SMED30032529

Overview
NameSMED30032529
Smed IDSMED30032529
Length (bp)1253
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30032529 (SMED30032529) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30032529 (SMED30032529) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032529

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30032529h1SMcG0016829 SmedASXL_015030SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30032529h1SMcG0016829 dd_Smed_v4_11079_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032529h1SMcG0016829 dd_Smed_v4_11079_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30032529 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.007787:18069..19464 -5580
Homology
BLAST of SMED30032529 vs. Ensembl Human
Match: ANKRD44 (ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:HGNC:25259])

HSP 1 Score: 56.6102 bits (135), Expect = 6.545e-8
Identity = 40/114 (35.09%), Postives = 54/114 (47.37%), Query Frame = 2
Query:  317 LLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTD 658
            LL  G +ID+ + YG  ALH +   N +D V   L  +  ++N  NN GFT LH+A  S      LE L+         +NI +K   SPL  +  H  F   + LI NG   D
Sbjct:  225 LLNLGVEIDEINVYGNTALHIACY-NGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLV----NNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEID 333          
BLAST of SMED30032529 vs. Ensembl Human
Match: ANKRD44 (ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:HGNC:25259])

HSP 1 Score: 56.6102 bits (135), Expect = 6.851e-8
Identity = 40/115 (34.78%), Postives = 54/115 (46.96%), Query Frame = 2
Query:  317 LLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTDF 661
            LL  G +ID+ + YG  ALH +   N +D V   L  +  ++N  NN GFT LH+A  S      LE L+         +NI +K   SPL  +  H  F   + LI NG   D 
Sbjct:  225 LLNLGVEIDEINVYGNTALHIACY-NGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLV----NNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDC 334          
BLAST of SMED30032529 vs. Ensembl Human
Match: ANKRD44 (ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:HGNC:25259])

HSP 1 Score: 55.8398 bits (133), Expect = 6.933e-8
Identity = 40/114 (35.09%), Postives = 54/114 (47.37%), Query Frame = 2
Query:  317 LLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTD 658
            LL  G +ID+ + YG  ALH +   N +D V   L  +  ++N  NN GFT LH+A  S      LE L+         +NI +K   SPL  +  H  F   + LI NG   D
Sbjct:  225 LLNLGVEIDEINVYGNTALHIACY-NGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLV----NNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEID 333          
BLAST of SMED30032529 vs. Ensembl Human
Match: ANKRD44 (ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:HGNC:25259])

HSP 1 Score: 56.225 bits (134), Expect = 7.212e-8
Identity = 40/114 (35.09%), Postives = 54/114 (47.37%), Query Frame = 2
Query:  317 LLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTD 658
            LL  G +ID+ + YG  ALH +   N +D V   L  +  ++N  NN GFT LH+A  S      LE L+         +NI +K   SPL  +  H  F   + LI NG   D
Sbjct:  225 LLNLGVEIDEINVYGNTALHIACY-NGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLV----NNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEID 333          
BLAST of SMED30032529 vs. Ensembl Human
Match: ANKRD44 (ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:HGNC:25259])

HSP 1 Score: 56.225 bits (134), Expect = 7.623e-8
Identity = 40/114 (35.09%), Postives = 54/114 (47.37%), Query Frame = 2
Query:  317 LLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTD 658
            LL  G +ID+ + YG  ALH +   N +D V   L  +  ++N  NN GFT LH+A  S      LE L+         +NI +K   SPL  +  H  F   + LI NG   D
Sbjct:   22 LLNLGVEIDEINVYGNTALHIACY-NGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLV----NNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEID 130          
BLAST of SMED30032529 vs. Ensembl Fly
Match: Kank (gene:FBgn0027596 transcript:FBtr0303758)

HSP 1 Score: 51.9878 bits (123), Expect = 6.256e-7
Identity = 38/125 (30.40%), Postives = 65/125 (52.00%), Query Frame = 2
Query:  299 KSLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNI-LNKFNNSPLMESIRHLNFHAVEVLIDNGARTDFKYE 670
            +SLS  LLEY   ++  D  G  A+H++V     D+V I L+S   D+N  NN G+T++     ++ K     +++ ++ K    +NI   K   + LM ++ H N   V +L+D GA  + + E
Sbjct:  236 ESLSIPLLEYC--VNLSDSNGNTAMHYAVSHGNFDVVSILLDSKVCDVNQMNNAGYTSVMLVSLAKLKQPAHRTVVERLFKMA-DVNIRAKKHCQTALMLAVSHGNGDMVNMLLDAGADINIQDE 357          
BLAST of SMED30032529 vs. Ensembl Fly
Match: Kank (gene:FBgn0027596 transcript:FBtr0303756)

HSP 1 Score: 52.373 bits (124), Expect = 6.763e-7
Identity = 37/117 (31.62%), Postives = 61/117 (52.14%), Query Frame = 2
Query:  302 SLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNI-LNKFNNSPLMESIRHLNFHAVEVLIDNGA 649
            SLS  LLEY   ++  D  G  A+H++V     D+V I L+S   D+N  NN G+T++     ++ K     +++ ++ K    +NI   K   + LM ++ H N   V +L+D GA
Sbjct:  854 SLSIPLLEYC--VNLSDSNGNTAMHYAVSHGNFDVVSILLDSKVCDVNQMNNAGYTSVMLVSLAKLKQPAHRTVVERLFKM-ADVNIRAKKHCQTALMLAVSHGNGDMVNMLLDAGA 967          
BLAST of SMED30032529 vs. Ensembl Fly
Match: Kank (gene:FBgn0027596 transcript:FBtr0087431)

HSP 1 Score: 51.9878 bits (123), Expect = 7.805e-7
Identity = 37/117 (31.62%), Postives = 61/117 (52.14%), Query Frame = 2
Query:  302 SLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNI-LNKFNNSPLMESIRHLNFHAVEVLIDNGA 649
            SLS  LLEY   ++  D  G  A+H++V     D+V I L+S   D+N  NN G+T++     ++ K     +++ ++ K    +NI   K   + LM ++ H N   V +L+D GA
Sbjct:  833 SLSIPLLEYC--VNLSDSNGNTAMHYAVSHGNFDVVSILLDSKVCDVNQMNNAGYTSVMLVSLAKLKQPAHRTVVERLFKM-ADVNIRAKKHCQTALMLAVSHGNGDMVNMLLDAGA 946          
BLAST of SMED30032529 vs. Ensembl Fly
Match: Kank (gene:FBgn0027596 transcript:FBtr0332856)

HSP 1 Score: 51.9878 bits (123), Expect = 8.146e-7
Identity = 37/117 (31.62%), Postives = 61/117 (52.14%), Query Frame = 2
Query:  302 SLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNI-LNKFNNSPLMESIRHLNFHAVEVLIDNGA 649
            SLS  LLEY   ++  D  G  A+H++V     D+V I L+S   D+N  NN G+T++     ++ K     +++ ++ K    +NI   K   + LM ++ H N   V +L+D GA
Sbjct:  830 SLSIPLLEYC--VNLSDSNGNTAMHYAVSHGNFDVVSILLDSKVCDVNQMNNAGYTSVMLVSLAKLKQPAHRTVVERLFKM-ADVNIRAKKHCQTALMLAVSHGNGDMVNMLLDAGA 943          
BLAST of SMED30032529 vs. Ensembl Fly
Match: Kank (gene:FBgn0027596 transcript:FBtr0087430)

HSP 1 Score: 51.9878 bits (123), Expect = 9.751e-7
Identity = 37/117 (31.62%), Postives = 61/117 (52.14%), Query Frame = 2
Query:  302 SLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNI-LNKFNNSPLMESIRHLNFHAVEVLIDNGA 649
            SLS  LLEY   ++  D  G  A+H++V     D+V I L+S   D+N  NN G+T++     ++ K     +++ ++ K    +NI   K   + LM ++ H N   V +L+D GA
Sbjct: 1015 SLSIPLLEYC--VNLSDSNGNTAMHYAVSHGNFDVVSILLDSKVCDVNQMNNAGYTSVMLVSLAKLKQPAHRTVVERLFKM-ADVNIRAKKHCQTALMLAVSHGNGDMVNMLLDAGA 1128          
BLAST of SMED30032529 vs. Ensembl Zebrafish
Match: CABZ01071939.1 (pep chromosome:GRCz11:19:2018796:2029777:-1 gene:ENSDARG00000086326.3 transcript:ENSDART00000128639.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01071939.1)

HSP 1 Score: 51.9878 bits (123), Expect = 9.475e-7
Identity = 37/118 (31.36%), Postives = 57/118 (48.31%), Query Frame = 2
Query:  317 LLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTDFKYE 670
            LL  G  I++ + YG  ALH +   N +D+V   L +   D+N  N  GF+ALH+   S      LE LI      + +LN  +K   +PL  +  H  +   + +I NGA  + + E
Sbjct:   71 LLSLGVDINEPNAYGNTALHLACF-NGQDVVVNELIAAGADVNQVNEKGFSALHFTAASRQGALCLELLIAN----RANLNCKSKDGKTPLHMAAIHGRYSRSQAIIQNGAEINCEDE 183          
BLAST of SMED30032529 vs. Ensembl Zebrafish
Match: ankrd44 (ankyrin repeat domain 44 [Source:ZFIN;Acc:ZDB-GENE-070912-605])

HSP 1 Score: 51.9878 bits (123), Expect = 1.017e-6
Identity = 35/115 (30.43%), Postives = 53/115 (46.09%), Query Frame = 2
Query:  317 LLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTDF 661
            LL    +ID+ + +G  ALH +   N +D V   L  +  +++  NN GFT LH+A  S      LE L+         +N+ ++   SPL  +  H  F   + LI NG   D 
Sbjct:  216 LLSLAVEIDEANAFGNTALHVACF-NGQDAVVSELIDYGANVSQPNNKGFTPLHFAAASTHGALCLEFLV----NSGADVNVQSRDGKSPLHLTAVHGRFTRSQTLIQNGGEIDC 325          
BLAST of SMED30032529 vs. Ensembl Zebrafish
Match: ankrd44 (ankyrin repeat domain 44 [Source:ZFIN;Acc:ZDB-GENE-070912-605])

HSP 1 Score: 51.9878 bits (123), Expect = 1.060e-6
Identity = 35/115 (30.43%), Postives = 53/115 (46.09%), Query Frame = 2
Query:  317 LLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTDF 661
            LL    +ID+ + +G  ALH +   N +D V   L  +  +++  NN GFT LH+A  S      LE L+         +N+ ++   SPL  +  H  F   + LI NG   D 
Sbjct:  225 LLSLAVEIDEANAFGNTALHVACF-NGQDAVVSELIDYGANVSQPNNKGFTPLHFAAASTHGALCLEFLV----NSGADVNVQSRDGKSPLHLTAVHGRFTRSQTLIQNGGEIDC 334          
BLAST of SMED30032529 vs. Ensembl Zebrafish
Match: rai14 (retinoic acid induced 14 [Source:ZFIN;Acc:ZDB-GENE-040718-235])

HSP 1 Score: 51.6026 bits (122), Expect = 1.493e-6
Identity = 42/159 (26.42%), Postives = 73/159 (45.91%), Query Frame = 2
Query:  173 AIYRGLFKQVRELLNKEADPDEKIKSKTAIMLCTFLTDTFWAKSLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGA 649
            A+  G   +V  LL+K+     K+ S+    L      T         +L +GA +  +D  GF ALH +   N  +  +  L +    ++  ++ G TALH+A    +  EI++ L     + KY +N+ +    +PL+ S RH +    + L+D GA
Sbjct:   26 AVEHGEADKVTSLLSKKGASPTKLDSEGKSAL--HAAATRGQTECLAVILAHGADVSLQDASGFTALHLAAKNNHPECAKKLLQNKCV-VDAPDSSGRTALHHAAACGNN-EIVQLLC----ENKYHVNLKDSDGFTPLLLSARHAHAEVCQSLLDWGA 176          
BLAST of SMED30032529 vs. Ensembl Zebrafish
Match: rai14 (retinoic acid induced 14 [Source:ZFIN;Acc:ZDB-GENE-040718-235])

HSP 1 Score: 51.6026 bits (122), Expect = 1.527e-6
Identity = 42/159 (26.42%), Postives = 73/159 (45.91%), Query Frame = 2
Query:  173 AIYRGLFKQVRELLNKEADPDEKIKSKTAIMLCTFLTDTFWAKSLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGA 649
            A+  G   +V  LL+K+     K+ S+    L      T         +L +GA +  +D  GF ALH +   N  +  +  L +    ++  ++ G TALH+A    +  EI++ L     + KY +N+ +    +PL+ S RH +    + L+D GA
Sbjct:   26 AVEHGEADKVTSLLSKKGASPTKLDSEGKSAL--HAAATRGQTECLAVILAHGADVSLQDASGFTALHLAAKNNHPECAKKLLQNKCV-VDAPDSSGRTALHHAAACGNN-EIVQLLC----ENKYHVNLKDSDGFTPLLLSARHAHAEVCQSLLDWGA 176          
BLAST of SMED30032529 vs. Ensembl Xenopus
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:NCBI gene;Acc:549110])

HSP 1 Score: 55.4546 bits (132), Expect = 3.345e-8
Identity = 36/133 (27.07%), Postives = 59/133 (44.36%), Query Frame = 2
Query:  281 TDTFWAKSLSFT-----LLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTDFK 664
            T   WA S   T     LL  G  +D KD+ G+  LH +    + D+V   +      +N  N  G T LHYA  S++K EI       + +   S +  +   ++PL  +    N   V++L+ + A T+ +
Sbjct:   43 TALHWACSAGRTEVAEYLLRLGVPVDAKDDAGWTPLHIAASAGRDDIVRALIGKG-AQVNAANQIGCTPLHYAA-SKNKHEI----ALMLLENGASPDAKDNLESTPLHRAASKGNLRIVQILLKHQASTNIQ 169          
BLAST of SMED30032529 vs. Ensembl Xenopus
Match: ankrd52 (ankyrin repeat domain 52 [Source:NCBI gene;Acc:100127696])

HSP 1 Score: 51.2174 bits (121), Expect = 2.629e-6
Identity = 36/114 (31.58%), Postives = 55/114 (48.25%), Query Frame = 2
Query:  317 LLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTD 658
            LL+ G +ID+ + +G  ALH +    + D V   L ++  ++N  N  GFT LH+A  S +    LE L+         +N  +K   SPL  +  H  F   ++LI NG   D
Sbjct:  229 LLKLGVEIDEPNAFGNTALHIACYMGQ-DAVANELVNYGSNVNQPNEKGFTPLHFAAVSTNGALCLELLV----NNGADVNFQSKEGKSPLHMAAIHGRFTRSQILIQNGGEID 337          
BLAST of SMED30032529 vs. Ensembl Xenopus
Match: ankrd52 (ankyrin repeat domain 52 [Source:NCBI gene;Acc:100127696])

HSP 1 Score: 51.2174 bits (121), Expect = 2.647e-6
Identity = 36/114 (31.58%), Postives = 55/114 (48.25%), Query Frame = 2
Query:  317 LLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTD 658
            LL+ G +ID+ + +G  ALH +    + D V   L ++  ++N  N  GFT LH+A  S +    LE L+         +N  +K   SPL  +  H  F   ++LI NG   D
Sbjct:  225 LLKLGVEIDEPNAFGNTALHIACYMGQ-DAVANELVNYGSNVNQPNEKGFTPLHFAAVSTNGALCLELLV----NNGADVNFQSKEGKSPLHMAAIHGRFTRSQILIQNGGEID 333          
BLAST of SMED30032529 vs. Ensembl Xenopus
Match: ankrd52 (ankyrin repeat domain 52 [Source:NCBI gene;Acc:100127696])

HSP 1 Score: 51.2174 bits (121), Expect = 3.017e-6
Identity = 36/114 (31.58%), Postives = 55/114 (48.25%), Query Frame = 2
Query:  317 LLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTD 658
            LL+ G +ID+ + +G  ALH +    + D V   L ++  ++N  N  GFT LH+A  S +    LE L+         +N  +K   SPL  +  H  F   ++LI NG   D
Sbjct:  225 LLKLGVEIDEPNAFGNTALHIACYMGQ-DAVANELVNYGSNVNQPNEKGFTPLHFAAVSTNGALCLELLV----NNGADVNFQSKEGKSPLHMAAIHGRFTRSQILIQNGGEID 333          
BLAST of SMED30032529 vs. Ensembl Xenopus
Match: ankrd52 (ankyrin repeat domain 52 [Source:NCBI gene;Acc:100127696])

HSP 1 Score: 51.2174 bits (121), Expect = 3.078e-6
Identity = 36/114 (31.58%), Postives = 55/114 (48.25%), Query Frame = 2
Query:  317 LLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTD 658
            LL+ G +ID+ + +G  ALH +    + D V   L ++  ++N  N  GFT LH+A  S +    LE L+         +N  +K   SPL  +  H  F   ++LI NG   D
Sbjct:  225 LLKLGVEIDEPNAFGNTALHIACYMGQ-DAVANELVNYGSNVNQPNEKGFTPLHFAAVSTNGALCLELLV----NNGADVNFQSKEGKSPLHMAAIHGRFTRSQILIQNGGEID 333          
BLAST of SMED30032529 vs. Ensembl Mouse
Match: Ankrd44 (ankyrin repeat domain 44 [Source:MGI Symbol;Acc:MGI:3045243])

HSP 1 Score: 56.9954 bits (136), Expect = 3.178e-8
Identity = 40/115 (34.78%), Postives = 54/115 (46.96%), Query Frame = 2
Query:  317 LLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTDF 661
            LL  G +ID+ + YG  ALH +   N +D V   L  +  ++N  NN GFT LH+A  S      LE L+         +NI +K   SPL  +  H  F   + LI NG   D 
Sbjct:  225 LLNLGVEIDEINVYGNTALHIACY-NGQDAVVNELIDYGANVNQPNNSGFTPLHFAAASTHGALCLELLV----NNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDC 334          
BLAST of SMED30032529 vs. Ensembl Mouse
Match: Ankrd44 (ankyrin repeat domain 44 [Source:MGI Symbol;Acc:MGI:3045243])

HSP 1 Score: 56.9954 bits (136), Expect = 3.364e-8
Identity = 40/115 (34.78%), Postives = 54/115 (46.96%), Query Frame = 2
Query:  317 LLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTDF 661
            LL  G +ID+ + YG  ALH +   N +D V   L  +  ++N  NN GFT LH+A  S      LE L+         +NI +K   SPL  +  H  F   + LI NG   D 
Sbjct:  225 LLNLGVEIDEINVYGNTALHIACY-NGQDAVVNELIDYGANVNQPNNSGFTPLHFAAASTHGALCLELLV----NNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDC 334          
BLAST of SMED30032529 vs. Ensembl Mouse
Match: Ankrd44 (ankyrin repeat domain 44 [Source:MGI Symbol;Acc:MGI:3045243])

HSP 1 Score: 56.6102 bits (135), Expect = 4.315e-8
Identity = 40/114 (35.09%), Postives = 54/114 (47.37%), Query Frame = 2
Query:  317 LLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTD 658
            LL  G +ID+ + YG  ALH +   N +D V   L  +  ++N  NN GFT LH+A  S      LE L+         +NI +K   SPL  +  H  F   + LI NG   D
Sbjct:   22 LLNLGVEIDEINVYGNTALHIACY-NGQDAVVNELIDYGANVNQPNNSGFTPLHFAAASTHGALCLELLV----NNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEID 130          
BLAST of SMED30032529 vs. Ensembl Mouse
Match: Ankrd52 (ankyrin repeat domain 52 [Source:MGI Symbol;Acc:MGI:2444029])

HSP 1 Score: 54.6842 bits (130), Expect = 1.636e-7
Identity = 38/114 (33.33%), Postives = 55/114 (48.25%), Query Frame = 2
Query:  317 LLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTD 658
            LL  GA+ID+ + +G  ALH +    + D V I L +   ++N  N+ GFT LH A  S +    LE L+       Y     +K   SPL  +  H  F   ++LI NG+  D
Sbjct:  225 LLRMGAEIDEPNAFGNTALHIACYLGQ-DAVAIELVNAGANVNQPNDKGFTPLHVAAVSTNGALCLELLVNNGADVNYQ----SKEGKSPLHMAAIHGRFTRSQILIQNGSEID 333          
BLAST of SMED30032529 vs. Ensembl Mouse
Match: A26c3 (ANKRD26-like family C, member 3 [Source:MGI Symbol;Acc:MGI:1914825])

HSP 1 Score: 50.0618 bits (118), Expect = 3.385e-6
Identity = 46/165 (27.88%), Postives = 82/165 (49.70%), Query Frame = 2
Query:  293 WAKSLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNG---------ARTDFKY--EGLS------FLDYFNNLKRKLKET-PEY 733
            W       LL++GA  ++KD+ G  +LH++V ++ + L +  L  +  ++  KN  GFT L  A+  E+KIE+ + L+    K   ++++ +    + L+ +IR  +   V +L+D G           T  +Y  EG S       ++Y   L+RK K+  PEY
Sbjct:  123 WTYECVCILLKHGADPNRKDKNGNTSLHYAVSEDNQTLAKCLL-KYSANMEQKNKDGFTPLLLAL-KENKIEMAKFLV----KMGANIHVFDDMRRNTLLYAIRWDSKDMVNLLLDEGIDFFFRDVFGWTALRYAIEGTSKGSREILMNYDEMLRRKNKDGIPEY 281          
BLAST of SMED30032529 vs. UniProt/SwissProt
Match: sp|B2RXR6|ANR44_MOUSE (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus OX=10090 GN=Ankrd44 PE=1 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 2.223e-7
Identity = 40/115 (34.78%), Postives = 54/115 (46.96%), Query Frame = 2
Query:  317 LLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTDF 661
            LL  G +ID+ + YG  ALH +   N +D V   L  +  ++N  NN GFT LH+A  S      LE L+         +NI +K   SPL  +  H  F   + LI NG   D 
Sbjct:  225 LLNLGVEIDEINVYGNTALHIACY-NGQDAVVNELIDYGANVNQPNNSGFTPLHFAAASTHGALCLELLV----NNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDC 334          
BLAST of SMED30032529 vs. UniProt/SwissProt
Match: sp|Q8N8A2|ANR44_HUMAN (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens OX=9606 GN=ANKRD44 PE=1 SV=3)

HSP 1 Score: 56.6102 bits (135), Expect = 3.290e-7
Identity = 40/115 (34.78%), Postives = 54/115 (46.96%), Query Frame = 2
Query:  317 LLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTDF 661
            LL  G +ID+ + YG  ALH +   N +D V   L  +  ++N  NN GFT LH+A  S      LE L+         +NI +K   SPL  +  H  F   + LI NG   D 
Sbjct:  225 LLNLGVEIDEINVYGNTALHIACY-NGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLV----NNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDC 334          
BLAST of SMED30032529 vs. UniProt/SwissProt
Match: sp|Q5F478|ANR44_CHICK (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus OX=9031 GN=ANKRD44 PE=2 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 4.499e-7
Identity = 37/114 (32.46%), Postives = 54/114 (47.37%), Query Frame = 2
Query:  317 LLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTD 658
            LL  G +ID+ + YG  ALH +    +  +V   ++ +  ++N  NN GFT LH+A  S      LE L+         +NI +K   SPL  +  H  F   + LI NG   D
Sbjct:  225 LLNLGVEIDEMNIYGNTALHIACYNGQDSVVNELID-YGANVNQPNNNGFTPLHFAAASTHGALCLELLV----NNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEID 333          
BLAST of SMED30032529 vs. UniProt/SwissProt
Match: sp|Q4UMH6|Y381_RICFE (Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0381 PE=4 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 6.080e-7
Identity = 43/162 (26.54%), Postives = 73/162 (45.06%), Query Frame = 2
Query:  173 AIYRGLFKQVRELLNKEADPDEKIKSKTAIMLCTFLTDTFWAKSLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTD 658
            A+  G    V+ L+  +A+   K  +   ++       +F    L + L+ YGA ++ K + G  ALH++V     DLV + + S   D+N K N G T L+ AV+  S       L++ +  Y   +N       + L  ++   N   V +LI NGA  +
Sbjct:  678 AVKSGNLHLVKWLIENQANIHAKTDNGETVL---HYAVSFNNSDLVYLLIAYGADVNAKTDNGLTALHYAVYDGNLDLVSLLI-SHGADVNAKTNSGETILYSAVDYGS-----PDLVYLLIAYGADVNAKTDNGETVLHYAVESGNLDLVSLLIHNGANVN 830          
BLAST of SMED30032529 vs. UniProt/SwissProt
Match: sp|Q8BTI7|ANR52_MOUSE (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus OX=10090 GN=Ankrd52 PE=1 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 1.145e-6
Identity = 38/114 (33.33%), Postives = 55/114 (48.25%), Query Frame = 2
Query:  317 LLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTD 658
            LL  GA+ID+ + +G  ALH +    + D V I L +   ++N  N+ GFT LH A  S +    LE L+       Y     +K   SPL  +  H  F   ++LI NG+  D
Sbjct:  225 LLRMGAEIDEPNAFGNTALHIACYLGQ-DAVAIELVNAGANVNQPNDKGFTPLHVAAVSTNGALCLELLVNNGADVNYQ----SKEGKSPLHMAAIHGRFTRSQILIQNGSEID 333          
BLAST of SMED30032529 vs. TrEMBL
Match: A0A267DSQ1 (ANK_REP_REGION domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020439g2 PE=4 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 4.750e-22
Identity = 53/151 (35.10%), Postives = 90/151 (59.60%), Query Frame = 2
Query:  155 ASSPAEAIYRGLFKQVRELLN----KEADPDEKIKS-KTAIMLCTFLTDTFWAKSLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLM 592
            ++SPAEAI  G F QVR LL       AD  E +   +T ++LC+ + D  W+ SL+  LLE GAK+  KD  G NALH++    +++L E+FL + D+ ++  + +  +A+HYAV    ++ I+E+L   +++ +  ++  N+   +PLM
Sbjct:   56 SASPAEAILAGYFAQVRYLLQTGGRGAADTREPLAGGRTPLILCSLVRDRCWSVSLARLLLEKGAKVGLKDRRGMNALHYACAHGREELAELFLQAIDYRVDAADGYRNSAMHYAVRG-GRLRIVEALAKVLQRLQLPVSPPNREGVTPLM 205          
BLAST of SMED30032529 vs. TrEMBL
Match: A0A267E3L7 (ANK_REP_REGION domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020439g1 PE=4 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 5.222e-22
Identity = 53/151 (35.10%), Postives = 90/151 (59.60%), Query Frame = 2
Query:  155 ASSPAEAIYRGLFKQVRELLN----KEADPDEKIKS-KTAIMLCTFLTDTFWAKSLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLM 592
            ++SPAEAI  G F QVR LL       AD  E +   +T ++LC+ + D  W+ SL+  LLE GAK+  KD  G NALH++    +++L E+FL + D+ ++  + +  +A+HYAV    ++ I+E+L   +++ +  ++  N+   +PLM
Sbjct:   63 SASPAEAILAGYFAQVRYLLQTGGRGAADTREPLAGGRTPLILCSLVRDRCWSVSLARLLLEKGAKVGLKDRRGMNALHYACAHGREELAELFLQAIDYRVDAADGYRNSAMHYAVRG-GRLRIVEALAKVLQRLQLPVSPPNREGVTPLM 212          
BLAST of SMED30032529 vs. TrEMBL
Match: A0A1I8H035 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 5.726e-22
Identity = 53/151 (35.10%), Postives = 90/151 (59.60%), Query Frame = 2
Query:  155 ASSPAEAIYRGLFKQVRELLN----KEADPDEKIKS-KTAIMLCTFLTDTFWAKSLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLM 592
            ++SPAEAI  G F QVR LL       AD  E +   +T ++LC+ + D  W+ SL+  LLE GAK+  KD  G NALH++    +++L E+FL + D+ ++  + +  +A+HYAV    ++ I+E+L   +++ +  ++  N+   +PLM
Sbjct:   33 SASPAEAILAGYFAQVRYLLQTGGRGAADTREPLAGGRTPLILCSLVRDRCWSVSLARLLLEKGAKVGLKDRRGMNALHYACAHGREELAELFLQAIDYRVDAADGYRNSAMHYAVRG-GRLRIVEALAKVLQRLQLPVSPPNREGVTPLM 182          
BLAST of SMED30032529 vs. TrEMBL
Match: A0A267GAP7 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013982g1 PE=4 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 8.183e-22
Identity = 52/151 (34.44%), Postives = 90/151 (59.60%), Query Frame = 2
Query:  155 ASSPAEAIYRGLFKQVRELLN----KEADPDEKIKS-KTAIMLCTFLTDTFWAKSLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLM 592
            ++SPAEAI  G F QVR LL       AD  E +   +T ++LC+ + D  W+ SL+  LLE GAK+  KD  G NALH++    +++L E+FL + D+ ++  + +  +A+HYAV    ++ ++E+L   +++ +  ++  N+   +PLM
Sbjct:   14 SASPAEAILAGYFAQVRYLLQTGGRGAADTREPLAGGRTPLILCSLVRDRCWSVSLARLLLEKGAKVGLKDRRGMNALHYACAHGREELAELFLQAIDYRVDAADGYRNSAMHYAVRG-GRLRVVEALAKVLQRLQLPVSPPNREGVTPLM 163          
BLAST of SMED30032529 vs. TrEMBL
Match: A0A1S3KG74 (uncharacterized protein LOC106181577 OS=Lingula unguis OX=7574 GN=LOC106181577 PE=4 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 3.434e-21
Identity = 55/159 (34.59%), Postives = 93/159 (58.49%), Query Frame = 2
Query:  173 AIYRGLFKQVRELLNKEADPDEKIKSK-TAIMLCTFLTDTFWAKSLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNG 646
            AI RG F+QVR L+   +D + K +   T ++LC  + +  W   LS  LLE GA +  +D+ G NALH++ +  + +LV +FL + D+D+N  + FG TALHYAV S   ++I   L+  ++KY  +++  N+   +PL+++         ++L+D G
Sbjct:   15 AIKRGFFQQVRFLIELGSDVNGKDEDGLTPLILCAMIEEEEWGVGLSRLLLEKGASVGFRDKRGLNALHYACLYQRLELVRVFLCAIDYDLNQGDKFGNTALHYAV-SVGNVDITRLLLRTLQKYGMTVDKPNRRGFTPLIQAWSTGRVTCAQILVDEG 172          
BLAST of SMED30032529 vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 53.5286 bits (127), Expect = 3.534e-7
Identity = 40/140 (28.57%), Postives = 69/140 (49.29%), Query Frame = 2
Query:  185 GLFKQVRELLNKEADP-DEKIKSKTAIMLCTFLTDTFWAKSLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESI 601
            G   +VREL+ K  D  D K + KTA+ +          K     LL+  + I+ KDE G  ALH++   N+ ++  + L S   ++N  NN   TALH AVN          ++  + ++   +N+ + + ++PL ++I
Sbjct:  499 GSATKVRELVQKHPDKVDIKNQGKTALQVAAHQGHMEVVK----VLLQANSSIEAKDEDGDAALHYTAFGNQAEIARLLL-SKGANVNLLNNSMCTALHIAVNKG-----FTDVVRVLTEHSADVNLQDSYGDTPLHDAI 628          
BLAST of SMED30032529 vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 53.1434 bits (126), Expect = 3.729e-7
Identity = 40/140 (28.57%), Postives = 69/140 (49.29%), Query Frame = 2
Query:  185 GLFKQVRELLNKEADP-DEKIKSKTAIMLCTFLTDTFWAKSLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESI 601
            G   +VREL+ K  D  D K + KTA+ +          K     LL+  + I+ KDE G  ALH++   N+ ++  + L S   ++N  NN   TALH AVN          ++  + ++   +N+ + + ++PL ++I
Sbjct:  505 GSATKVRELVQKHPDKVDIKNQGKTALQVAAHQGHMEVVK----VLLQANSSIEAKDEDGDAALHYTAFGNQAEIARLLL-SKGANVNLLNNSMCTALHIAVNKG-----FTDVVRVLTEHSADVNLQDSYGDTPLHDAI 634          
BLAST of SMED30032529 vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 53.1434 bits (126), Expect = 3.963e-7
Identity = 44/160 (27.50%), Postives = 77/160 (48.12%), Query Frame = 2
Query:  125 FKRSIFRNNQASSPAEAIYRGLFKQVRELLNKEADP-DEKIKSKTAIMLCTFLTDTFWAKSLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESI 601
              +S  ++N      EA + G   +VREL+ K  D  D K + KTA+ +          K     LL+  + I+ KDE G  ALH++   N+ ++  + L S   ++N  NN   TALH AVN          ++  + ++   +N+ + + ++PL ++I
Sbjct:  425 LSQSTEQDNPGRLVIEAAH-GSATKVRELVQKHPDKVDIKNQGKTALQVAAHQGHMEVVK----VLLQANSSIEAKDEDGDAALHYTAFGNQAEIARLLL-SKGANVNLLNNSMCTALHIAVNKG-----FTDVVRVLTEHSADVNLQDSYGDTPLHDAI 573          
BLAST of SMED30032529 vs. Ensembl Cavefish
Match: ankrd52a (ankyrin repeat domain 52a [Source:NCBI gene;Acc:553206])

HSP 1 Score: 52.7582 bits (125), Expect = 4.950e-7
Identity = 35/115 (30.43%), Postives = 55/115 (47.83%), Query Frame = 2
Query:  317 LLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTDF 661
            LL  GA+ID+ + +G  ALH +    ++ +    +N    ++N  NN G+T LH A  S +    LE L+         +N+ +K   SPL  +  H  F   ++LI NG   D 
Sbjct:  216 LLRNGAEIDEPNAFGNTALHVACYMGQEAVANELVNR-GANVNQPNNRGYTPLHLAAVSTNGALCLELLV----NNGADVNMQSKEGKSPLHMAAIHGRFTRSQILIQNGGEIDC 325          
BLAST of SMED30032529 vs. Ensembl Cavefish
Match: ENSAMXT00000031513.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002164.1:626:64909:-1 gene:ENSAMXG00000032083.1 transcript:ENSAMXT00000031513.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 5.313e-7
Identity = 35/114 (30.70%), Postives = 55/114 (48.25%), Query Frame = 2
Query:  317 LLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTD 658
            LL  GA+ID+ + +G  ALH +    ++ +    +N    ++N  NN G+T LH A  S +    LE L+         +N+ +K   SPL  +  H  F   ++LI NG   D
Sbjct:  219 LLRNGAEIDEPNAFGNTALHVACYTGQEAVANELVNR-GANVNQPNNRGYTPLHLAAVSTNGALCLELLV----NNGADVNMQSKEGKSPLHMAAIHGRFTRSQILIQNGGEID 327          
BLAST of SMED30032529 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 4.705e-8
Identity = 33/120 (27.50%), Postives = 55/120 (45.83%), Query Frame = 2
Query:  305 LSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTDFK 664
            ++ TLLEYGA+ +     G   LH    +   D+  + L  +  D+N     G + LH A   E K+ + E L+    K+   +N   K   +PL+ +  + N   V  L+ +GA  + K
Sbjct:  261 IATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYA-DVNHATKSGLSPLHLAAQ-EDKVNVAEILV----KHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSK 374          
BLAST of SMED30032529 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 6.001e-8
Identity = 37/116 (31.90%), Postives = 53/116 (45.69%), Query Frame = 2
Query:  317 LLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTDFK 664
            LL+ G  ID  + +G  ALH +   N +D+V   L     ++N  N  GFT LH+A  S      LE L+         +N+ +K   SPL  +  H  F   + LI NG   D +
Sbjct:  223 LLDLGVDIDDPNSFGNTALHVACY-NGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLV----NNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCE 333          
BLAST of SMED30032529 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 2.160e-6
Identity = 33/120 (27.50%), Postives = 55/120 (45.83%), Query Frame = 2
Query:  305 LSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTDFK 664
            ++ TLLEYGA+ +     G   LH    +   D+  + L  +  D+N     G + LH A   E K+ + E L+    K+   +N   K   +PL+ +  + N   V  L+ +GA  + K
Sbjct:  351 IATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYA-DVNHATKSGLSPLHLAAQ-EDKVNVAEILV----KHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSK 464          
BLAST of SMED30032529 vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 48.521 bits (114), Expect = 1.698e-6
Identity = 33/103 (32.04%), Postives = 55/103 (53.40%), Query Frame = 2
Query:  347 KDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNI--LNKFNNSPLMESIRHLNFHAVEVLIDNGA 649
            +D  G   L  +  K K D+V+  +    +DIN ++N G TALH A   +  IEI+E LI    +    +NI  +  F ++PL+++  + +   V+ L+ NGA
Sbjct:  326 RDSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAA-LQGHIEIVELLI----ENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGA 423          
BLAST of SMED30032529 vs. Ensembl Nematostella
Match: EDO38263 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDI0])

HSP 1 Score: 66.2402 bits (160), Expect = 9.164e-12
Identity = 45/162 (27.78%), Postives = 82/162 (50.62%), Query Frame = 2
Query:  173 AIYRGLFKQVR---ELLNKEADPDEKIKSKTAIMLCTFLTDTFWAKSLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSF-DFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNG 646
            A+    F+Q +   E+ N + +  ++ K +TA+M   FL +   A  L+  LL +GA++  +D  G  AL ++    ++ LV   +     FD N  +  G TALHYA  S + + +L  ++  +K++K S +  N    +PL+ + +  NF    +L+  G
Sbjct:   50 AVKSKRFRQAKILIEMGNIDVNARDETK-RTALMELCFLEEENKAAKLARMLLSHGARVGIRDTDGMTALSYAAKLGREQLVSAMMEEVHSFDPNAADKHGNTALHYASMSGNFV-VLNLILKTLKRFKLSADKPNNAGETPLICASKTGNFLCARILVSEG 209          
BLAST of SMED30032529 vs. Ensembl Nematostella
Match: EDO41179 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S546])

HSP 1 Score: 62.3882 bits (150), Expect = 1.076e-10
Identity = 43/159 (27.04%), Postives = 88/159 (55.35%), Query Frame = 2
Query:  173 AIYRGLFKQVRELLNKEADPDEKI-KSKTAIMLCTFLTDTFWAKSLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNG 646
            AI +  ++Q R L+   AD + +  + +T +M   F+ +   A S++  LLE G  +  KD+ G  AL ++ I  KK L++      D+D+N  +  G TAL+YA+ +  +  ++E L+ ++K Y  +++ +N+   +PL+ +++       ++L++ G
Sbjct:    7 AIIQRRWRQARLLVEVGADVNRQGDEGRTPLMELCFVDNEDKACSMAKLLLENGGNVGIKDKQGKTALSYACILKKKKLLKWLTRFVDYDLNSTDLDGNTALNYAILAGDETVVME-LVRKLKAYGLTVDTINRKGETPLINALKSERTDIADILLEIG 164          
BLAST of SMED30032529 vs. Ensembl Nematostella
Match: EDO42585 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S176])

HSP 1 Score: 54.299 bits (129), Expect = 1.513e-9
Identity = 34/95 (35.79%), Postives = 58/95 (61.05%), Query Frame = 2
Query:  317 LLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSF-DFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMES 598
            L++ GAKI  KD++G NA+  +V+  K+ L+ +FL     F+IN ++  G TAL YA  S     IL  L+   +K++ S+++ NK   +PL+++
Sbjct:    8 LVDNGAKIALKDKHGRNAVMKAVLSEKEKLLTLFLTRVSSFNINDRDKKGNTALFYAA-SIGNFHILRKLVVVYRKFRLSVDVTNKDGMTPLIQA 101          
BLAST of SMED30032529 vs. Ensembl Nematostella
Match: EDO33642 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRL7])

HSP 1 Score: 56.6102 bits (135), Expect = 1.047e-8
Identity = 40/166 (24.10%), Postives = 85/166 (51.20%), Query Frame = 2
Query:  158 SSPAEAIYRGLFKQVRELLNKEADPDEKIK--SKTAIMLCTFLTDTFWAKSLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYK-YSLNILNKFNNSPLMESIRHLNFHAVEVLIDNG 646
            SS A+A+    F+Q + L+    D + + K   ++ ++  + + D   +  +   LL+ GA I  +D++G NA      + +  +  +FL   DFD+N ++  G TAL YAV +   I    +++ +++K +    +  NK   +PL+ + +  +    ++L+++G
Sbjct:    2 SSLAKALEERRFRQAKLLVQLGDDLNSRSKETGRSPLVQASLIEDEDLSYKVCHWLLQEGADIAVRDDHGMNAFMHVCRQGRTRIAALFLKHRDFDLNTQDFEGNTALSYAVIA-GDISTTSAIVAELRKRRIRGADKQNKNGETPLIIAAKLGHKGCADILLNDG 166          
BLAST of SMED30032529 vs. Ensembl Nematostella
Match: EDO32718 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU82])

HSP 1 Score: 51.9878 bits (123), Expect = 4.536e-8
Identity = 45/169 (26.63%), Postives = 88/169 (52.07%), Query Frame = 2
Query:  170 EAIYRGLFKQVRELLNKEADPDEKI-KSKTAIMLCTFLTDTFWAKSLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLN--SFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKY--SLNILNKFNN---SPLMESIRHLNFHAVEVLIDNGAR 652
             A+  G   QVR LL    + + +  + +TA++ C FL +    +++   LL  GAK++K+D  G +AL ++ ++   D+V   +N    + D+N  +N G T+L  AV S   +E++  L+  +++     + + +++ NN   SPL+ +    +     VL+  GA+
Sbjct:    5 SAVRFGRTHQVRLLLKAGINTENRDDRGRTALVYCCFLKNPQTRQTILKLLLASGAKVNKRDHLGRSALLWACLQGLVDVVTSLVNDSQSEVDLNLTDNDGNTSLLLAVKS-GNLEMVRLLLSLLRRSLSNNTTSFIHRCNNRGISPLLAAFLRGDKDCARVLVQGGAQ 172          
BLAST of SMED30032529 vs. Ensembl Medaka
Match: ENSORLT00000005069.2 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A [Source:NCBI gene;Acc:101168382])

HSP 1 Score: 53.5286 bits (127), Expect = 3.547e-7
Identity = 44/164 (26.83%), Postives = 71/164 (43.29%), Query Frame = 2
Query:  173 AIYRGLFKQVRELLNKEADPDEKIKSKTAIMLCTFLTDTFWAKSLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTDFK 664
            A Y G  + V+ L+   A+ D K K   + +       +    S    LL  G  +++ + YG   LH +   N +D+V   L     ++N  N  GF+ALH+A +S       E L+     +   +N  +K   +PL  +  H  F   + LI NGA  D +
Sbjct:  223 AAYMGHLEVVKLLVESGAEVDCKDKKGYSPL---HAAASSGMSSTVHYLLGLGVHVNEANSYGNTPLHLACY-NGQDVVVGELIQAGANVNQVNERGFSALHFASSSRQGALCQELLL----AHGACINSRSKDGKTPLHMAATHGRFSCSQALIQNGAEVDCE 378          
BLAST of SMED30032529 vs. Ensembl Medaka
Match: ENSORLT00000028696.1 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A [Source:NCBI gene;Acc:101168382])

HSP 1 Score: 53.1434 bits (126), Expect = 3.763e-7
Identity = 44/164 (26.83%), Postives = 71/164 (43.29%), Query Frame = 2
Query:  173 AIYRGLFKQVRELLNKEADPDEKIKSKTAIMLCTFLTDTFWAKSLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTDFK 664
            A Y G  + V+ L+   A+ D K K   + +       +    S    LL  G  +++ + YG   LH +   N +D+V   L     ++N  N  GF+ALH+A +S       E L+     +   +N  +K   +PL  +  H  F   + LI NGA  D +
Sbjct:  180 AAYMGHLEVVKLLVESGAEVDCKDKKGYSPL---HAAASSGMSSTVHYLLGLGVHVNEANSYGNTPLHLACY-NGQDVVVGELIQAGANVNQVNERGFSALHFASSSRQGALCQELLL----AHGACINSRSKDGKTPLHMAATHGRFSCSQALIQNGAEVDCE 335          
BLAST of SMED30032529 vs. Ensembl Medaka
Match: ENSORLT00000037670.1 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A [Source:NCBI gene;Acc:101168382])

HSP 1 Score: 53.1434 bits (126), Expect = 4.006e-7
Identity = 44/164 (26.83%), Postives = 71/164 (43.29%), Query Frame = 2
Query:  173 AIYRGLFKQVRELLNKEADPDEKIKSKTAIMLCTFLTDTFWAKSLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTDFK 664
            A Y G  + V+ L+   A+ D K K   + +       +    S    LL  G  +++ + YG   LH +   N +D+V   L     ++N  N  GF+ALH+A +S       E L+     +   +N  +K   +PL  +  H  F   + LI NGA  D +
Sbjct:  180 AAYMGHLEVVKLLVESGAEVDCKDKKGYSPL---HAAASSGMSSTVHYLLGLGVHVNEANSYGNTPLHLACY-NGQDVVVGELIQAGANVNQVNERGFSALHFASSSRQGALCQELLL----AHGACINSRSKDGKTPLHMAATHGRFSCSQALIQNGAEVDCE 335          
BLAST of SMED30032529 vs. Ensembl Medaka
Match: ENSORLT00000045754.1 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A [Source:NCBI gene;Acc:101168382])

HSP 1 Score: 53.1434 bits (126), Expect = 4.006e-7
Identity = 44/164 (26.83%), Postives = 71/164 (43.29%), Query Frame = 2
Query:  173 AIYRGLFKQVRELLNKEADPDEKIKSKTAIMLCTFLTDTFWAKSLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTDFK 664
            A Y G  + V+ L+   A+ D K K   + +       +    S    LL  G  +++ + YG   LH +   N +D+V   L     ++N  N  GF+ALH+A +S       E L+     +   +N  +K   +PL  +  H  F   + LI NGA  D +
Sbjct:  180 AAYMGHLEVVKLLVESGAEVDCKDKKGYSPL---HAAASSGMSSTVHYLLGLGVHVNEANSYGNTPLHLACY-NGQDVVVGELIQAGANVNQVNERGFSALHFASSSRQGALCQELLL----AHGACINSRSKDGKTPLHMAATHGRFSCSQALIQNGAEVDCE 335          
BLAST of SMED30032529 vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 52.373 bits (124), Expect = 8.017e-7
Identity = 43/160 (26.88%), Postives = 76/160 (47.50%), Query Frame = 2
Query:  125 FKRSIFRNNQASSPAEAIYRGLFKQVRELLNKEADP-DEKIKSKTAIMLCTFLTDTFWAKSLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESI 601
              +S  ++N      EA +    K VREL+ K  D  D K + KTA+ +          K+L    L+    ++ KDE G  ALH++   N+ ++  + L S   ++N  NN   TALH AVN          ++  + ++   +N+ + + ++PL ++I
Sbjct:  416 LSQSTEQDNPCRLVIEAAHGSAVK-VRELVQKHPDKVDIKNQGKTALQVAAHQGHMEVVKAL----LQANCSVEVKDEDGDTALHYAAFGNQAEIARLLL-SKGANVNLLNNSMCTALHIAVNKG-----FTDVVRVLTEHSADVNLQDSYGDTPLHDAI 564          
BLAST of SMED30032529 vs. Planmine SMEST
Match: SMESG000077536.1 (SMESG000077536.1)

HSP 1 Score: 633.639 bits (1633), Expect = 0.000e+0
Identity = 357/360 (99.17%), Postives = 358/360 (99.44%), Query Frame = 2
Query:  119 MNFKRSIFRNNQASSPAEAIYRGLFKQVRELLNKEADPDEKIKSKTAIMLCTFLTDTFWAKSLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTDFKYEGLSFLDYFNNLKRKLKETPEYMXXXXXXXXXXXXXEELAMHDSIIRSVEQISIEEAPDFDIRNNSKWVVERPKSCITLHSFNENEESSWKTIMPIVLNQLEERISKSYRKNFSVEKIISNLKQFNHEAGDTTXXXXXXXXXXXXXXXXXXXXXXXXXXQDKLSKRSTNDGIKINKF 1198
            MNFKRSIFRNNQASSPAEAIYRGLFKQVRELLNKEADPDEKIKSKTAIMLCTFLTDTFWAKSLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDIN KNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKF+NSPLMESIRHLNFHA EVLIDNGARTDFKYEGLSFLDYFNNLKRKLKETPEYMINKIKKSIIINKNEELAMHDSIIRSVEQISIEEAPDFDIRNNSKWVVERPKSCITLHSFNENEESSWKTIMPIVLNQLEERISKSYRKNFSVEKIISNLKQFNHEAGDTTGKGRNGSSKKSNAKSKLNKKGSASSSQDKLSKRSTNDGIKINKF
Sbjct:    1 MNFKRSIFRNNQASSPAEAIYRGLFKQVRELLNKEADPDEKIKSKTAIMLCTFLTDTFWAKSLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINSKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFSNSPLMESIRHLNFHAAEVLIDNGARTDFKYEGLSFLDYFNNLKRKLKETPEYMINKIKKSIIINKNEELAMHDSIIRSVEQISIEEAPDFDIRNNSKWVVERPKSCITLHSFNENEESSWKTIMPIVLNQLEERISKSYRKNFSVEKIISNLKQFNHEAGDTTGKGRNGSSKKSNAKSKLNKKGSASSSQDKLSKRSTNDGIKINKF 360          
BLAST of SMED30032529 vs. Planmine SMEST
Match: SMESG000034080.1 (SMESG000034080.1)

HSP 1 Score: 62.003 bits (149), Expect = 2.904e-10
Identity = 41/116 (35.34%), Postives = 68/116 (58.62%), Query Frame = 2
Query:  155 ASSPAEAIYRGLFKQVRELL-NKEADPDEKIKSK-TAIMLCTFLTDTFWAKSLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSE 496
            +S   + I +G F Q ++ + N   D +E  ++K T ++LC+ + D  W  SL+  LLE GA I++ D+   N LH+  I  +K+L+++ L S DF+IN  +  G + L YA+ SE
Sbjct:    7 SSDICKLILKGYFAQAKDKIKNTNVDVNETNENKQTPLILCSLIEDPSWGISLAQLLLELGADIERADDNKMNVLHYCAIYQQKELLKLLLESVDFNINKGDILGNSPLIYAIVSE 122          
BLAST of SMED30032529 vs. Planmine SMEST
Match: SMESG000058588.1 (SMESG000058588.1)

HSP 1 Score: 56.225 bits (134), Expect = 3.834e-8
Identity = 44/132 (33.33%), Postives = 68/132 (51.52%), Query Frame = 2
Query:  317 LLEYGAKIDKK-DEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGAR-TDFKYEGLSFLDYFNNLK 706
            L  YGA  + K ++     LH + I     ++ +FL++ + +IN  +    T L YA   +S I+ +ESLI    +    +N  N   N+PL E++RH N   +E+LI +GA  T     GLS LD   +LK
Sbjct:  882 LFHYGADPNTKTNKLQLTPLHLAAIYGSIKVLNLFLHNANVNINAADKKLNTPLAYACAKDS-IDTVESLI----QAGALINTNNYKGNTPLHEAVRHNNASIIELLIKHGANITTLNANGLSPLDLSKDLK 1008          
BLAST of SMED30032529 vs. Planmine SMEST
Match: SMESG000058588.1 (SMESG000058588.1)

HSP 1 Score: 56.225 bits (134), Expect = 3.848e-8
Identity = 44/132 (33.33%), Postives = 68/132 (51.52%), Query Frame = 2
Query:  317 LLEYGAKIDKK-DEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGAR-TDFKYEGLSFLDYFNNLK 706
            L  YGA  + K ++     LH + I     ++ +FL++ + +IN  +    T L YA   +S I+ +ESLI    +    +N  N   N+PL E++RH N   +E+LI +GA  T     GLS LD   +LK
Sbjct:  902 LFHYGADPNTKTNKLQLTPLHLAAIYGSIKVLNLFLHNANVNINAADKKLNTPLAYACAKDS-IDTVESLI----QAGALINTNNYKGNTPLHEAVRHNNASIIELLIKHGANITTLNANGLSPLDLSKDLK 1028          
BLAST of SMED30032529 vs. Planmine SMEST
Match: SMESG000026655.1 (SMESG000026655.1)

HSP 1 Score: 49.6766 bits (117), Expect = 3.592e-6
Identity = 41/149 (27.52%), Postives = 74/149 (49.66%), Query Frame = 2
Query:  317 LLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILNKFNNSPLMESIRHLNFHAVEVLIDNGARTDFK-YEGLSFLD------YFNNLK--RKLKETPEYM 736
            LL+  A ++ + E G  ALH +  KN+ D+VE  L + + DI+ K   G+TALH AV+   +I+ ++ L+    +  + +N       + L  + +  +   V +L+DN    + +  +GL+ L+      Y N  +   K+   PE M
Sbjct:  717 LLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKT-EADISTKTQMGYTALHTAVHF-GQIQTVKMLL----EKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMM 859          
The following BLAST results are available for this feature:
BLAST of SMED30032529 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANKRD446.545e-835.09ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:H... [more]
ANKRD446.851e-834.78ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:H... [more]
ANKRD446.933e-835.09ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:H... [more]
ANKRD447.212e-835.09ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:H... [more]
ANKRD447.623e-835.09ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of SMED30032529 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032529 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kank6.256e-730.40gene:FBgn0027596 transcript:FBtr0303758[more]
Kank6.763e-731.62gene:FBgn0027596 transcript:FBtr0303756[more]
Kank7.805e-731.62gene:FBgn0027596 transcript:FBtr0087431[more]
Kank8.146e-731.62gene:FBgn0027596 transcript:FBtr0332856[more]
Kank9.751e-731.62gene:FBgn0027596 transcript:FBtr0087430[more]
back to top
BLAST of SMED30032529 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CABZ01071939.19.475e-731.36pep chromosome:GRCz11:19:2018796:2029777:-1 gene:E... [more]
ankrd441.017e-630.43ankyrin repeat domain 44 [Source:ZFIN;Acc:ZDB-GENE... [more]
ankrd441.060e-630.43ankyrin repeat domain 44 [Source:ZFIN;Acc:ZDB-GENE... [more]
rai141.493e-626.42retinoic acid induced 14 [Source:ZFIN;Acc:ZDB-GENE... [more]
rai141.527e-626.42retinoic acid induced 14 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of SMED30032529 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmd103.345e-827.07proteasome 26S subunit, non-ATPase 10 [Source:NCBI... [more]
ankrd522.629e-631.58ankyrin repeat domain 52 [Source:NCBI gene;Acc:100... [more]
ankrd522.647e-631.58ankyrin repeat domain 52 [Source:NCBI gene;Acc:100... [more]
ankrd523.017e-631.58ankyrin repeat domain 52 [Source:NCBI gene;Acc:100... [more]
ankrd523.078e-631.58ankyrin repeat domain 52 [Source:NCBI gene;Acc:100... [more]
back to top
BLAST of SMED30032529 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ankrd443.178e-834.78ankyrin repeat domain 44 [Source:MGI Symbol;Acc:MG... [more]
Ankrd443.364e-834.78ankyrin repeat domain 44 [Source:MGI Symbol;Acc:MG... [more]
Ankrd444.315e-835.09ankyrin repeat domain 44 [Source:MGI Symbol;Acc:MG... [more]
Ankrd521.636e-733.33ankyrin repeat domain 52 [Source:MGI Symbol;Acc:MG... [more]
A26c33.385e-627.88ANKRD26-like family C, member 3 [Source:MGI Symbol... [more]
back to top
BLAST of SMED30032529 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B2RXR6|ANR44_MOUSE2.223e-734.78Serine/threonine-protein phosphatase 6 regulatory ... [more]
sp|Q8N8A2|ANR44_HUMAN3.290e-734.78Serine/threonine-protein phosphatase 6 regulatory ... [more]
sp|Q5F478|ANR44_CHICK4.499e-732.46Serine/threonine-protein phosphatase 6 regulatory ... [more]
sp|Q4UMH6|Y381_RICFE6.080e-726.54Putative ankyrin repeat protein RF_0381 OS=Rickett... [more]
sp|Q8BTI7|ANR52_MOUSE1.145e-633.33Serine/threonine-protein phosphatase 6 regulatory ... [more]
back to top
BLAST of SMED30032529 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DSQ14.750e-2235.10ANK_REP_REGION domain-containing protein (Fragment... [more]
A0A267E3L75.222e-2235.10ANK_REP_REGION domain-containing protein (Fragment... [more]
A0A1I8H0355.726e-2235.10ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267GAP78.183e-2234.44ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A1S3KG743.434e-2134.59uncharacterized protein LOC106181577 OS=Lingula un... [more]
back to top
BLAST of SMED30032529 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib23.534e-728.57mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib23.729e-728.57mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib23.963e-727.50mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
ankrd52a4.950e-730.43ankyrin repeat domain 52a [Source:NCBI gene;Acc:55... [more]
ENSAMXT00000031513.15.313e-730.70pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of SMED30032529 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000007449.14.705e-827.50pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
ENSPMAT00000003991.16.001e-831.90pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
ENSPMAT00000007446.12.160e-627.50pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
back to top
BLAST of SMED30032529 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
HOS41.698e-632.04Subunit of the Set3 complex; complex is a meiotic-... [more]
back to top
BLAST of SMED30032529 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO382639.164e-1227.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411791.076e-1027.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425851.513e-935.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336421.047e-824.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO327184.536e-826.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30032529 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000005069.23.547e-726.83serine/threonine-protein phosphatase 6 regulatory ... [more]
ENSORLT00000028696.13.763e-726.83serine/threonine-protein phosphatase 6 regulatory ... [more]
ENSORLT00000037670.14.006e-726.83serine/threonine-protein phosphatase 6 regulatory ... [more]
ENSORLT00000045754.14.006e-726.83serine/threonine-protein phosphatase 6 regulatory ... [more]
mib28.017e-726.88mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
back to top
BLAST of SMED30032529 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077536.10.000e+099.17SMESG000077536.1[more]
SMESG000034080.12.904e-1035.34SMESG000034080.1[more]
SMESG000058588.13.834e-833.33SMESG000058588.1[more]
SMESG000058588.13.848e-833.33SMESG000058588.1[more]
SMESG000026655.13.592e-627.52SMESG000026655.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032529 ID=SMED30032529|Name=SMED30032529|organism=Schmidtea mediterranea sexual|type=transcript|length=1253bp
TTTATTGAAATTATTGATTAAATAGCAGAATATGTAGAAATTCAGGTAGT
AATACAAATATCAAATATCTGATAAAAATTAATTCGTAAGCCAATTTTAA
CGAAAATGATTTAGTGAAATGAATTTTAAAAGATCCATCTTTCGAAATAA
TCAGGCTTCTAGCCCAGCTGAAGCCATTTACAGAGGACTATTTAAACAGG
TCAGAGAGTTGTTGAACAAAGAAGCTGACCCAGATGAAAAAATCAAAAGC
AAGACCGCTATTATGCTATGTACTTTTCTCACTGATACTTTTTGGGCAAA
AAGTCTTTCATTTACACTATTAGAATATGGAGCTAAAATTGACAAAAAAG
ATGAATACGGATTCAACGCGTTGCACTTTTCCGTCATTAAAAATAAAAAA
GACTTAGTGGAAATATTTCTTAATTCATTTGATTTTGATATTAATGGTAA
AAACAATTTTGGTTTTACTGCCTTACATTATGCCGTGAATTCTGAAAGTA
AAATAGAGATTCTAGAAAGTCTCATTTTCCAAATGAAAAAATATAAATAT
TCTTTAAATATTTTAAATAAATTCAATAATTCACCACTAATGGAATCGAT
TCGGCATTTGAACTTTCACGCAGTGGAAGTTTTAATTGATAATGGTGCCA
GAACTGATTTCAAATATGAAGGTCTATCGTTTTTAGATTATTTCAATAAT
TTGAAAAGAAAATTAAAAGAAACCCCAGAATATATGATAAATAAAATAAA
AAAATCAATCATCATTAATAAAAATGAAGAATTAGCAATGCATGATTCTA
TAATCCGGTCAGTTGAACAAATATCCATCGAGGAAGCTCCAGACTTCGAT
ATCAGGAACAATTCTAAATGGGTTGTGGAACGACCTAAATCATGCATAAC
GTTACATTCTTTTAATGAAAACGAGGAAAGTTCTTGGAAAACTATAATGC
CAATTGTTCTTAATCAGCTAGAAGAAAGAATTTCCAAATCTTACAGAAAG
AATTTTAGCGTAGAAAAAATAATTTCGAATTTAAAACAATTTAATCACGA
AGCAGGAGATACGACAGGTAAAGGAAGAAATGGATCCTCAAAAAAGTCCA
ATGCAAAATCTAAATTAAACAAAAAAGGTTCGGCTTCCTCCAGTCAAGAT
AAATTATCCAAAAGGTCAACAAATGATGGAATAAAGATAAATAAATTTTA
ATACCATTCTGCTAAAATTGAATTTTTATCATTGTATAATAATAAATTAA
TAG
back to top

protein sequence of SMED30032529-orf-1

>SMED30032529-orf-1 ID=SMED30032529-orf-1|Name=SMED30032529-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=361bp
MNFKRSIFRNNQASSPAEAIYRGLFKQVRELLNKEADPDEKIKSKTAIML
CTFLTDTFWAKSLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIF
LNSFDFDINGKNNFGFTALHYAVNSESKIEILESLIFQMKKYKYSLNILN
KFNNSPLMESIRHLNFHAVEVLIDNGARTDFKYEGLSFLDYFNNLKRKLK
ETPEYMINKIKKSIIINKNEELAMHDSIIRSVEQISIEEAPDFDIRNNSK
WVVERPKSCITLHSFNENEESSWKTIMPIVLNQLEERISKSYRKNFSVEK
IISNLKQFNHEAGDTTGKGRNGSSKKSNAKSKLNKKGSASSSQDKLSKRS
TNDGIKINKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000420parapharyngeal region
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 114..148
e-value: 92.0
score: 11.9
coord: 80..110
e-value: 0.33
score: 20.0
coord: 152..183
e-value: 49.0
score: 12.8
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 9..236
e-value: 4.6E-23
score: 83.4
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 19..182
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 67..137
e-value: 1.4E-7
score: 32.0
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 67..184
score: 18.855
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 312..360
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 312..348
NoneNo IPR availablePANTHERPTHR24134FAMILY NOT NAMEDcoord: 17..124
coord: 66..157