Ras-related protein Rab-33B

Overview
NameRas-related protein Rab-33B
Smed IDSMED30032522
Length (bp)862
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras-related protein Rab-33B (SMED30032522) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras-related protein Rab-33B (SMED30032522) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras-related protein Rab-33B (SMED30032522) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras-related protein Rab-33B (SMED30032522) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032522

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30032522SMESG000061912.1 dd_Smed_v6_17877_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30032522SMESG000061912.1 dd_Smed_v4_17877_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras-related protein Rab-33B vs. Ensembl Human
Match: RAB33B (RAB33B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:16075])

HSP 1 Score: 154.066 bits (388), Expect = 3.241e-45
Identity = 78/134 (58.21%), Postives = 99/134 (73.88%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRLHXXXXXXXXXXPEDVIEL 622
            +QLWDTAGQERFRKSMV HYYRNVHAVVFV+D+T   SF  L  WI EC+++ LAN + RI++GNKCDL     V    AQKFAD + +PLFETSAK  + +D+V+ IF+T+ H+L S K L+LS  P++ I L
Sbjct:   84 IQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPSWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHKPLMLSQPPDNGIIL 217          
BLAST of Ras-related protein Rab-33B vs. Ensembl Human
Match: RAB33B (RAB33B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:16075])

HSP 1 Score: 154.836 bits (390), Expect = 6.276e-45
Identity = 78/134 (58.21%), Postives = 99/134 (73.88%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRLHXXXXXXXXXXPEDVIEL 622
            +QLWDTAGQERFRKSMV HYYRNVHAVVFV+D+T   SF  L  WI EC+++ LAN + RI++GNKCDL     V    AQKFAD + +PLFETSAK  + +D+V+ IF+T+ H+L S K L+LS  P++ I L
Sbjct:  132 IQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPSWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHKPLMLSQPPDNGIIL 265          
BLAST of Ras-related protein Rab-33B vs. Ensembl Human
Match: RAB33A (RAB33A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9773])

HSP 1 Score: 134.806 bits (338), Expect = 1.043e-37
Identity = 64/116 (55.17%), Postives = 82/116 (70.69%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            +Q+WDTAGQERFRKSMV HYYRNVHAVVFV+DVT+  SF +L  WI+EC  + +   V ++++GNKCDL  +  V    A KFAD + + LFETSAK    S NV+ IF+ +  RL
Sbjct:   87 VQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRL 202          
BLAST of Ras-related protein Rab-33B vs. Ensembl Human
Match: RAB1A (RAB1A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9758])

HSP 1 Score: 109.383 bits (272), Expect = 2.578e-28
Identity = 50/116 (43.10%), Postives = 79/116 (68.10%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            LQ+WDTAGQERFR ++   YYR  H ++ V+DVT ++SF ++ +W++E ++Y   N V+++++GNKCDL  K+VV    A++FAD   +P  ETSAK    + NV+  F+T+   +
Sbjct:   62 LQIWDTAGQERFR-TITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASEN-VNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKN---ATNVEQSFMTMAAEI 172          
BLAST of Ras-related protein Rab-33B vs. Ensembl Human
Match: RAB1A (RAB1A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9758])

HSP 1 Score: 109.383 bits (272), Expect = 2.578e-28
Identity = 50/116 (43.10%), Postives = 79/116 (68.10%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            LQ+WDTAGQERFR ++   YYR  H ++ V+DVT ++SF ++ +W++E ++Y   N V+++++GNKCDL  K+VV    A++FAD   +P  ETSAK    + NV+  F+T+   +
Sbjct:   62 LQIWDTAGQERFR-TITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASEN-VNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKN---ATNVEQSFMTMAAEI 172          
BLAST of Ras-related protein Rab-33B vs. Ensembl Celegans
Match: rab-33 (Ras-related protein Rab-33 [Source:UniProtKB/Swiss-Prot;Acc:Q20365])

HSP 1 Score: 149.058 bits (375), Expect = 7.850e-43
Identity = 74/122 (60.66%), Postives = 93/122 (76.23%), Query Frame = 2
Query:  212 LL*LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLA--NSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRLH 571
            LL +QLWDTAGQER+R+S+V HYYRNV+AVVFV+DVT R+SF  L  WI+ECEK+ L   + V RI+IGNKCD+E    VS  EAQ FAD   + LFETSAK  S +D+V+ IFLT++H+L 
Sbjct:  148 LLRVQLWDTAGQERYRQSIVAHYYRNVNAVVFVYDVTCRESFNDLALWIKECEKHGLVGDSEVPRILIGNKCDVECTNRVSTDEAQMFADRNNMALFETSAKLASEADHVESIFLTLLHKLQ 269          
BLAST of Ras-related protein Rab-33B vs. Ensembl Celegans
Match: rab-1 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q9UAQ6])

HSP 1 Score: 112.464 bits (280), Expect = 6.753e-30
Identity = 50/116 (43.10%), Postives = 78/116 (67.24%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            LQ+WDTAGQERFR ++   YYR  H ++ V+D+T +++F ++ +W++E ++Y   N V+++++GNKCDL  KR V  Q AQ +A +  +P  ETSAK    S NV+  FLT+   +
Sbjct:   62 LQIWDTAGQERFR-TITSSYYRGAHGIIVVYDITDQETFNNVKQWLQEIDRYACEN-VNKLLVGNKCDLTAKRAVETQAAQDYAGQLGIPFLETSAKS---STNVEQAFLTMASEI 172          
BLAST of Ras-related protein Rab-33B vs. Ensembl Celegans
Match: rab-35 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q9U2C3])

HSP 1 Score: 102.064 bits (253), Expect = 5.420e-26
Identity = 51/113 (45.13%), Postives = 74/113 (65.49%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIV 559
            LQ+WDTAGQERFR ++   YYR  H VV V+DVT  +SF ++  W++E E  N  +SV ++++GNKC+   +RVV E +A+ +A    +  FETSAK+D    NV+ +F  I 
Sbjct:   61 LQIWDTAGQERFR-TITSTYYRGTHGVVVVYDVTNGESFGNVKRWLQEIE--NNCDSVQKVLVGNKCEENERRVVLESDARNYAQSMNISFFETSAKEDK---NVEPMFTCIT 167          
BLAST of Ras-related protein Rab-33B vs. Ensembl Celegans
Match: rab-8 (RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5EFC1])

HSP 1 Score: 101.679 bits (252), Expect = 7.535e-26
Identity = 51/114 (44.74%), Postives = 71/114 (62.28%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVH 562
            LQ+WDTAGQERFR ++   YYR    ++ V+D+T   SFE++  WIR  E++  A+ V R+IIGNKCD+E +R VS    ++ A EY     ETSAK +    N+D  F T+  
Sbjct:   59 LQIWDTAGQERFR-TITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEH-AASDVERMIIGNKCDIEERREVSRDRGEQLAIEYGTKFLETSAKANL---NIDEAFFTLAR 167          
BLAST of Ras-related protein Rab-33B vs. Ensembl Celegans
Match: rab-8 (RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5EFC1])

HSP 1 Score: 101.679 bits (252), Expect = 7.535e-26
Identity = 51/114 (44.74%), Postives = 71/114 (62.28%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVH 562
            LQ+WDTAGQERFR ++   YYR    ++ V+D+T   SFE++  WIR  E++  A+ V R+IIGNKCD+E +R VS    ++ A EY     ETSAK +    N+D  F T+  
Sbjct:   59 LQIWDTAGQERFR-TITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEH-AASDVERMIIGNKCDIEERREVSRDRGEQLAIEYGTKFLETSAKANL---NIDEAFFTLAR 167          
BLAST of Ras-related protein Rab-33B vs. Ensembl Fly
Match: Rab8 (gene:FBgn0262518 transcript:FBtr0308832)

HSP 1 Score: 101.679 bits (252), Expect = 4.592e-26
Identity = 50/114 (43.86%), Postives = 74/114 (64.91%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVH 562
            LQ+WDTAGQERFR ++   YYR    ++ V+D+T+  SFE++  WIR  E+ N +  V ++++GNKC+L  KR VS++  ++ A EY +   ETSAK    S NV+  FLT+  
Sbjct:   24 LQIWDTAGQERFR-TITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEE-NASADVEKMLLGNKCELTDKRQVSKERGEQLAIEYGIKFMETSAK---ASINVEEAFLTLAS 132          
BLAST of Ras-related protein Rab-33B vs. Ensembl Fly
Match: Rab1 (gene:FBgn0285937 transcript:FBtr0084104)

HSP 1 Score: 101.293 bits (251), Expect = 1.315e-25
Identity = 47/116 (40.52%), Postives = 75/116 (64.66%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            LQ+WDTAGQERFR ++   YYR  H ++ V+D T ++SF ++ +W+ E E+Y   N V+++++GNK DL  K+VV    A ++A +  +P  ETSAK    + NV+  F+T+   +
Sbjct:   62 LQIWDTAGQERFR-TITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACEN-VNKLLVGNKSDLTTKKVVDHTTAAEYAAQLGIPFLETSAKS---ATNVEQAFMTMAAEI 172          
BLAST of Ras-related protein Rab-33B vs. Ensembl Fly
Match: Rab8 (gene:FBgn0262518 transcript:FBtr0308833)

HSP 1 Score: 101.293 bits (251), Expect = 1.596e-25
Identity = 50/114 (43.86%), Postives = 74/114 (64.91%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVH 562
            LQ+WDTAGQERFR ++   YYR    ++ V+D+T+  SFE++  WIR  E+ N +  V ++++GNKC+L  KR VS++  ++ A EY +   ETSAK    S NV+  FLT+  
Sbjct:   59 LQIWDTAGQERFR-TITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEE-NASADVEKMLLGNKCELTDKRQVSKERGEQLAIEYGIKFMETSAKA---SINVEEAFLTLAS 167          
BLAST of Ras-related protein Rab-33B vs. Ensembl Fly
Match: Rab8 (gene:FBgn0262518 transcript:FBtr0074921)

HSP 1 Score: 101.293 bits (251), Expect = 1.596e-25
Identity = 50/114 (43.86%), Postives = 74/114 (64.91%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVH 562
            LQ+WDTAGQERFR ++   YYR    ++ V+D+T+  SFE++  WIR  E+ N +  V ++++GNKC+L  KR VS++  ++ A EY +   ETSAK    S NV+  FLT+  
Sbjct:   59 LQIWDTAGQERFR-TITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEE-NASADVEKMLLGNKCELTDKRQVSKERGEQLAIEYGIKFMETSAKA---SINVEEAFLTLAS 167          
BLAST of Ras-related protein Rab-33B vs. Ensembl Fly
Match: Rab35 (gene:FBgn0031090 transcript:FBtr0333548)

HSP 1 Score: 96.2857 bits (238), Expect = 7.313e-24
Identity = 50/116 (43.10%), Postives = 79/116 (68.10%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            LQ+WDTAGQERFR ++   YYR  H V+ V+DVT  +SF ++  W+ E +  N  + V ++++GNK D   ++VV  ++AQ+FA +  + LFETSA KD++  NV+ +FL+I  ++
Sbjct:   48 LQIWDTAGQERFR-TITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQ--NNCDVVKKVLVGNKNDDPDRKVVITEDAQRFAKQMDIELFETSA-KDNI--NVENMFLSITRQV 157          
BLAST of Ras-related protein Rab-33B vs. Ensembl Zebrafish
Match: zgc:101559 (zgc:101559 [Source:ZFIN;Acc:ZDB-GENE-041114-122])

HSP 1 Score: 149.058 bits (375), Expect = 1.781e-43
Identity = 70/116 (60.34%), Postives = 86/116 (74.14%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            LQ+WDTAGQERFRKSMV HYYRNVHA++FV+DVT   SFE L EWI EC  +++   V RI++GNKCDL   R VS   AQ+ AD Y  PLFETSA+  +  ++VD IFLT+ +RL
Sbjct:   87 LQIWDTAGQERFRKSMVEHYYRNVHAIIFVYDVTSLASFESLPEWIEECNHHSVPPMVPRILVGNKCDLRESREVSTFLAQRLADSYNFPLFETSARDLAEKEHVDAIFLTLAYRL 202          
BLAST of Ras-related protein Rab-33B vs. Ensembl Zebrafish
Match: zgc:101559 (zgc:101559 [Source:ZFIN;Acc:ZDB-GENE-041114-122])

HSP 1 Score: 149.058 bits (375), Expect = 1.781e-43
Identity = 70/116 (60.34%), Postives = 86/116 (74.14%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            LQ+WDTAGQERFRKSMV HYYRNVHA++FV+DVT   SFE L EWI EC  +++   V RI++GNKCDL   R VS   AQ+ AD Y  PLFETSA+  +  ++VD IFLT+ +RL
Sbjct:   87 LQIWDTAGQERFRKSMVEHYYRNVHAIIFVYDVTSLASFESLPEWIEECNHHSVPPMVPRILVGNKCDLRESREVSTFLAQRLADSYNFPLFETSARDLAEKEHVDAIFLTLAYRL 202          
BLAST of Ras-related protein Rab-33B vs. Ensembl Zebrafish
Match: zgc:101559 (zgc:101559 [Source:ZFIN;Acc:ZDB-GENE-041114-122])

HSP 1 Score: 149.058 bits (375), Expect = 1.781e-43
Identity = 70/116 (60.34%), Postives = 86/116 (74.14%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            LQ+WDTAGQERFRKSMV HYYRNVHA++FV+DVT   SFE L EWI EC  +++   V RI++GNKCDL   R VS   AQ+ AD Y  PLFETSA+  +  ++VD IFLT+ +RL
Sbjct:   87 LQIWDTAGQERFRKSMVEHYYRNVHAIIFVYDVTSLASFESLPEWIEECNHHSVPPMVPRILVGNKCDLRESREVSTFLAQRLADSYNFPLFETSARDLAEKEHVDAIFLTLAYRL 202          
BLAST of Ras-related protein Rab-33B vs. Ensembl Zebrafish
Match: zgc:101559 (zgc:101559 [Source:ZFIN;Acc:ZDB-GENE-041114-122])

HSP 1 Score: 149.058 bits (375), Expect = 1.781e-43
Identity = 70/116 (60.34%), Postives = 86/116 (74.14%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            LQ+WDTAGQERFRKSMV HYYRNVHA++FV+DVT   SFE L EWI EC  +++   V RI++GNKCDL   R VS   AQ+ AD Y  PLFETSA+  +  ++VD IFLT+ +RL
Sbjct:   87 LQIWDTAGQERFRKSMVEHYYRNVHAIIFVYDVTSLASFESLPEWIEECNHHSVPPMVPRILVGNKCDLRESREVSTFLAQRLADSYNFPLFETSARDLAEKEHVDAIFLTLAYRL 202          
BLAST of Ras-related protein Rab-33B vs. Ensembl Zebrafish
Match: rab33a (RAB33A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-060825-283])

HSP 1 Score: 144.821 bits (364), Expect = 9.646e-42
Identity = 67/116 (57.76%), Postives = 86/116 (74.14%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            +Q+WDTAGQERFRKSMV HYYRNVHAVVFV+DVT+  SF++L  WI+EC  + ++++V R+++GNKCDL  +  V    A KFAD Y + LFETSAK    S NVD IF+ +  RL
Sbjct:   89 VQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMASFQNLKTWIQECNGHGVSSAVPRVLVGNKCDLVDQIQVPSNTALKFADAYNMLLFETSAKDPKESQNVDSIFMCLACRL 204          
BLAST of Ras-related protein Rab-33B vs. Ensembl Xenopus
Match: rab33b (RAB33B, member RAS oncogene family [Source:NCBI gene;Acc:493471])

HSP 1 Score: 156.377 bits (394), Expect = 2.460e-46
Identity = 78/134 (58.21%), Postives = 103/134 (76.87%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRLHXXXXXXXXXXPEDVIEL 622
            +QLWDTAGQERFRKSMV HYYRNVHAVVFV+D+T   SF+ L  WI EC+++ ++N V RI++GNKCDL G   V    AQKFAD + +P+FETSAK  + +D+V+ IF+T+ H+L S K LILS  P++++EL
Sbjct:   76 IQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDITNMASFQSLPAWIEECKQHLISNDVPRILVGNKCDLRGSIQVPTDMAQKFADSHSMPMFETSAK--NTNDHVEAIFMTLAHKLKSHKPLILSQPPDNMVEL 207          
BLAST of Ras-related protein Rab-33B vs. Ensembl Xenopus
Match: rab33b (RAB33B, member RAS oncogene family [Source:NCBI gene;Acc:493471])

HSP 1 Score: 156.762 bits (395), Expect = 2.647e-46
Identity = 78/134 (58.21%), Postives = 103/134 (76.87%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRLHXXXXXXXXXXPEDVIEL 622
            +QLWDTAGQERFRKSMV HYYRNVHAVVFV+D+T   SF+ L  WI EC+++ ++N V RI++GNKCDL G   V    AQKFAD + +P+FETSAK  + +D+V+ IF+T+ H+L S K LILS  P++++EL
Sbjct:   83 IQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDITNMASFQSLPAWIEECKQHLISNDVPRILVGNKCDLRGSIQVPTDMAQKFADSHSMPMFETSAK--NTNDHVEAIFMTLAHKLKSHKPLILSQPPDNMVEL 214          
BLAST of Ras-related protein Rab-33B vs. Ensembl Xenopus
Match: rab33a (RAB33A, member RAS oncogene family [Source:NCBI gene;Acc:779982])

HSP 1 Score: 125.946 bits (315), Expect = 1.268e-34
Identity = 59/116 (50.86%), Postives = 82/116 (70.69%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            +Q+WDTAGQERFR S+V HYYRNVH VVFV+DVT+  SF +L  W++ECE + +   V R+++GNKCDL  +  V    A  FA  +++ LFETSAK  S + NV+ IF+++  +L
Sbjct:   68 VQVWDTAGQERFRHSLVEHYYRNVHGVVFVYDVTKLSSFHNLRTWLQECEGHAVPALVPRVLVGNKCDLLEQVEVPSGLALNFAKAHKMVLFETSAKDPSQAKNVEKIFMSLACQL 183          
BLAST of Ras-related protein Rab-33B vs. Ensembl Xenopus
Match: rab1a (RAB1A, member RAS oncogene family [Source:NCBI gene;Acc:448007])

HSP 1 Score: 109.768 bits (273), Expect = 1.485e-28
Identity = 50/117 (42.74%), Postives = 79/117 (67.52%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRLH 571
            LQ+WDTAGQERFR ++   YYR  H ++ V+DVT ++SF ++ +W++E ++Y   N V+++++GNKCDL  K+VV    A++FAD   +P  ETSAK    + NV+  F+T+   + 
Sbjct:   63 LQIWDTAGQERFR-TITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASEN-VNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKN---ATNVEQAFMTMAAEIK 174          
BLAST of Ras-related protein Rab-33B vs. Ensembl Xenopus
Match: rab1a (RAB1A, member RAS oncogene family [Source:NCBI gene;Acc:448007])

HSP 1 Score: 109.768 bits (273), Expect = 1.644e-28
Identity = 50/116 (43.10%), Postives = 79/116 (68.10%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            LQ+WDTAGQERFR ++   YYR  H ++ V+DVT ++SF ++ +W++E ++Y   N V+++++GNKCDL  K+VV    A++FAD   +P  ETSAK    + NV+  F+T+   +
Sbjct:   62 LQIWDTAGQERFR-TITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASEN-VNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKN---ATNVEQAFMTMAAEI 172          
BLAST of Ras-related protein Rab-33B vs. Ensembl Mouse
Match: Rab33b (RAB33B, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1330805])

HSP 1 Score: 154.836 bits (390), Expect = 1.038e-45
Identity = 78/134 (58.21%), Postives = 100/134 (74.63%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRLHXXXXXXXXXXPEDVIEL 622
            +QLWDTAGQERFRKSMV HYYRNVHAVVFV+D+T   SF  L  WI EC+++ LAN + RI++GNKCDL     V    AQKFAD + +PLFETSAK  + +D+V+ IF+T+ H+L S K L+LS +P++ I L
Sbjct:   84 IQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPAWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHKPLMLSQLPDNRISL 217          
BLAST of Ras-related protein Rab-33B vs. Ensembl Mouse
Match: Rab33a (RAB33A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:109493])

HSP 1 Score: 134.806 bits (338), Expect = 7.470e-38
Identity = 64/116 (55.17%), Postives = 82/116 (70.69%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            +Q+WDTAGQERFRKSMV HYYRNVHAVVFV+DVT+  SF +L  WI+EC  + +   V ++++GNKCDL  +  V    A KFAD + + LFETSAK    S NV+ IF+ +  RL
Sbjct:   87 VQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRL 202          
BLAST of Ras-related protein Rab-33B vs. Ensembl Mouse
Match: Rab1a (RAB1A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:97842])

HSP 1 Score: 109.383 bits (272), Expect = 1.770e-28
Identity = 50/116 (43.10%), Postives = 79/116 (68.10%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            LQ+WDTAGQERFR ++   YYR  H ++ V+DVT ++SF ++ +W++E ++Y   N V+++++GNKCDL  K+VV    A++FAD   +P  ETSAK    + NV+  F+T+   +
Sbjct:   62 LQIWDTAGQERFR-TITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASEN-VNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKN---ATNVEQSFMTMAAEI 172          
BLAST of Ras-related protein Rab-33B vs. Ensembl Mouse
Match: Rab1a (RAB1A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:97842])

HSP 1 Score: 108.997 bits (271), Expect = 2.276e-28
Identity = 50/116 (43.10%), Postives = 79/116 (68.10%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            LQ+WDTAGQERFR ++   YYR  H ++ V+DVT ++SF ++ +W++E ++Y   N V+++++GNKCDL  K+VV    A++FAD   +P  ETSAK    + NV+  F+T+   +
Sbjct:   59 LQIWDTAGQERFR-TITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASEN-VNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKN---ATNVEQSFMTMAAEI 169          
BLAST of Ras-related protein Rab-33B vs. Ensembl Mouse
Match: Rab30 (RAB30, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1923235])

HSP 1 Score: 105.531 bits (262), Expect = 2.369e-27
Identity = 55/121 (45.45%), Postives = 81/121 (66.94%), Query Frame = 2
Query:  206 RHLL*LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            R    LQ+WDTAGQERFR S+   YYR+ +A++  +D+T  +SF  L EW+RE E+Y  +N V  +++GNK DL  +R VS+Q A++F++   +   ETSAK+   SDNV+ +FL +  RL
Sbjct:   27 RRFTQLQIWDTAGQERFR-SITQSYYRSANALILTYDITCEESFRCLPEWLREIEQY-ASNKVITVLVGNKIDLAERREVSQQRAEEFSEAQDMYYLETSAKE---SDNVEKLFLDLACRL 142          
BLAST of Ras-related protein Rab-33B vs. UniProt/SwissProt
Match: sp|P91580|RAB33_CIOIN (Putative Ras-related protein Rab-33 OS=Ciona intestinalis OX=7719 GN=COS41.2 PE=3 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 4.040e-47
Identity = 73/117 (62.39%), Postives = 90/117 (76.92%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNL-ANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            LQLWDTAGQERFRKSMVPHYYRNVHAVVF +DVT+  SF+ L  WI ECE+Y+L A+ + RI++GNKCDL+ +  V    A +FAD   +PLFETSAK DS   N++ IFLT+ H+L
Sbjct:   66 LQLWDTAGQERFRKSMVPHYYRNVHAVVFTYDVTKGRSFQGLPSWIEECERYSLNASEIPRILVGNKCDLKDQAEVDTNSATRFADANSMPLFETSAKADSEMGNIEAIFLTVAHKL 182          
BLAST of Ras-related protein Rab-33B vs. UniProt/SwissProt
Match: sp|O35963|RB33B_MOUSE (Ras-related protein Rab-33B OS=Mus musculus OX=10090 GN=Rab33b PE=1 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 7.259e-45
Identity = 78/134 (58.21%), Postives = 100/134 (74.63%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRLHXXXXXXXXXXPEDVIEL 622
            +QLWDTAGQERFRKSMV HYYRNVHAVVFV+D+T   SF  L  WI EC+++ LAN + RI++GNKCDL     V    AQKFAD + +PLFETSAK  + +D+V+ IF+T+ H+L S K L+LS +P++ I L
Sbjct:   84 IQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPAWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHKPLMLSQLPDNRISL 217          
BLAST of Ras-related protein Rab-33B vs. UniProt/SwissProt
Match: sp|Q9H082|RB33B_HUMAN (Ras-related protein Rab-33B OS=Homo sapiens OX=9606 GN=RAB33B PE=1 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 1.557e-44
Identity = 78/134 (58.21%), Postives = 99/134 (73.88%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRLHXXXXXXXXXXPEDVIEL 622
            +QLWDTAGQERFRKSMV HYYRNVHAVVFV+D+T   SF  L  WI EC+++ LAN + RI++GNKCDL     V    AQKFAD + +PLFETSAK  + +D+V+ IF+T+ H+L S K L+LS  P++ I L
Sbjct:   84 IQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPSWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHKPLMLSQPPDNGIIL 217          
BLAST of Ras-related protein Rab-33B vs. UniProt/SwissProt
Match: sp|Q5R615|RB33B_PONAB (Ras-related protein Rab-33B OS=Pongo abelii OX=9601 GN=RAB33B PE=2 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 9.869e-44
Identity = 77/134 (57.46%), Postives = 99/134 (73.88%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRLHXXXXXXXXXXPEDVIEL 622
            +QLWDTAGQERFRKSMV HYYRNVHAVVFV+D+T   SF  L  WI EC+++ LA+ + RI++GNKCDL     V    AQKFAD + +PLFETSAK  + +D+V+ IF+T+ H+L S K L+LS  P++ I L
Sbjct:   84 IQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPSWIEECKQHLLASDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHKPLMLSQPPDNGIIL 217          
BLAST of Ras-related protein Rab-33B vs. UniProt/SwissProt
Match: sp|Q5ZHV1|RB33B_CHICK (Ras-related protein Rab-33B OS=Gallus gallus OX=9031 GN=RAB33B PE=2 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 2.898e-43
Identity = 69/116 (59.48%), Postives = 87/116 (75.00%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            +QLWDTAGQERFRKSMV HYYRNVHAVVFV+D+T   SF  L  WI EC+++ L N + RI++GNKCDL     V    AQKFAD + +PLFETSAK  + +D+V+ IF+T+ H+L
Sbjct:   82 IQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNLASFHSLPSWIEECKQHLLTNDIPRILVGNKCDLRNAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKL 197          
BLAST of Ras-related protein Rab-33B vs. TrEMBL
Match: V4BAC5 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_223895 PE=4 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 1.241e-45
Identity = 73/116 (62.93%), Postives = 93/116 (80.17%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            LQLWDTAGQERFRKSMV HYYRNVHAVVFVFDVT+  SFE + +WI EC+++NL   + RI++GNKCD++ K  V+   AQKFAD + +PLFETSAK D  +++VD IF+T+ H+L
Sbjct:   83 LQLWDTAGQERFRKSMVQHYYRNVHAVVFVFDVTKMSSFEDMPQWIEECDRHNLNKQLPRILVGNKCDVKDKIAVNTNLAQKFADSHNMPLFETSAKDDEKANHVDAIFMTLAHKL 198          
BLAST of Ras-related protein Rab-33B vs. TrEMBL
Match: A0A1S3JMT9 (putative Ras-related protein Rab-33 OS=Lingula unguis OX=7574 GN=LOC106174305 PE=4 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 1.295e-45
Identity = 71/116 (61.21%), Postives = 92/116 (79.31%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            LQLWDTAGQERFRKSMV HYYRNVHAVVFV+DVT+  SFE++  W+ EC++++L   + RI++GNKCD+  K  ++   AQKFAD + +PLFETSAK DS  D+VD IF+T+ H+L
Sbjct:   90 LQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDVTKASSFENMPSWVDECDRHHLNTDIPRILVGNKCDMRDKAQIATNVAQKFADSHNMPLFETSAKDDSACDHVDAIFMTLAHKL 205          
BLAST of Ras-related protein Rab-33B vs. TrEMBL
Match: A0A3S1HSK7 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_006915 PE=4 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 1.386e-45
Identity = 72/118 (61.02%), Postives = 96/118 (81.36%), Query Frame = 2
Query:  215 L*LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            L LQLWDTAGQERFRKSMV HYYRNVHAV+FV+D+T+ +SFE++ +WI EC+K++L   + RI++GNKCD+E K  V+   AQKFAD + +PLFETSAK D  +++VD IF+T+ H+L
Sbjct:  120 LKLQLWDTAGQERFRKSMVQHYYRNVHAVIFVYDITKINSFENMAQWIEECDKHSLNKHIPRILVGNKCDMEDKIAVNTNMAQKFADAHGMPLFETSAKDDDKANHVDAIFMTVAHKL 237          
BLAST of Ras-related protein Rab-33B vs. TrEMBL
Match: A0A293LDM3 (RAS related protein (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 5.849e-45
Identity = 75/116 (64.66%), Postives = 90/116 (77.59%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            LQLWDTAGQERFRKSMV HYYRNVHAVVFV+DVT+  SFE L  W+ EC+ + L   + RI++GNKCD + K  VS   AQKFAD + +PLFETSAK DS SD+V+ IFLT+ H+L
Sbjct:   75 LQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDVTKVASFESLPAWLEECDSHRLTGDLPRILVGNKCDCKDKVAVSTNMAQKFADLHNMPLFETSAKDDSESDHVEAIFLTLAHKL 190          
BLAST of Ras-related protein Rab-33B vs. TrEMBL
Match: R7UNT7 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_3285 PE=4 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 6.299e-45
Identity = 74/120 (61.67%), Postives = 96/120 (80.00%), Query Frame = 2
Query:  206 RHLL*LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHR 565
            + L+ LQLWDTAGQERFRKSMV HYYRNVHAVVFV+DVT+  SFE+L  WI EC+++NL + V RI++GNKCD++ +  VS   AQKFAD + +PLFETSAK +  +++V+ IFLTI H+
Sbjct:   74 KELVKLQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDVTKVSSFENLPHWIGECDRHNLTSEVPRILVGNKCDMKERVAVSTNMAQKFADLHSMPLFETSAKDNHKANHVEAIFLTIAHK 193          
BLAST of Ras-related protein Rab-33B vs. Ensembl Cavefish
Match: zgc:101559 (ras-related protein Rab-33B-like [Source:NCBI gene;Acc:103024663])

HSP 1 Score: 146.362 bits (368), Expect = 2.596e-42
Identity = 70/116 (60.34%), Postives = 85/116 (73.28%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            LQ+WDTAGQERFRKSMV HYYRNVHAV+FV+DVT   SFE L EWI EC  + +   V RI++GNKCDL G+  V    AQ+ AD Y  PLFETSAK  +  ++VD IFLT+ ++L
Sbjct:  100 LQIWDTAGQERFRKSMVEHYYRNVHAVIFVYDVTNLASFESLPEWIEECSHHAVPPVVPRILVGNKCDL-GRGEVPTSLAQRLADSYNFPLFETSAKDPAEKEHVDAIFLTLAYKL 214          
BLAST of Ras-related protein Rab-33B vs. Ensembl Cavefish
Match: rab33ba (RAB33B, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-050809-122])

HSP 1 Score: 145.976 bits (367), Expect = 3.351e-42
Identity = 71/125 (56.80%), Postives = 87/125 (69.60%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKD---------SLSDNVDGIFLTIVHRL 568
            +QLWDTAGQERFRKSMV HYYRNVHAVVFV+DVT   SF  L  WI EC ++ L   V RI++GNKCDL     VS + AQ+FAD + +PLFETSAK           + SD+V+ IF+T+ H+L
Sbjct:   74 VQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDVTSAASFRSLPAWIEECRQHALGQEVPRILVGNKCDLRHLSQVSTELAQQFADAHSMPLFETSAKNPHGGEEGGGRNSSDHVEAIFMTVAHKL 198          
BLAST of Ras-related protein Rab-33B vs. Ensembl Cavefish
Match: ENSAMXT00000048868.1 (pep primary_assembly:Astyanax_mexicanus-2.0:25:5400755:5407468:1 gene:ENSAMXG00000037428.1 transcript:ENSAMXT00000048868.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 123.635 bits (309), Expect = 6.124e-34
Identity = 61/120 (50.83%), Postives = 80/120 (66.67%), Query Frame = 2
Query:  215 L*LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSE--QEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            L LQLWDTAGQERFRKSMV HYYR+VHA+VFV+DVT   SF  L  W+ EC +++L   V R+++GNK DL      S   ++A++ AD + +P +  SAK D     VD IF+T+  RL
Sbjct:   56 LKLQLWDTAGQERFRKSMVQHYYRDVHAIVFVYDVTNTTSFRSLPVWMEECRQHSLGQDVPRVLVGNKVDLATSVASSTTLEQARRLADVHGMPFYVCSAKGDD-KKQVDTIFMTLAQRL 174          
BLAST of Ras-related protein Rab-33B vs. Ensembl Cavefish
Match: ENSAMXT00000055997.1 (pep primary_assembly:Astyanax_mexicanus-2.0:25:5400563:5407468:1 gene:ENSAMXG00000037428.1 transcript:ENSAMXT00000055997.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 123.635 bits (309), Expect = 7.495e-34
Identity = 61/120 (50.83%), Postives = 80/120 (66.67%), Query Frame = 2
Query:  215 L*LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSE--QEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            L LQLWDTAGQERFRKSMV HYYR+VHA+VFV+DVT   SF  L  W+ EC +++L   V R+++GNK DL      S   ++A++ AD + +P +  SAK D     VD IF+T+  RL
Sbjct:   67 LKLQLWDTAGQERFRKSMVQHYYRDVHAIVFVYDVTNTTSFRSLPVWMEECRQHSLGQDVPRVLVGNKVDLATSVASSTTLEQARRLADVHGMPFYVCSAKGDD-KKQVDTIFMTLAQRL 185          
BLAST of Ras-related protein Rab-33B vs. Ensembl Cavefish
Match: ENSAMXT00000035653.1 (pep primary_assembly:Astyanax_mexicanus-2.0:25:5401338:5407468:1 gene:ENSAMXG00000037428.1 transcript:ENSAMXT00000035653.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 123.635 bits (309), Expect = 9.357e-34
Identity = 61/120 (50.83%), Postives = 80/120 (66.67%), Query Frame = 2
Query:  215 L*LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSE--QEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            L LQLWDTAGQERFRKSMV HYYR+VHA+VFV+DVT   SF  L  W+ EC +++L   V R+++GNK DL      S   ++A++ AD + +P +  SAK D     VD IF+T+  RL
Sbjct:   82 LKLQLWDTAGQERFRKSMVQHYYRDVHAIVFVYDVTNTTSFRSLPVWMEECRQHSLGQDVPRVLVGNKVDLATSVASSTTLEQARRLADVHGMPFYVCSAKGDD-KKQVDTIFMTLAQRL 200          
BLAST of Ras-related protein Rab-33B vs. Ensembl Sea Lamprey
Match: rab33ba (RAB33B, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-050809-122])

HSP 1 Score: 142.895 bits (359), Expect = 9.495e-42
Identity = 68/117 (58.12%), Postives = 85/117 (72.65%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAK-KDSLSDNVDGIFLTIVHRL 568
            LQLWDTAGQERFRKSMV HYYRN HAVVFV+DVT R SF  L  W+ ECE++  ++   R+++GNKCDL+ K  V    AQKFAD + +  FETSAK ++   D+ + IFLT+ HRL
Sbjct:   90 LQLWDTAGQERFRKSMVSHYYRNAHAVVFVYDVTSRPSFLSLPSWLAECERHLSSSDAPRVLVGNKCDLKDKVEVPTSLAQKFADAHGMAHFETSAKEQEGTGDHAEAIFLTLAHRL 206          
BLAST of Ras-related protein Rab-33B vs. Ensembl Sea Lamprey
Match: rab1aa (RAB1A, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-090312-110])

HSP 1 Score: 110.153 bits (274), Expect = 1.482e-29
Identity = 50/116 (43.10%), Postives = 79/116 (68.10%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            LQ+WDTAGQERFR ++   YYR  H ++ V+DVT ++SF ++ +W++E ++Y   N V+++++GNKCDL  K+VV    A++FAD   +P  ETSAK    + NV+  F+T+   +
Sbjct:   62 LQIWDTAGQERFR-TITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASEN-VNKLLVGNKCDLTTKKVVDYTTAKEFADSLEIPFLETSAKN---ATNVEQAFMTMAAEI 172          
BLAST of Ras-related protein Rab-33B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010665.1 (pep scaffold:Pmarinus_7.0:GL482742:3398:12039:1 gene:ENSPMAG00000009656.1 transcript:ENSPMAT00000010665.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.679 bits (252), Expect = 8.729e-27
Identity = 47/97 (48.45%), Postives = 66/97 (68.04%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAK 511
            LQ+WDTAGQERFR ++   YYR    ++ V+D+T   SFE++  WIR  E++  A+ V R+I+GNKCD+  +R VS +  +KFA EY +   ETSAK
Sbjct:   18 LQIWDTAGQERFR-TITTAYYRGAMGIMLVYDITNDKSFENIKNWIRNIEEHASAD-VERMILGNKCDMNDRRQVSRERGEKFASEYGIKFMETSAK 112          
BLAST of Ras-related protein Rab-33B vs. Ensembl Sea Lamprey
Match: rab8a (RAB8A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070424-36])

HSP 1 Score: 98.5969 bits (244), Expect = 2.849e-25
Identity = 49/114 (42.98%), Postives = 72/114 (63.16%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVH 562
            LQ+WDTAGQERFR ++   YYR    ++ V+D+T   SFE++  WIR  E++  A+ V ++I+GNKCD+  +R V+ +  +K A EY +   ETSAK    S NV+  F T+  
Sbjct:   59 LQIWDTAGQERFR-TITTAYYRGAMGIMLVYDITNEKSFENIKNWIRNIEEHASAD-VEKMILGNKCDMNERRQVTRERGEKLAIEYGIKFMETSAKA---SINVEEAFFTLAR 167          
BLAST of Ras-related protein Rab-33B vs. Ensembl Sea Lamprey
Match: rab2a (RAB2A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-011212-2])

HSP 1 Score: 97.8265 bits (242), Expect = 6.981e-25
Identity = 50/117 (42.74%), Postives = 72/117 (61.54%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRLH 571
            LQ+WDTAGQE FR S+   YYR     + V+D+TRRD+F HL  W+ +  +++ +N V  ++IGNK DLE +R V  +E + FA E+ L   ETSAK  S   NV+  F+     ++
Sbjct:   57 LQIWDTAGQESFR-SITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVI-MLIGNKSDLESRREVKREEGEAFAREHGLVFMETSAKTAS---NVEEAFINTAKEIY 168          
BLAST of Ras-related protein Rab-33B vs. Ensembl Yeast
Match: YPT1 (Rab family GTPase; involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by type II protein geranylgeranyltransferase (Bet2p-Bet4p); binds to unspliced HAC1 mRNA; regulates the unfolded protein response (UPR) by promoting the decay of HAC1 RNA; localizes to the early Golgi, the transitional Golgi and ER membranes, pre-autophagosomal structures, and cytoplasmic vesicles [Source:SGD;Acc:S000001856])

HSP 1 Score: 107.457 bits (267), Expect = 9.242e-29
Identity = 51/116 (43.97%), Postives = 79/116 (68.10%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            LQ+WDTAGQERFR ++   YYR  H ++ V+DVT ++SF  +  W++E ++Y   ++V ++++GNKCDL+ KRVV    A++FAD  ++P  ETSA     S NV+  FLT+  ++
Sbjct:   59 LQIWDTAGQERFR-TITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRY-ATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALD---STNVEDAFLTMARQI 169          
BLAST of Ras-related protein Rab-33B vs. Ensembl Yeast
Match: SEC4 (Rab family GTPase; essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane [Source:SGD;Acc:S000001889])

HSP 1 Score: 88.9669 bits (219), Expect = 8.995e-22
Identity = 44/117 (37.61%), Postives = 69/117 (58.97%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRLH 571
            LQLWDTAGQERFR ++   YYR    ++ V+DVT   +F ++ +W +   ++   +    +++GNK D+E  RVV+  + +  A E  +P  E+SAK D   DNV+ IF T+   + 
Sbjct:   71 LQLWDTAGQERFR-TITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEH-ANDEAQLLLVGNKSDME-TRVVTADQGEALAKELGIPFIESSAKND---DNVNEIFFTLAKLIQ 181          
BLAST of Ras-related protein Rab-33B vs. Ensembl Yeast
Match: VPS21 (Endosomal Rab family GTPase; required for endocytic transport and sorting of vacuolar hydrolases; required for endosomal localization of the CORVET complex; required with YPT52 for MVB biogenesis and sorting; involved in autophagy and ionic stress tolerance; geranylgeranylation required for membrane association; protein abundance increases in response to DNA replication stress; mammalian Rab5 homolog; VPS21 has a paralog, YPT53, that arose from the whole genome duplication [Source:SGD;Acc:S000005615])

HSP 1 Score: 88.1965 bits (217), Expect = 1.517e-21
Identity = 48/123 (39.02%), Postives = 73/123 (59.35%), Query Frame = 2
Query:  209 HLL*LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDL---EGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            H +  ++WDTAGQERF  S+ P YYRN  A + V+DVT+  SF     W++E  +   +  +   ++GNK D+    G+R V+ +E +K A+E  L  FETSAK     +NV+ +FL I  ++
Sbjct:   54 HTVKFEIWDTAGQERF-ASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHE-QASKDIIIALVGNKIDMLQEGGERKVAREEGEKLAEEKGLLFFETSAK---TGENVNDVFLGIGEKI 171          
BLAST of Ras-related protein Rab-33B vs. Ensembl Yeast
Match: YPT6 (Rab family GTPase; required for endosome-to-Golgii, intra-Golgi retrograde, and retrograde Golgi-to-ER transport; temporarily at the Golgi, dissociating into the cytosol on arrival of the late Golgi GTPase Ypt32p; Golgi-localized form is GTP bound, while cytosolic form is GDP-bound; required for delivery of Atg9p to the phagophore assembly site during autophagy under heat stress, with Ypt6p for starvation induced autophagy and for the CVT pathway; homolog of mammalian Rab6 [Source:SGD;Acc:S000004252])

HSP 1 Score: 85.8853 bits (211), Expect = 1.350e-20
Identity = 48/117 (41.03%), Postives = 68/117 (58.12%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLF-ETSAKKDSLSDNVDGIFLTIVHRL 568
            LQLWDTAGQERFR S++P Y R+    + V+D+T+R SFE++ +WI + +      +V   I+GNK DL  +R +S +E +K A      +F ETS K      NV  +F  I   L
Sbjct:   61 LQLWDTAGQERFR-SLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDENVILCIVGNKSDLSDERQISTEEGEKKAKLLGAKIFMETSTKAGY---NVKALFKKIAKSL 173          
BLAST of Ras-related protein Rab-33B vs. Ensembl Yeast
Match: YPT31 (Rab family GTPase; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; YPT31 has a paralog, YPT32, that arose from the whole genome duplication; localizes to the transitional and late Golgi [Source:SGD;Acc:S000000833])

HSP 1 Score: 79.337 bits (194), Expect = 3.965e-18
Identity = 43/116 (37.07%), Postives = 69/116 (59.48%), Query Frame = 2
Query:  224 QLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRLH 571
            Q+WDTAGQER+R ++   YYR     + V+D+++  S+E+   W+ E  + N  ++V   +IGNK DL   R V  +E++ FA E +L   ETSA     S+NVD  F  +++ ++
Sbjct:   65 QIWDTAGQERYR-AITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRE-NADDNVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALN---SENVDKAFEELINTIY 175          
BLAST of Ras-related protein Rab-33B vs. Ensembl Nematostella
Match: EDO44462 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVW7])

HSP 1 Score: 140.198 bits (352), Expect = 2.659e-41
Identity = 66/116 (56.90%), Postives = 86/116 (74.14%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            LQLWDTAGQERFRKSMV HYYRNV+AVVF++D+TR+ SFE L  WI E   +  +  V +I+IGNKCDL  +R VS   A+KFAD + +PL+E S K D+  + ++ IFLT+ H+L
Sbjct:   54 LQLWDTAGQERFRKSMVCHYYRNVNAVVFMYDITRKCSFEALTTWIVEYRHHAYSGDVPKILIGNKCDLGLERTVSSNIARKFADSHNMPLWEISIKNDAELEQIEAIFLTLTHKL 169          
BLAST of Ras-related protein Rab-33B vs. Ensembl Nematostella
Match: EDO40167 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S806])

HSP 1 Score: 105.916 bits (263), Expect = 9.155e-28
Identity = 48/116 (41.38%), Postives = 79/116 (68.10%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            LQ+WDTAGQERFR ++   YYR  H ++ V+DVT ++SF ++ +W++E ++Y   N V+++++GNKCDL  K+VV    A+++A+   +P  ETSAK    + NV+  F+T+   +
Sbjct:   62 LQIWDTAGQERFR-TITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYACEN-VNKLLVGNKCDLTTKKVVDFTTAKEYAESLGVPFLETSAKN---ATNVEQAFMTMAAEI 172          
BLAST of Ras-related protein Rab-33B vs. Ensembl Nematostella
Match: EDO41018 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5I6])

HSP 1 Score: 99.3673 bits (246), Expect = 3.301e-25
Identity = 48/114 (42.11%), Postives = 73/114 (64.04%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVH 562
            LQ+WDTAGQERFR ++   YYR    ++ V+D+T   SFE++  WIR  E++  +  V ++++GNKCD+E +R VS++  ++ A EY +   ETSAK    S NV+  F T+  
Sbjct:   59 LQIWDTAGQERFR-TITTAYYRGAMGIMLVYDITNDKSFENIKNWIRNIEEH-ASQDVEKMVLGNKCDMEDRRQVSKERGEQLAVEYGIKFMETSAKA---SINVEEAFFTLAR 167          
BLAST of Ras-related protein Rab-33B vs. Ensembl Nematostella
Match: EDO42144 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2G3])

HSP 1 Score: 98.9821 bits (245), Expect = 4.011e-25
Identity = 49/116 (42.24%), Postives = 72/116 (62.07%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            LQ+WDTAGQERFR ++   YYR+ H +V ++DV   ++F HL +W+ E  +Y     V+ I++GNKCDL   R V    A++FA++  +   ETSAK    S NV+ +F T+   L
Sbjct:   59 LQIWDTAGQERFR-TLTTAYYRSAHGIVLIYDVNESETFLHLSQWLEEVSEY-ACEGVNTILVGNKCDLIDCRQVGYNTAKEFAEKLDISFIETSAKD---STNVESVFRTMAAEL 169          
BLAST of Ras-related protein Rab-33B vs. Ensembl Nematostella
Match: EDO43129 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZN1])

HSP 1 Score: 98.5969 bits (244), Expect = 5.709e-25
Identity = 50/112 (44.64%), Postives = 72/112 (64.29%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTI 556
            LQ+WDTAGQERFR ++   YYR  H V+ V+D+T+R+S+ +L +W+ E E Y  +  VH I++GNK DL+  R V    AQ++A  + +P  ETSAK    + NV   FL +
Sbjct:   67 LQIWDTAGQERFR-TITSSYYRGAHGVMIVYDITKRESYNNLHKWLMEVETYA-SEGVHMILVGNKIDLDTDREVQPDAAQEWAALHDMPFVETSAKG---AKNVKEAFLVL 173          
BLAST of Ras-related protein Rab-33B vs. Ensembl Medaka
Match: zgc:101559 (ras-related protein Rab-33B [Source:NCBI gene;Acc:101162878])

HSP 1 Score: 150.214 bits (378), Expect = 5.533e-44
Identity = 70/116 (60.34%), Postives = 86/116 (74.14%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            LQ+WDTAGQERFRKSMV HYYR+VHAV+FV+DVT   SFE + EWI EC ++ +   V R+I+GNKCDL  +R V    AQ  AD Y  PLFETSAK+ S  ++VD IFLT+ +RL
Sbjct:   87 LQIWDTAGQERFRKSMVEHYYRSVHAVIFVYDVTSLPSFESIPEWIEECSRHLVGPLVPRVIVGNKCDLREQREVPASSAQLLADSYNYPLFETSAKEPSEKEHVDAIFLTLAYRL 202          
BLAST of Ras-related protein Rab-33B vs. Ensembl Medaka
Match: rab33ba (ras-related protein Rab-33B [Source:NCBI gene;Acc:101168379])

HSP 1 Score: 149.443 bits (376), Expect = 1.066e-43
Identity = 77/142 (54.23%), Postives = 98/142 (69.01%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSL--------SDNVDGIFLTIVHRLHXXXXXXXXXXPEDVIEL 622
            +QLWDTAGQERFRKSMV HYYRNVHAVVFV+D+T   SF  L  WI EC++++L   V RI++GNKCDL+    V    AQ+FAD + +PLFETSAK  +         SD+V+ IF+T+ H+L S K L+LS  PE  + L
Sbjct:   75 IQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDLTNAASFRSLPAWIEECKQHSLGTEVPRILVGNKCDLQDSVQVGTDVAQQFADSHSMPLFETSAKDPNSQGGGNHRDSDHVEAIFMTVAHKLKSQKPLVLSQPPESSVSL 216          
BLAST of Ras-related protein Rab-33B vs. Ensembl Medaka
Match: rab33a (ras-related protein Rab-33A [Source:NCBI gene;Acc:101158035])

HSP 1 Score: 139.043 bits (349), Expect = 4.025e-39
Identity = 66/116 (56.90%), Postives = 83/116 (71.55%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            +Q+WDTAGQERFRKSMV HYYRNVHAVVFV+DVT   S+ +L  WI EC  + ++ SV R+++GNKCDL  +  V    A KFAD + + LFETSAK    S NVD IF+++  RL
Sbjct:  130 VQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTNMASYRNLQTWIEECNGHRVSASVPRVLVGNKCDLVDQIQVPSNMALKFADAHNMLLFETSAKDPKESQNVDSIFMSLACRL 245          
BLAST of Ras-related protein Rab-33B vs. Ensembl Medaka
Match: ENSORLT00000002583.2 (pep primary_assembly:ASM223467v1:1:5626778:5630215:1 gene:ENSORLG00000002071.2 transcript:ENSORLT00000002583.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.309 bits (277), Expect = 6.568e-29
Identity = 56/101 (55.45%), Postives = 69/101 (68.32%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDL----EGKRVVSEQEAQKFADEYRLPLFETSAK 511
            LQLWDTAGQERFRKSMV  YYRNVHAV+FV+DVT   SF  L  W+ EC + +L + + R +IGNK DL    +  R VS++ A  FA  + +  FETSAK
Sbjct:   74 LQLWDTAGQERFRKSMVQQYYRNVHAVLFVYDVTCPASFRGLTAWVEECRQNSLGHEIPRFLIGNKSDLRDASKADRQVSQELALSFAKFHSMVFFETSAK 174          
BLAST of Ras-related protein Rab-33B vs. Ensembl Medaka
Match: zgc:171927 (ras-related protein ORAB-1-like [Source:NCBI gene;Acc:101173484])

HSP 1 Score: 109.768 bits (273), Expect = 9.436e-29
Identity = 52/117 (44.44%), Postives = 75/117 (64.10%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRLH 571
            LQ+WDTAGQERFR ++   YYR  H ++ V+DVT ++SF ++ +W+ E ++Y   N V R+++GNK DL  K+VV    AQ  A   ++P  ETSAK    S NV+  FLT+   +H
Sbjct:   59 LQIWDTAGQERFR-TITSSYYRGAHGIIIVYDVTEQESFNNVRQWLEEIDRYACEN-VSRLLVGNKSDLVSKKVVDAATAQDLASSLKIPFLETSAKS---SGNVEKAFLTMASEIH 170          
BLAST of Ras-related protein Rab-33B vs. Planmine SMEST
Match: SMESG000078531.1 (SMESG000078531.1)

HSP 1 Score: 255.373 bits (651), Expect = 2.201e-85
Identity = 133/134 (99.25%), Postives = 134/134 (100.00%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRLHXXXXXXXXXXPEDVIEL 622
            LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRLHSSKSLILSSIP+DVIEL
Sbjct:   68 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRLHSSKSLILSSIPDDVIEL 201          
BLAST of Ras-related protein Rab-33B vs. Planmine SMEST
Match: SMESG000026323.1 (SMESG000026323.1)

HSP 1 Score: 107.071 bits (266), Expect = 6.407e-28
Identity = 51/116 (43.97%), Postives = 76/116 (65.52%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            LQ+WDTAGQERFR ++   YYR  H ++ V+DVT +DSF ++  W+ E ++Y   N V+++++GNK DL  KRVV    A+++AD   +P  ETSAK    + NV+  FLT+   +
Sbjct:   59 LQIWDTAGQERFR-TITSSYYRGAHGIIVVYDVTDQDSFNNVKNWLSEIDRYANEN-VNKLLVGNKTDLISKRVVEASNAKEYADSLNIPFLETSAKD---ATNVEQAFLTMAGEI 169          
BLAST of Ras-related protein Rab-33B vs. Planmine SMEST
Match: SMESG000049854.1 (SMESG000049854.1)

HSP 1 Score: 105.531 bits (262), Expect = 2.523e-27
Identity = 50/116 (43.10%), Postives = 75/116 (64.66%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRL 568
            LQ+WDTAGQERFR ++   YYR  H ++ V+DVT + SF ++  W+ E E+Y   N V++++IGNK D+  K+VV    A++FAD   +P  ETSA+    S NV+  F+T+   +
Sbjct:   59 LQIWDTAGQERFR-TITSSYYRGAHGIIVVYDVTDQTSFNNVKNWLNEIERYANEN-VNKLLIGNKSDMVSKKVVDSGTAKEFADSLNIPFLETSARD---STNVEKTFITMAQEI 169          
BLAST of Ras-related protein Rab-33B vs. Planmine SMEST
Match: SMESG000078456.1 (SMESG000078456.1)

HSP 1 Score: 103.219 bits (256), Expect = 1.988e-26
Identity = 54/114 (47.37%), Postives = 70/114 (61.40%), Query Frame = 2
Query:  227 LWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRII-IGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHR 565
            +WDTAGQER+ KS+ P YYR  HA + V+D+T R SF     WI E  +  + ++V  II +GNKCDL   RV+    AQKFADE  L   ETSAK   LS N+  IF+ +  +
Sbjct:   60 IWDTAGQERY-KSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNE--ITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAK---LSINIKEIFILLARK 167          
BLAST of Ras-related protein Rab-33B vs. Planmine SMEST
Match: SMESG000076159.1 (SMESG000076159.1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.955e-23
Identity = 48/117 (41.03%), Postives = 72/117 (61.54%), Query Frame = 2
Query:  221 LQLWDTAGQERFRKSMVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGNKCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHRLH 571
            LQ+WDTAGQE FR S+   YYR     + V+D+TRR++F HL  W+ +  +++ +N V  ++IGNK DLE +R V  +E + FA E+ L   ETSAK    + NV+  F+     ++
Sbjct:   57 LQIWDTAGQESFR-SITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSSSNMVI-MLIGNKSDLEARRDVKREEGEAFAREHGLVFMETSAKT---AANVEEAFINTAKAIY 168          
The following BLAST results are available for this feature:
BLAST of Ras-related protein Rab-33B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB33B3.241e-4558.21RAB33B, member RAS oncogene family [Source:HGNC Sy... [more]
RAB33B6.276e-4558.21RAB33B, member RAS oncogene family [Source:HGNC Sy... [more]
RAB33A1.043e-3755.17RAB33A, member RAS oncogene family [Source:HGNC Sy... [more]
RAB1A2.578e-2843.10RAB1A, member RAS oncogene family [Source:HGNC Sym... [more]
RAB1A2.578e-2843.10RAB1A, member RAS oncogene family [Source:HGNC Sym... [more]
back to top
BLAST of Ras-related protein Rab-33B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab-337.850e-4360.66Ras-related protein Rab-33 [Source:UniProtKB/Swis... [more]
rab-16.753e-3043.10RAB family [Source:UniProtKB/TrEMBL;Acc:Q9UAQ6][more]
rab-355.420e-2645.13RAB family [Source:UniProtKB/TrEMBL;Acc:Q9U2C3][more]
rab-87.535e-2644.74RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
rab-87.535e-2644.74RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
back to top
BLAST of Ras-related protein Rab-33B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab84.592e-2643.86gene:FBgn0262518 transcript:FBtr0308832[more]
Rab11.315e-2540.52gene:FBgn0285937 transcript:FBtr0084104[more]
Rab81.596e-2543.86gene:FBgn0262518 transcript:FBtr0308833[more]
Rab81.596e-2543.86gene:FBgn0262518 transcript:FBtr0074921[more]
Rab357.313e-2443.10gene:FBgn0031090 transcript:FBtr0333548[more]
back to top
BLAST of Ras-related protein Rab-33B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1015591.781e-4360.34zgc:101559 [Source:ZFIN;Acc:ZDB-GENE-041114-122][more]
zgc:1015591.781e-4360.34zgc:101559 [Source:ZFIN;Acc:ZDB-GENE-041114-122][more]
zgc:1015591.781e-4360.34zgc:101559 [Source:ZFIN;Acc:ZDB-GENE-041114-122][more]
zgc:1015591.781e-4360.34zgc:101559 [Source:ZFIN;Acc:ZDB-GENE-041114-122][more]
rab33a9.646e-4257.76RAB33A, member RAS oncogene family [Source:ZFIN;Ac... [more]
back to top
BLAST of Ras-related protein Rab-33B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab33b2.460e-4658.21RAB33B, member RAS oncogene family [Source:NCBI ge... [more]
rab33b2.647e-4658.21RAB33B, member RAS oncogene family [Source:NCBI ge... [more]
rab33a1.268e-3450.86RAB33A, member RAS oncogene family [Source:NCBI ge... [more]
rab1a1.485e-2842.74RAB1A, member RAS oncogene family [Source:NCBI gen... [more]
rab1a1.644e-2843.10RAB1A, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of Ras-related protein Rab-33B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab33b1.038e-4558.21RAB33B, member RAS oncogene family [Source:MGI Sym... [more]
Rab33a7.470e-3855.17RAB33A, member RAS oncogene family [Source:MGI Sym... [more]
Rab1a1.770e-2843.10RAB1A, member RAS oncogene family [Source:MGI Symb... [more]
Rab1a2.276e-2843.10RAB1A, member RAS oncogene family [Source:MGI Symb... [more]
Rab302.369e-2745.45RAB30, member RAS oncogene family [Source:MGI Symb... [more]
back to top
BLAST of Ras-related protein Rab-33B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P91580|RAB33_CIOIN4.040e-4762.39Putative Ras-related protein Rab-33 OS=Ciona intes... [more]
sp|O35963|RB33B_MOUSE7.259e-4558.21Ras-related protein Rab-33B OS=Mus musculus OX=100... [more]
sp|Q9H082|RB33B_HUMAN1.557e-4458.21Ras-related protein Rab-33B OS=Homo sapiens OX=960... [more]
sp|Q5R615|RB33B_PONAB9.869e-4457.46Ras-related protein Rab-33B OS=Pongo abelii OX=960... [more]
sp|Q5ZHV1|RB33B_CHICK2.898e-4359.48Ras-related protein Rab-33B OS=Gallus gallus OX=90... [more]
back to top
BLAST of Ras-related protein Rab-33B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4BAC51.241e-4562.93Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A1S3JMT91.295e-4561.21putative Ras-related protein Rab-33 OS=Lingula ung... [more]
A0A3S1HSK71.386e-4561.02Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A293LDM35.849e-4564.66RAS related protein (Fragment) OS=Ornithodoros err... [more]
R7UNT76.299e-4561.67Uncharacterized protein OS=Capitella teleta OX=283... [more]
back to top
BLAST of Ras-related protein Rab-33B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1015592.596e-4260.34ras-related protein Rab-33B-like [Source:NCBI gene... [more]
rab33ba3.351e-4256.80RAB33B, member RAS oncogene family a [Source:ZFIN;... [more]
ENSAMXT00000048868.16.124e-3450.83pep primary_assembly:Astyanax_mexicanus-2.0:25:540... [more]
ENSAMXT00000055997.17.495e-3450.83pep primary_assembly:Astyanax_mexicanus-2.0:25:540... [more]
ENSAMXT00000035653.19.357e-3450.83pep primary_assembly:Astyanax_mexicanus-2.0:25:540... [more]
back to top
BLAST of Ras-related protein Rab-33B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab33ba9.495e-4258.12RAB33B, member RAS oncogene family a [Source:ZFIN;... [more]
rab1aa1.482e-2943.10RAB1A, member RAS oncogene family a [Source:ZFIN;A... [more]
ENSPMAT00000010665.18.729e-2748.45pep scaffold:Pmarinus_7.0:GL482742:3398:12039:1 ge... [more]
rab8a2.849e-2542.98RAB8A, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab2a6.981e-2542.74RAB2A, member RAS oncogene family [Source:ZFIN;Acc... [more]
back to top
BLAST of Ras-related protein Rab-33B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YPT19.242e-2943.97Rab family GTPase; involved in the ER-to-Golgi ste... [more]
SEC48.995e-2237.61Rab family GTPase; essential for vesicle-mediated ... [more]
VPS211.517e-2139.02Endosomal Rab family GTPase; required for endocyti... [more]
YPT61.350e-2041.03Rab family GTPase; required for endosome-to-Golgii... [more]
YPT313.965e-1837.07Rab family GTPase; involved in the exocytic pathwa... [more]
back to top
BLAST of Ras-related protein Rab-33B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO444622.659e-4156.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401679.155e-2841.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410183.301e-2542.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421444.011e-2542.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431295.709e-2544.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras-related protein Rab-33B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1015595.533e-4460.34ras-related protein Rab-33B [Source:NCBI gene;Acc:... [more]
rab33ba1.066e-4354.23ras-related protein Rab-33B [Source:NCBI gene;Acc:... [more]
rab33a4.025e-3956.90ras-related protein Rab-33A [Source:NCBI gene;Acc:... [more]
ENSORLT00000002583.26.568e-2955.45pep primary_assembly:ASM223467v1:1:5626778:5630215... [more]
zgc:1719279.436e-2944.44ras-related protein ORAB-1-like [Source:NCBI gene;... [more]
back to top
BLAST of Ras-related protein Rab-33B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078531.12.201e-8599.25SMESG000078531.1[more]
SMESG000026323.16.407e-2843.97SMESG000026323.1[more]
SMESG000049854.12.523e-2743.10SMESG000049854.1[more]
SMESG000078456.11.988e-2647.37SMESG000078456.1[more]
SMESG000076159.11.955e-2341.03SMESG000076159.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032522 ID=SMED30032522|Name=Ras-related protein Rab-33B|organism=Schmidtea mediterranea sexual|type=transcript|length=862bp
ATCAAAATTTGTTTTTCAACATACAATATGGGAAAGTTTTAAATAATTTT
GTATGGATTTTTCCATTGGTTTTGAAGTTTCATAAATTTCGATTTAGCTT
AGTTTTATATTTTTCATCAAATTTTACTAAATGTTAAAATTTTTAAAAAG
TGCGAGGAAAATACAGTGAATTTTTAAGATAAAGTTTTACATGTTTTGAA
TACCTCGACATTTATTGTAGTTGCAATTATGGGATACGGCAGGTCAGGAA
AGATTCCGTAAGAGCATGGTTCCGCATTATTATAGAAATGTTCACGCAGT
TGTGTTTGTATTTGATGTTACTCGTCGAGACAGTTTTGAACATCTCGTCG
AATGGATCCGTGAATGTGAGAAATACAATCTTGCCAATAGTGTTCATCGG
ATTATCATTGGAAATAAATGTGATTTAGAAGGGAAACGGGTTGTCAGTGA
ACAGGAAGCTCAGAAATTTGCTGACGAATACCGATTACCGTTATTTGAGA
CTTCGGCTAAAAAAGATTCCTTATCAGATAACGTCGATGGCATATTTTTA
ACAATTGTCCATCGGTTACATTCGTCCAAATCGTTGATATTATCATCAAT
TCCCGAAGATGTAATTGAACTGTCCAGATCTTCCAAACCGCAAACTTCAT
CAAATTCTAATAGTTGTAGTTGTTGATGTATCGAGCATTGCTCATCAGTT
TTTATGAATTTTTGATCTTTAAAGAAAATAAAATTTTATTGTTTTTTCTA
GATTATGCGATTTTGTTTCATTGCGGTATTTCCTCATAATAATATTTAAT
ATTTTTACAACATATCCTTGGTATTATTTATGTTTTCAATTATTTAATTT
TGTAAATAAATG
back to top

protein sequence of SMED30032522-orf-1

>SMED30032522-orf-1 ID=SMED30032522-orf-1|Name=SMED30032522-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=137bp
MVPHYYRNVHAVVFVFDVTRRDSFEHLVEWIRECEKYNLANSVHRIIIGN
KCDLEGKRVVSEQEAQKFADEYRLPLFETSAKKDSLSDNVDGIFLTIVHR
LHSSKSLILSSIPEDVIELSRSSKPQTSSNSNSCSC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000045autophagosome assembly
GO:0006891intra-Golgi vesicle-mediated transport
GO:0006914autophagy
GO:0015031protein transport
GO:0032482Rab protein signal transduction
GO:0034067protein localization to Golgi apparatus
GO:0048705skeletal system morphogenesis
GO:1903358regulation of Golgi organization
GO:1903434negative regulation of constitutive secretory pathway
GO:2000156regulation of retrograde vesicle-mediated transport, Golgi to ER
GO:0007264small GTPase mediated signal transduction
GO:2000785regulation of autophagosome assembly
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005794Golgi apparatus
GO:0005796Golgi lumen
GO:0005622intracellular
GO:0005886plasma membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR027417P-loop_NTPase
IPR001806Small_GTPase
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 1..104
e-value: 3.8E-5
score: -34.4
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 1..104
e-value: 9.1E-13
score: 49.7
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..108
e-value: 1.8E-30
score: 107.7
NoneNo IPR availablePANTHERPTHR24073FAMILY NOT NAMEDcoord: 1..128
NoneNo IPR availablePANTHERPTHR24073:SF378RAS-RELATED PROTEIN RAB-33Bcoord: 1..128
NoneNo IPR availablePROSITEPS51419RABcoord: 1..136
score: 19.014
IPR001806Small GTPasePFAMPF00071Rascoord: 2..101
e-value: 3.0E-23
score: 82.2
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1..133