAAGTCTAAAGTCTT
TGAAAGTTATATCAATAGTTTGTCTAACCATTTCTTTATGCGTGGTTTTG
AATGGGAAAACTCGTTGCTTCAGCGTTTTGGCGGCTGAATTACAAAATCA
AACTTGCAACACAATCAAAGATACTTGTGGAATGGCAACATTGAACTGGA
TTGCCTTCCTTAGCGAAATGATCATTGTCGGTGGAAATCCATTCATAACG
AATATGTTTATCAGAGTCCACAGCGGAGTTTTAGGAGGAAAAGTCACTTT
TCAATTTTGTTTGATCCTAACATTGGGAACATTGCTTACTGGTTTCGTTG
GAGATCCCGAATCTTTGTTTGTTACAGATACTCTAATTCAAGGAATTTCA
ACATCCGTTTTACTGGGTCTCGTTTCTTTCAAATTGGTACACATGTATCC
AGACGATAATCCTAACCACAAAACAGTTTTATTGCTATCAGAAATTGCCC
CGTGGTTTGGAGTGATTTTGTGTCCTTTATACGGAACACTAGTTTCTGTG
TATGGATGGCAGTCGTCATATTTATTAATATCGTTCCTTATTATGGTAAT
CTGCGTTTTAGCCGGAATCATTGAACCAAAAGTTTCAGCCACCGAAGAAC
AGGAAGAAAACGAAGATAGTGATAATAGCTCAATACAGAACACCGAAGAA
ATAGATTCCCAAACGTATTTTGATAAATCCGATTATTGGGAAATAGAAGA
CGTAGGAGAAATGGAGTGCCAACATCCAAGTTTGTTGCAATTATTGTTGA
ATGTTAATATTTCCCAAGTGGTTGGAAAAAGTGAAGTTGTTGTATGGTTT
ATAGAAAGAGCTTTAATGATAATTGCGGAATTTAATCTTATAATTAATCT
TGTGCATTACATGACCTCTGTATTGTTGGAACCAATTTTGGAGGCGTCAA
TGATCATGATCACTTTGGGAGCTGGGAATATTATGGGATTTTTAACAATC
TATGTGTTGGGTTCTAAAATTAGAAAATATCTTCCACGAATATATATTTT
AGCATCGGTTATGTTGGTGATTTCCTTTATTGTCTGGCAGATATATGGCT
CACAAACTGATCTAATTTTATTTACGGTTCCGGACGCACATTTTGTCGTA
ATTGTTATTGGAGCTTTTAGCGCGATTAGTACGGCTCAAAGCTATTACGT
CGCTGAGGATATAATTGAACGTCCTAGGATTATTTCGGTTTCTCTGACGA
AACTAGCCCAATCATTGGGGTTACTTATTGGTCCAATTTCGTCAGGAATG
CTAATTCAAATTGACTTTTTTCATTCGTTTTTTTCTGTTCAGGCATTTAT
ACATTCCGTAAGAATAATGTTATTATCTTTTATTGTGTATAAAAAATCTT
AATCAACTTGCTAATTAAAAT
back to top

protein sequence of SMED30032562-orf-1

>SMED30032562-orf-1 ID=SMED30032562-orf-1|Name=SMED30032562-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=474bp
MNTFFRNIPTLNTPRKIFASLKSLKVISIVCLTISLCVVLNGKTRCFSVL
AAELQNQTCNTIKDTCGMATLNWIAFLSEMIIVGGNPFITNMFIRVHSGV
LGGKVTFQFCLILTLGTLLTGFVGDPESLFVTDTLIQGISTSVLLGLVSF
KLVHMYPDDNPNHKTVLLLSEIAPWFGVILCPLYGTLVSVYGWQSSYLLI
SFLIMVICVLAGIIEPKVSATEEQEENEDSDNSSIQNTEEIDSQTYFDKS
DYWEIEDVGEMECQHPSLLQLLLNVNISQVVGKSEVVVWFIERALMIIAE
FNLIINLVHYMTSVLLEPILEASMIMITLGAGNIMGFLTIYVLGSKIRKY
LPRIYILASVMLVISFIVWQIYGSQTDLILFTVPDAHFVVIVIGAFSAIS
TAQSYYVAEDIIERPRIISVSLTKLAQSLGLLIGPISSGMLIQIDFFHSF
FSVQAFIHSVRIMLLSFIVYKKS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR11360MONOCARBOXYLATE TRANSPORTERcoord: 30..470
NoneNo IPR availablePANTHERPTHR11360:SF225EG:103B4.3 PROTEINcoord: 30..470
NoneNo IPR availableCDDcd17325MFS_MdtG_SLC18_likecoord: 303..470
e-value: 2.80308E-4
score: 41.0224
NoneNo IPR availableTMHMMTMhelixcoord: 447..469
NoneNo IPR availableTMHMMTMhelixcoord: 351..373
NoneNo IPR availableTMHMMTMhelixcoord: 166..188
NoneNo IPR availableTMHMMTMhelixcoord: 105..124
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 322..344
NoneNo IPR availableTMHMMTMhelixcoord: 134..153
NoneNo IPR availableTMHMMTMhelixcoord: 290..312
NoneNo IPR availableTMHMMTMhelixcoord: 71..93
NoneNo IPR availableTMHMMTMhelixcoord: 388..407
NoneNo IPR availableTMHMMTMhelixcoord: 192..214
NoneNo IPR availableTMHMMTMhelixcoord: 420..442
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 104..469