Upstream activation factor subunit UAF30

Overview
NameUpstream activation factor subunit UAF30
Smed IDSMED30032516
Length (bp)1066
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Upstream activation factor subunit UAF30 (SMED30032516) t-SNE clustered cells

Violin plots show distribution of expression levels for Upstream activation factor subunit UAF30 (SMED30032516) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Upstream activation factor subunit UAF30 (SMED30032516) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Upstream activation factor subunit UAF30 (SMED30032516) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032516

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30032516SMESG000064350.1 SmedASXL_013859SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30032516SMESG000064350.1 SmedASXL_013859SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
posterior muscle cellSMED30032516SMESG000064350.1 dd_Smed_v4_7810_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30032516SMESG000064350.1 dd_Smed_v4_7810_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Upstream activation factor subunit UAF30 vs. Ensembl Celegans
Match: T24G10.2 (pep chromosome:WBcel235:III:5440862:5442761:-1 gene:WBGene00020779.1 transcript:T24G10.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T24G10.2)

HSP 1 Score: 66.2402 bits (160), Expect = 5.786e-12
Identity = 40/120 (33.33%), Postives = 60/120 (50.00%), Query Frame = 1
Query:  469 AEINGMRNLRKT-----FSNRKPKENKKVKSDKVGTKQTRGYGKDQNL---SEPMSQYLGSEKMARHDVVKKFWDIAKEKNMFDPSNRQFVLCDDDWQRLFSKKRIRMFSIAKFLEKHYI 804
            A  + ++ +R T     F+N K K+ K   +D  G      +G    L   S  + Q    + M R DVVK  WD  KE N+ DP N Q+++CD   + +F K R++ F + KFL +H I
Sbjct:  157 AASDALKQIRNTSEGGRFANNKKKKVKDPNADMSGV-----FGPMTKLCYISTELQQVTKDQWMKRCDVVKALWDYIKENNLKDPKNGQYIICDSTLESIFKKNRLKGFGMVKFLTRHII 271          
BLAST of Upstream activation factor subunit UAF30 vs. Ensembl Fly
Match: Non2 (gene:FBgn0035370 transcript:FBtr0072969)

HSP 1 Score: 80.8777 bits (198), Expect = 2.627e-17
Identity = 30/81 (37.04%), Postives = 53/81 (65.43%), Query Frame = 1
Query:  562 KQTRGYGKDQNLSEPMSQYLGSEKMARHDVVKKFWDIAKEKNMFDPSNRQFVLCDDDWQRLFSKKRIRMFSIAKFLEKHYI 804
            +++ G+ +  NLS  +S  +G   + RH+VVKK W I KE++++DP N+QF +CDD+  ++   +R R F + K L+ H++
Sbjct:  163 RKSTGFTRAYNLSPELSALMGESSLPRHEVVKKVWAIIKERDLYDPKNKQFAICDDELMKVMKIRRFRTFGMLKHLKPHFL 243          
BLAST of Upstream activation factor subunit UAF30 vs. UniProt/SwissProt
Match: sp|Q05024|TRI1_YEAST (Protein TRI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRI1 PE=1 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 3.963e-11
Identity = 30/73 (41.10%), Postives = 46/73 (63.01%), Query Frame = 1
Query:  595 LSEPMSQYLGSEKMARHDVVKKFWDIAKEKNMFDPSNRQFVLCDDDWQRLFSKKRIRMFSIAKFLEKHYIKND 813
            LS P+ ++LGSE++ R  VVK  W   KE ++ +P +R+ +LCD+  + +F KK + MFS+ K L KH    D
Sbjct:  126 LSAPLQKFLGSEELPRTQVVKMIWQYIKEHDLQNPKDRREILCDEKMEPIFGKK-MTMFSMNKLLTKHLFNPD 197          
BLAST of Upstream activation factor subunit UAF30 vs. UniProt/SwissProt
Match: sp|O74503|UAF30_SCHPO (Upstream activation factor subunit spp27 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spp27 PE=1 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.068e-10
Identity = 56/229 (24.45%), Postives = 95/229 (41.48%), Query Frame = 1
Query:  103 ISEILDEADLKSVSAKAVRLKLQEKLNEDFTKDKLEIDKLIMKLYNERLPKSDDESSSLDENINVKVKKRKITSSLKKDIKKKMVTSKDKNGGVTTSNAANESSGDSIVDNDNDAELARALQAEINGMRNLRKTFSNRKPKENKKVKSDKVGTKQTRGYGKDQNLSEPMSQYLGSEKMARHDVVKKFWDIAKEKNMFDPSNRQFVLCDDDWQRLFSKKRIRMFSIAKFL 789
            I +IL   D ++VSAK VR  L+E+   D +  K +++ LI+K ++E    S+ ES                         +K   ++   G   T N   E    +           R    E  G R       N+ P  N                 K   LS  ++++LG E+++R   VKK W+  K  ++ DP++++ +LCDD  + +F    + MF++ K+L
Sbjct:    8 IKQILGTVDRQTVSAKQVRQLLEERRKVDLSAHKKDLNALILKCFDETAAPSEKESL------------------------EKQAPARKTKGKRATENGTEEGKKPAKRTR------KRKEDGEEGGKRK-----RNQDPANN--------------PLNKPMKLSPKLAEFLGLEQLSRPQTVKKLWEYIKAHDLQDPNDKRTILCDDKLKSVFEVDTLHMFTMNKYL 187          
BLAST of Upstream activation factor subunit UAF30 vs. UniProt/SwissProt
Match: sp|Q08747|UAF30_YEAST (Upstream activation factor subunit UAF30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UAF30 PE=1 SV=1)

HSP 1 Score: 50.8322 bits (120), Expect = 4.814e-6
Identity = 21/69 (30.43%), Postives = 39/69 (56.52%), Query Frame = 1
Query:  592 NLSEPMSQYLGSEKMARHDVVKKFWDIAKEKNMFDPSNRQFVLCDDDWQRLFSKKRIRMFSIAKFLEKH 798
             LS+ ++  LG  ++ R +VV++ W   K  N+ +P+N++ +LCD+  + +  K    MF + K L  H
Sbjct:  125 TLSKSLASLLGEHELTRTEVVRRLWAYIKAHNLQNPNNKKEILCDEKLELILGKS-TNMFEMHKILASH 192          
BLAST of Upstream activation factor subunit UAF30 vs. TrEMBL
Match: A0A4Z2D0I5 (Upstream activation factor subunit spp27 isoform 3 OS=Schistosoma japonicum OX=6182 GN=EWB00_006192 PE=4 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 3.455e-37
Identity = 87/241 (36.10%), Postives = 139/241 (57.68%), Query Frame = 1
Query:  103 ISEILDEADLKSVSAKAVRLKLQEKLNEDFTKDKLEIDKLIMKLYNERLPKSDDESSSLDENINVKVKKRKITSSLKKDIKKKMVTSKDKNGGVTTSNAANESSGDSIVDN-----DNDAELARALQAEINGMRNLRKTFSNRKPKENKKVKSDKVGTKQTRGYGKDQNLSEPMSQYLGSEKMARHDVVKKFWDIAKEKNMFDPSNRQFVLCDDDWQRLFSKKRIRMFSIAKFLEKHYIKN 810
            I ++L +ADL  V++K VR  L+   N D + +K +++ +IM              S+L+          K+ SS  K       +S  +    T S+A+ ES  +  V        +D + AR+L AE NGMR  R++  N KPK+ K+  S K G      + +   LS+ +++Y+G+++++R D+VKKFW IAKE+++FDP+N+QFV+C++DWQRLF+ KR RMF +AK L++H I N
Sbjct:   13 IEKLLQDADLSQVTSKKVRSALESHFNIDLSTEKSKLETMIM--------------STLE----------KLQSSRSKSRNGSKRSSSPEPEEFTESDASCESEPEEPVKKKRNKASDDEDYARSLHAETNGMR--RRSGCNSKPKQQKQPGSGKTG------FTRPLLLSDELAEYVGAKELSRSDLVKKFWKIAKEQDLFDPNNKQFVVCNEDWQRLFNLKRFRMFGVAKHLKRHIIGN 221          
BLAST of Upstream activation factor subunit UAF30 vs. TrEMBL
Match: C1L7P9 (Upstream activation factor subunit UAF30 OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 3.465e-37
Identity = 86/239 (35.98%), Postives = 139/239 (58.16%), Query Frame = 1
Query:  103 ISEILDEADLKSVSAKAVRLKLQEKLNEDFTKDKLEIDKLIMKLYNERLPKSDDESSSLDENINVKVKKRKITSSLKKDIKKKMVTSKDKNGGVTTSNAANESSGDSIVDN-----DNDAELARALQAEINGMRNLRKTFSNRKPKENKKVKSDKVGTKQTRGYGKDQNLSEPMSQYLGSEKMARHDVVKKFWDIAKEKNMFDPSNRQFVLCDDDWQRLFSKKRIRMFSIAKFLEKHYI 804
            I ++L +ADL  V++K VR  L+   N D + +K +++ +IM              S+L+          K+ SS  K+      +S  +    T S+A+ ES  +  V        +D + AR+L AE NGMR  R++  N KPK+ K+  S K G      + +   LS+ +++Y+G+++++R D+VKKFW IAKE+++FDP+N+QFV+C++DWQRLF+ KR RMF +AK L++H I
Sbjct:   13 IEKLLQDADLSQVTSKKVRSALESHFNIDLSTEKSKLETMIM--------------STLE----------KLQSSRSKNRNGSKRSSSPEPEEFTESDASCESEPEEPVKKKRNKASDDEDYARSLHAETNGMR--RRSGCNSKPKQQKQPGSGKTG------FTRPLLLSDELAEYVGAKELSRSDLVKKFWKIAKEQDLFDPNNKQFVVCNEDWQRLFNLKRFRMFGVAKHLKRHII 219          
BLAST of Upstream activation factor subunit UAF30 vs. TrEMBL
Match: A0A4Z2CZQ7 (Upstream activation factor subunit spp27 isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_006192 PE=4 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 5.232e-37
Identity = 86/239 (35.98%), Postives = 138/239 (57.74%), Query Frame = 1
Query:  103 ISEILDEADLKSVSAKAVRLKLQEKLNEDFTKDKLEIDKLIMKLYNERLPKSDDESSSLDENINVKVKKRKITSSLKKDIKKKMVTSKDKNGGVTTSNAANESSGDSIVDN-----DNDAELARALQAEINGMRNLRKTFSNRKPKENKKVKSDKVGTKQTRGYGKDQNLSEPMSQYLGSEKMARHDVVKKFWDIAKEKNMFDPSNRQFVLCDDDWQRLFSKKRIRMFSIAKFLEKHYI 804
            I ++L +ADL  V++K VR  L+   N D + +K +++ +IM              S+L+          K+ SS  K       +S  +    T S+A+ ES  +  V        +D + AR+L AE NGMR  R++  N KPK+ K+  S K G      + +   LS+ +++Y+G+++++R D+VKKFW IAKE+++FDP+N+QFV+C++DWQRLF+ KR RMF +AK L++H I
Sbjct:   13 IEKLLQDADLSQVTSKKVRSALESHFNIDLSTEKSKLETMIM--------------STLE----------KLQSSRSKSRNGSKRSSSPEPEEFTESDASCESEPEEPVKKKRNKASDDEDYARSLHAETNGMR--RRSGCNSKPKQQKQPGSGKTG------FTRPLLLSDELAEYVGAKELSRSDLVKKFWKIAKEQDLFDPNNKQFVVCNEDWQRLFNLKRFRMFGVAKHLKRHII 219          
BLAST of Upstream activation factor subunit UAF30 vs. TrEMBL
Match: C1LM22 (Upstream activation factor subunit UAF30 OS=Schistosoma japonicum OX=6182 GN=EWB00_006192 PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 5.584e-37
Identity = 86/239 (35.98%), Postives = 138/239 (57.74%), Query Frame = 1
Query:  103 ISEILDEADLKSVSAKAVRLKLQEKLNEDFTKDKLEIDKLIMKLYNERLPKSDDESSSLDENINVKVKKRKITSSLKKDIKKKMVTSKDKNGGVTTSNAANESSGDSIVDN-----DNDAELARALQAEINGMRNLRKTFSNRKPKENKKVKSDKVGTKQTRGYGKDQNLSEPMSQYLGSEKMARHDVVKKFWDIAKEKNMFDPSNRQFVLCDDDWQRLFSKKRIRMFSIAKFLEKHYI 804
            I ++L +ADL  V++K VR  L+   N D + +K +++ +IM              S+L+          K+ SS  K       +S  +    T S+A+ ES  +  V        +D + AR+L AE NGMR  R++  N KPK+ K+  S K G      + +   LS+ +++Y+G+++++R D+VKKFW IAKE+++FDP+N+QFV+C++DWQRLF+ KR RMF +AK L++H I
Sbjct:   13 IEKLLQDADLSQVTSKKVRSALESHFNIDLSTEKSKLETMIM--------------STLE----------KLQSSRSKSRNGSKRSSSPEPEEFTESDASCESEPEEPVKKKRNKASDDEDYARSLHAETNGMR--RRSGCNSKPKQQKQPGSGKTG------FTRPLLLSDELAEYVGAKELSRSDLVKKFWKIAKEQDLFDPNNKQFVVCNEDWQRLFNLKRFRMFGVAKHLKRHII 219          
BLAST of Upstream activation factor subunit UAF30 vs. TrEMBL
Match: G4V889 (SWIB domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_006830.1 PE=4 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 4.916e-35
Identity = 86/234 (36.75%), Postives = 139/234 (59.40%), Query Frame = 1
Query:  103 ISEILDEADLKSVSAKAVRLKLQEKLNEDFTKDKLEIDKLIMKLYNERLPKSDDESSSLDENINVKVKKRKITSSLKKDIKKKMVTSKDKNGGVTTSNAANESSGDSIVDNDNDAELARALQAEINGMRNLRKTFSNRKPKENKKVKSDKVGTKQTRGYGKDQNLSEPMSQYLGSEKMARHDVVKKFWDIAKEKNMFDPSNRQFVLCDDDWQRLFSKKRIRMFSIAKFLEKHYI 804
            I +IL +ADL  V++K VR  L+   N D + +K +++ +IM    E+L       SS  +N N      K++SS + D   +  +S D            ++S        +D + AR+L AE NGMR  R++ S+ KP+  K+  S K G      + +   LS+ M++Y+G ++++R D+VKKFW+IA+E+++FDP+N+QFV+C++DWQRLF+ KR RMF +AK L++H I
Sbjct:   13 IEKILQDADLSQVTSKKVRSALEAHFNIDLSTEKSKLETMIMSTL-EKL------QSSKSQNRN----NSKLSSSPEVDECTESDSSSDSEPEKPVKKKKKKTS--------DDEDYARSLHAEANGMR--RRSSSSTKPRSQKQPGSGKTG------FTRPLTLSDEMAEYIGEKELSRSDLVKKFWEIAREQDLFDPNNKQFVVCNEDWQRLFNLKRFRMFGVAKHLKRHII 219          
BLAST of Upstream activation factor subunit UAF30 vs. Ensembl Yeast
Match: TRI1 (Non-essential sumoylated protein of unknown function; similar to components of human SWI/SNF complex including SMRD3; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm, nucleus and nucleolus; TRI1 has a paralog, UAF30, that arose from the whole genome duplication [Source:SGD;Acc:S000004846])

HSP 1 Score: 65.855 bits (159), Expect = 5.708e-13
Identity = 30/73 (41.10%), Postives = 46/73 (63.01%), Query Frame = 1
Query:  595 LSEPMSQYLGSEKMARHDVVKKFWDIAKEKNMFDPSNRQFVLCDDDWQRLFSKKRIRMFSIAKFLEKHYIKND 813
            LS P+ ++LGSE++ R  VVK  W   KE ++ +P +R+ +LCD+  + +F KK + MFS+ K L KH    D
Sbjct:  126 LSAPLQKFLGSEELPRTQVVKMIWQYIKEHDLQNPKDRREILCDEKMEPIFGKK-MTMFSMNKLLTKHLFNPD 197          
BLAST of Upstream activation factor subunit UAF30 vs. Ensembl Yeast
Match: UAF30 (Subunit of UAF (upstream activation factor) complex; UAF is an RNA polymerase I specific transcription stimulatory factor composed of Uaf30p, Rrn5p, Rrn9p, Rrn10p, histones H3 and H4; targeting factor for the UAF that facilitates activation of many rDNA genes; deletion decreases cellular growth rate; UAF30 has a paralog, TRI1, that arose from the whole genome duplication [Source:SGD;Acc:S000005821])

HSP 1 Score: 50.8322 bits (120), Expect = 6.933e-8
Identity = 21/69 (30.43%), Postives = 39/69 (56.52%), Query Frame = 1
Query:  592 NLSEPMSQYLGSEKMARHDVVKKFWDIAKEKNMFDPSNRQFVLCDDDWQRLFSKKRIRMFSIAKFLEKH 798
             LS+ ++  LG  ++ R +VV++ W   K  N+ +P+N++ +LCD+  + +  K    MF + K L  H
Sbjct:  125 TLSKSLASLLGEHELTRTEVVRRLWAYIKAHNLQNPNNKKEILCDEKLELILGKS-TNMFEMHKILASH 192          
BLAST of Upstream activation factor subunit UAF30 vs. Ensembl Nematostella
Match: EDO43110 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZK2])

HSP 1 Score: 104.76 bits (260), Expect = 1.549e-24
Identity = 75/251 (29.88%), Postives = 136/251 (54.18%), Query Frame = 1
Query:   88 KIEECISEILDEADLKSVSAKAVRLKLQEKLNEDFTKDKLEIDKLIMKLYNERLPKSDD--------ESSSLDENINVKVKKRKIT--SSLKKDIKKKMVTSKDKNGGVTTSNAANESSGDSIVDNDNDAELARALQAEINGMRNLRKTFSNRKPKENKKVKSDKVGTKQTRGYGKDQNLSEPMSQYLGSEKMARHDVVKKFWDIAKEKNMFDPSNRQFVLCDDDWQRLFSKKRIRMFSIAKFLEKHYIKN 810
            ++  C  +IL +A+L  ++++ VR +L+EK +    + K E+D L+M+   E+  ++ D        E S  +  I+ K    K+   +S K+ +KK   T   ++  ++++    E       ++ +D ++AR L     G+R  +++    +    KK  S   GTK   G+GK   LS  ++  LG +KM+R DVVK  W I KE+N+ DP +++F +CDD   ++F  KR++ FS+ K+L KH++K+
Sbjct: 1336 RLYYCQLDILQDAELSELTSRIVRSRLEEKFSVSLKERKKEVDALLMQTIQEKEAENTDKIGEKNNAERSDEESEISEKGDTEKVVHKASKKRVLKKSPATPSKRSKPISSA----EVPESDSDEDVDDEKIARKLHENERGLRARKQSVKKAQKTPQKKEPS---GTKGKTGFGKLMVLSPELAAILGQDKMSRSDVVKGMWAIIKERNLMDPKDKRFHICDDQLLKVFGTKRVKSFSMMKYL-KHHVKD 1578          
BLAST of Upstream activation factor subunit UAF30 vs. Planmine SMEST
Match: SMESG000064350.1 (SMESG000064350.1)

HSP 1 Score: 497.278 bits (1279), Expect = 2.594e-179
Identity = 247/249 (99.20%), Postives = 248/249 (99.60%), Query Frame = 1
Query:   67 MNKVDISKIEECISEILDEADLKSVSAKAVRLKLQEKLNEDFTKDKLEIDKLIMKLYNERLPKSDDESSSLDENINVKVKKRKITSSLKKDIKKKMVTSKDKNGGVTTSNAANESSGDSIVDNDNDAELARALQAEINGMRNLRKTFSNRKPKENKKVKSDKVGTKQTRGYGKDQNLSEPMSQYLGSEKMARHDVVKKFWDIAKEKNMFDPSNRQFVLCDDDWQRLFSKKRIRMFSIAKFLEKHYIKND 813
            MNKVDISKIEECISEILDEADLKSVSAKAVRLKLQEKLNEDFTKDKLEIDKLIMKLYNERLPKSDDESSSLDE+INVKVKKRKITSSLKKDIKKKMVTSKDKNGGVTTSN ANESSGDSIVDNDNDAELARALQAEINGMRNLRKTFSNRKPKENKKVKSDKVGTKQTRGYGKDQNLSEPMSQYLGSEKMARHDVVKKFWDIAKEKNMFDPSNRQFVLCDDDWQRLFSKKRIRMFSIAKFLEKHYIKND
Sbjct:    1 MNKVDISKIEECISEILDEADLKSVSAKAVRLKLQEKLNEDFTKDKLEIDKLIMKLYNERLPKSDDESSSLDEDINVKVKKRKITSSLKKDIKKKMVTSKDKNGGVTTSNVANESSGDSIVDNDNDAELARALQAEINGMRNLRKTFSNRKPKENKKVKSDKVGTKQTRGYGKDQNLSEPMSQYLGSEKMARHDVVKKFWDIAKEKNMFDPSNRQFVLCDDDWQRLFSKKRIRMFSIAKFLEKHYIKND 249          
The following BLAST results are available for this feature:
BLAST of Upstream activation factor subunit UAF30 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Upstream activation factor subunit UAF30 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
T24G10.25.786e-1233.33pep chromosome:WBcel235:III:5440862:5442761:-1 gen... [more]
back to top
BLAST of Upstream activation factor subunit UAF30 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Non22.627e-1737.04gene:FBgn0035370 transcript:FBtr0072969[more]
back to top
BLAST of Upstream activation factor subunit UAF30 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Upstream activation factor subunit UAF30 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Upstream activation factor subunit UAF30 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Upstream activation factor subunit UAF30 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q05024|TRI1_YEAST3.963e-1141.10Protein TRI1 OS=Saccharomyces cerevisiae (strain A... [more]
sp|O74503|UAF30_SCHPO1.068e-1024.45Upstream activation factor subunit spp27 OS=Schizo... [more]
sp|Q08747|UAF30_YEAST4.814e-630.43Upstream activation factor subunit UAF30 OS=Saccha... [more]
back to top
BLAST of Upstream activation factor subunit UAF30 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2D0I53.455e-3736.10Upstream activation factor subunit spp27 isoform 3... [more]
C1L7P93.465e-3735.98Upstream activation factor subunit UAF30 OS=Schist... [more]
A0A4Z2CZQ75.232e-3735.98Upstream activation factor subunit spp27 isoform 1... [more]
C1LM225.584e-3735.98Upstream activation factor subunit UAF30 OS=Schist... [more]
G4V8894.916e-3536.75SWIB domain-containing protein OS=Schistosoma mans... [more]
back to top
BLAST of Upstream activation factor subunit UAF30 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Upstream activation factor subunit UAF30 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Upstream activation factor subunit UAF30 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
TRI15.708e-1341.10Non-essential sumoylated protein of unknown functi... [more]
UAF306.933e-830.43Subunit of UAF (upstream activation factor) comple... [more]
back to top
BLAST of Upstream activation factor subunit UAF30 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO431101.549e-2429.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Upstream activation factor subunit UAF30 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Upstream activation factor subunit UAF30 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000064350.12.594e-17999.20SMESG000064350.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032516 ID=SMED30032516|Name=Upstream activation factor subunit UAF30|organism=Schmidtea mediterranea sexual|type=transcript|length=1066bp
CTGGAAATTTAAATTTCGATTGTTTGTATAATAGATTGTTATAAGTTAAC
ATTTAAAAATTTTAAAATGAATAAAGTCGATATTTCGAAAATTGAAGAAT
GCATTAGTGAAATTCTCGATGAAGCTGATTTAAAATCTGTATCTGCAAAA
GCAGTTCGTTTGAAACTCCAAGAAAAATTAAATGAAGATTTTACTAAAGA
TAAACTAGAAATCGATAAGTTAATAATGAAATTGTATAATGAAAGATTAC
CAAAATCAGACGATGAGTCAAGCAGTCTGGATGAAAACATAAATGTGAAG
GTCAAAAAACGTAAAATTACATCTAGTTTGAAAAAAGACATTAAAAAAAA
AATGGTCACTAGTAAAGATAAAAATGGTGGAGTTACAACATCAAATGCTG
CCAACGAAAGTAGTGGTGATTCAATTGTCGATAATGATAATGACGCTGAA
TTGGCTAGAGCTTTGCAAGCTGAAATTAATGGAATGAGAAATCTCAGAAA
AACGTTTTCAAATAGAAAACCAAAAGAAAATAAAAAGGTAAAGAGTGACA
AAGTTGGCACTAAGCAAACCAGAGGTTATGGTAAAGATCAGAATTTATCT
GAACCAATGTCCCAATATTTGGGATCCGAGAAAATGGCGCGTCATGACGT
GGTGAAGAAATTTTGGGATATTGCTAAAGAGAAAAATATGTTTGATCCGT
CAAATCGACAATTTGTATTATGTGATGATGACTGGCAGCGGTTATTCTCA
AAAAAACGCATTCGAATGTTTTCTATTGCGAAATTCTTAGAAAAGCACTA
TATTAAAAATGATTAGTATTCATTATTTTGTTATTTGCTATTAAATATTG
ATAGTTGTGTTTATATTGTAATGTTTCGAGTTTTTCTATTGATGTGCTTT
AGTATTTGTATTATTAAATGTCAGTTATGCCGTTGTTCTGTCTATTTTTG
TCACTGCTTACACATTTATTCTTCCGTAAAGTTGGTGAGGTTTTTATATT
GCCCTTCAACTGGAATAGATCAAGCAGCTCTGTCGATAATTTAGCCAATG
TAAATAAAGAGATCAG
back to top

protein sequence of SMED30032516-orf-1

>SMED30032516-orf-1 ID=SMED30032516-orf-1|Name=SMED30032516-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=250bp
MNKVDISKIEECISEILDEADLKSVSAKAVRLKLQEKLNEDFTKDKLEID
KLIMKLYNERLPKSDDESSSLDENINVKVKKRKITSSLKKDIKKKMVTSK
DKNGGVTTSNAANESSGDSIVDNDNDAELARALQAEINGMRNLRKTFSNR
KPKENKKVKSDKVGTKQTRGYGKDQNLSEPMSQYLGSEKMARHDVVKKFW
DIAKEKNMFDPSNRQFVLCDDDWQRLFSKKRIRMFSIAKFLEKHYIKND*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036885SWIB_MDM2_dom_sf
IPR019835SWIB_domain
IPR014876DEK_C
IPR003121SWIB_MDM2_domain
IPR009057Homeobox-like_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003677DNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019835SWIB domainSMARTSM00151swib_2coord: 171..249
e-value: 1.5E-12
score: 57.7
IPR014876DEK, C-terminalPFAMPF08766DEK_Ccoord: 7..56
e-value: 5.9E-11
score: 42.1
IPR003121SWIB/MDM2 domainPFAMPF02201SWIBcoord: 175..244
e-value: 3.9E-20
score: 71.5
IPR036885SWIB/MDM2 domain superfamilyGENE3DG3DSA:1.10.245.10coord: 164..249
e-value: 2.3E-21
score: 77.4
IPR036885SWIB/MDM2 domain superfamilySUPERFAMILYSSF47592SWIB/MDM2 domaincoord: 168..248
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 144..180
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 101..118
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 147..168
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 99..118
NoneNo IPR availablePANTHERPTHR13844:SF4LD45195Pcoord: 17..244
NoneNo IPR availablePANTHERPTHR13844BRG-1 ASSOCIATED FACTOR 60 BAF60coord: 17..244
NoneNo IPR availableCDDcd10567SWIB-MDM2_likecoord: 177..245
e-value: 9.06929E-23
score: 86.4433
NoneNo IPR availableSUPERFAMILYSSF109715DEK C-terminal domaincoord: 8..57