NPHP8

Overview
NameNPHP8 (AKN21709.1)
Smed IDSMED30032498
Uniprot Best hitProtein fantom OS=Homo sapiens OX=9606 GN=RPGRIP1L PE=1 SV=2 (E=1.18326e-166)
Length (bp)4152
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NPHP8 (SMED30032498) t-SNE clustered cells

Violin plots show distribution of expression levels for NPHP8 (SMED30032498) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NPHP8 (SMED30032498) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NPHP8 (SMED30032498) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032498

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30032498SMESG000076081.1 SmedASXL_016773SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30032498SMESG000076081.1 dd_Smed_v4_11425_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30032498SMESG000076081.1 dd_Smed_v4_11425_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30032498SMESG000076081.1 dd_Smed_v4_11425_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30032498SMESG000076081.1 dd_Smed_v4_11425_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30032498SMESG000076081.1 dd_Smed_v4_11425_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30032498SMESG000076081.1 dd_Smed_v6_11425_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30032498SMESG000076081.1 dd_Smed_v6_11425_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30032498SMESG000076081.1 Contig37156newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30032498SMESG000076081.1 Contig37156uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30032498SMESG000076081.1 dd_Smed_v4_11425_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30032498SMESG000076081.1 dd_Smed_v4_11425_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NPHP8 vs. Ensembl Human
Match: RPGRIP1L (RPGRIP1 like [Source:HGNC Symbol;Acc:HGNC:29168])

HSP 1 Score: 538.88 bits (1387), Expect = 2.503e-168
Identity = 340/913 (37.24%), Postives = 531/913 (58.16%), Query Frame = 3
Query:  177 RKTISQWTKDYLEDKYLRLQDDHETLKKHARLQEXXXXXXXXXXXXXXSDAKKNGDIT--PK--------TDDFEEFRRKCSILESQNGLLKDKVKLLQSQLLAQGKKASVYDNVPSRIKSGAIERSNSIQNSGRKNNIR-VIKPRGELYPLSPRRDESVTGDQSLISLNKVVEDLK--YEVHRLQIEN----EELLKKAYRREDEKL----------SPEHYKSNLKDNLDMIRVTRDIKEKEIQVNVLHGKYEDLKTKQQYLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEPD--LEPLAPEI-LERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDI-NFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGN-----EMSVVEARRP-------IDS----MNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYMYQDNSFT 2774
            R+ +S+ +++ LED++LRL D++  LK+HAR QE KIK++ TKL+++ +D K+   +   PK         +  E+ + K   LE QN  LK+++   + QL  QG + + Y+NV SRI +G   R  + +N+G +   R  IK +      +P    +  G+  L      + +L+   +  R QIE      E+LK   RR++ ++               +SN++DN++MI++ + + EK   ++ + GK+  L+ KQ+ L  ++  +    + L  +L+       + E Q+ ++    +RI +L+   ND +KE  LLKE+ DKL + AF+   E  W+ KE   + +IAQLE  LK D+++K  +L++L++ERD+ +   +E   L+L+  E + Q++EL  ++K +++E  +N  E+ EAL++I+ ++     Q   +L F+ K+D   ++DL R + E +  HAET+QELEKTR++L  Q+KI+ DY+ E E ++++++ +++DYE ++ +Y  LLDIRAARIHKLEAQLKDIAYGT+  + +  + PD  ++     I LERGEN+ EIHI +V  + + ++   DK+P  F T+ FYDFE Q T V+RG   E++  ++YLV ++D FL Y+ KNT   E+HQA   EY T+AACQ+   +I EKS              +  C A L+G +    DI NFG +EYW RL+ PMDQ IR YRE+ KA GYI  N      M  +  + P        DS    +NEL I I  C  L+SR  HLQP PY+ YKF+D + H +  IPSSN P+F D    PV MN DL +YLK ++L  YV D+ D  E++Y+G   +PLI L H++ ISG FEL D+Q    GT+ V L W+ +Y+    S T
Sbjct:   39 RQAVSRVSREELEDRFLRLHDENILLKQHARKQEDKIKRMATKLIRLVNDKKRYERVGGGPKRLGRDVEMEEMIEQLQEKVHELEKQNETLKNRLISAKQQLQTQGYRQTPYNNVQSRINTG---RRKANENAGLQECPRKGIKFQDADVAETPHPMFTKYGNSLLEEARGEIRNLENVIQSQRGQIEELEHLAEILKTQLRRKENEIELSLLQLREQQATDQRSNIRDNVEMIKLHKQLVEKSNALSAMEGKFIQLQEKQRTLRISHDALMANGDELNMQLKEQRLKCCSLEKQLHSMKFSERRIEELQDRINDLEKERELLKENYDKLYDSAFSAAHEEQWKLKEQQLKVQIAQLETALKSDLTDKTEILDRLKTERDQNEKLVQENRELQLQYLEQKQQLDELKKRIKLYNQENDINADELSEALLLIKAQKE----QKNGDLSFLVKVDSEINKDLERSMRELQATHAETVQELEKTRNMLIMQHKINKDYQMEVEAVTRKMENLQQDYELKVEQYVHLLDIRAARIHKLEAQLKDIAYGTKQYKFKPEIMPDDSVDEFDETIHLERGENLFEIHINKVTFSSEVLQASGDKEPVTFCTYAFYDFELQTTPVVRGLHPEYNFTSQYLVHVNDLFLQYIQKNTITLEVHQAYSTEYETIAACQLKFHEILEKSG-------------RIFCTASLIGTK---GDIPNFGTVEYWFRLRVPMDQAIRLYRERAKALGYITSNFKGPEHMQSLSQQAPKTAQLSSTDSTDGNLNELHITIRCCNHLQSRASHLQPHPYVVYKFFDFADHDTAIIPSSNDPQFDDHMYFPVPMNMDLDRYLKSESLSFYVFDDSDTQENIYIGKVNVPLISLAHDRCISGIFELTDHQKHPAGTIHVILKWKFAYLPPSGSIT 928          

HSP 2 Score: 57.7658 bits (138), Expect = 1.699e-7
Identity = 41/131 (31.30%), Postives = 69/131 (52.67%), Query Frame = 3
Query: 3513 DEIVVEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTETISLQKPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATMLT--EEPNKYIVFTLVQEPTADSE-ADCEDIGTAKVNVKTLLKESRNL 3896
            ++I +EI ++ + DS  +  D+ I+ ++VE R   +  E T  +SL KP   Q +    YN+     V    N   R  +  +L   E PN+ + FT+V +P  D +  +CEDIG A V++  + +E R+L
Sbjct: 1101 EKIRIEIIALSLNDS-QVTMDDTIQRLFVECRFYSLPAEET-PVSLPKPKSGQWVY---YNYSNVIYVDKENNKAKRDILKAILQKQEMPNRSLRFTVVSDPPEDEQDLECEDIGVAHVDLADMFQEGRDL 1226          
BLAST of NPHP8 vs. Ensembl Human
Match: RPGRIP1L (RPGRIP1 like [Source:HGNC Symbol;Acc:HGNC:29168])

HSP 1 Score: 538.495 bits (1386), Expect = 5.312e-168
Identity = 340/913 (37.24%), Postives = 531/913 (58.16%), Query Frame = 3
Query:  177 RKTISQWTKDYLEDKYLRLQDDHETLKKHARLQEXXXXXXXXXXXXXXSDAKKNGDIT--PK--------TDDFEEFRRKCSILESQNGLLKDKVKLLQSQLLAQGKKASVYDNVPSRIKSGAIERSNSIQNSGRKNNIR-VIKPRGELYPLSPRRDESVTGDQSLISLNKVVEDLK--YEVHRLQIEN----EELLKKAYRREDEKL----------SPEHYKSNLKDNLDMIRVTRDIKEKEIQVNVLHGKYEDLKTKQQYLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEPD--LEPLAPEI-LERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDI-NFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGN-----EMSVVEARRP-------IDS----MNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYMYQDNSFT 2774
            R+ +S+ +++ LED++LRL D++  LK+HAR QE KIK++ TKL+++ +D K+   +   PK         +  E+ + K   LE QN  LK+++   + QL  QG + + Y+NV SRI +G   R  + +N+G +   R  IK +      +P    +  G+  L      + +L+   +  R QIE      E+LK   RR++ ++               +SN++DN++MI++ + + EK   ++ + GK+  L+ KQ+ L  ++  +    + L  +L+       + E Q+ ++    +RI +L+   ND +KE  LLKE+ DKL + AF+   E  W+ KE   + +IAQLE  LK D+++K  +L++L++ERD+ +   +E   L+L+  E + Q++EL  ++K +++E  +N  E+ EAL++I+ ++     Q   +L F+ K+D   ++DL R + E +  HAET+QELEKTR++L  Q+KI+ DY+ E E ++++++ +++DYE ++ +Y  LLDIRAARIHKLEAQLKDIAYGT+  + +  + PD  ++     I LERGEN+ EIHI +V  + + ++   DK+P  F T+ FYDFE Q T V+RG   E++  ++YLV ++D FL Y+ KNT   E+HQA   EY T+AACQ+   +I EKS              +  C A L+G +    DI NFG +EYW RL+ PMDQ IR YRE+ KA GYI  N      M  +  + P        DS    +NEL I I  C  L+SR  HLQP PY+ YKF+D + H +  IPSSN P+F D    PV MN DL +YLK ++L  YV D+ D  E++Y+G   +PLI L H++ ISG FEL D+Q    GT+ V L W+ +Y+    S T
Sbjct:   39 RQAVSRVSREELEDRFLRLHDENILLKQHARKQEDKIKRMATKLIRLVNDKKRYERVGGGPKRLGRDVEMEEMIEQLQEKVHELEKQNETLKNRLISAKQQLQTQGYRQTPYNNVQSRINTG---RRKANENAGLQECPRKGIKFQDADVAETPHPMFTKYGNSLLEEARGEIRNLENVIQSQRGQIEELEHLAEILKTQLRRKENEIELSLLQLREQQATDQRSNIRDNVEMIKLHKQLVEKSNALSAMEGKFIQLQEKQRTLRISHDALMANGDELNMQLKEQRLKCCSLEKQLHSMKFSERRIEELQDRINDLEKERELLKENYDKLYDSAFSAAHEEQWKLKEQQLKVQIAQLETALKSDLTDKTEILDRLKTERDQNEKLVQENRELQLQYLEQKQQLDELKKRIKLYNQENDINADELSEALLLIKAQKE----QKNGDLSFLVKVDSEINKDLERSMRELQATHAETVQELEKTRNMLIMQHKINKDYQMEVEAVTRKMENLQQDYELKVEQYVHLLDIRAARIHKLEAQLKDIAYGTKQYKFKPEIMPDDSVDEFDETIHLERGENLFEIHINKVTFSSEVLQASGDKEPVTFCTYAFYDFELQTTPVVRGLHPEYNFTSQYLVHVNDLFLQYIQKNTITLEVHQAYSTEYETIAACQLKFHEILEKSG-------------RIFCTASLIGTK---GDIPNFGTVEYWFRLRVPMDQAIRLYRERAKALGYITSNFKGPEHMQSLSQQAPKTAQLSSTDSTDGNLNELHITIRCCNHLQSRASHLQPHPYVVYKFFDFADHDTAIIPSSNDPQFDDHMYFPVPMNMDLDRYLKSESLSFYVFDDSDTQENIYIGKVNVPLISLAHDRCISGIFELTDHQKHPAGTIHVILKWKFAYLPPSGSIT 928          

HSP 2 Score: 59.6918 bits (143), Expect = 4.085e-8
Identity = 42/139 (30.22%), Postives = 73/139 (52.52%), Query Frame = 3
Query: 3513 DEIVVEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTETISLQKPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATMLT--EEPNKYIVFTLVQEPTADSE-ADCEDIGTAKVNVKTLLKESRNLENERIPIY 3920
            ++I +EI ++ + DS  +  D+ I+ ++VE R   +  E T  +SL KP   Q +    YN+     V    N   R  +  +L   E PN+ + FT+V +P  D +  +CEDIG A V++  + +E R+L  + I ++
Sbjct: 1101 EKIRIEIIALSLNDS-QVTMDDTIQRLFVECRFYSLPAEET-PVSLPKPKSGQWVY---YNYSNVIYVDKENNKAKRDILKAILQKQEMPNRSLRFTVVSDPPEDEQDLECEDIGVAHVDLADMFQEGRDLIEQNIDVF 1234          
BLAST of NPHP8 vs. Ensembl Human
Match: RPGRIP1L (RPGRIP1 like [Source:HGNC Symbol;Acc:HGNC:29168])

HSP 1 Score: 537.339 bits (1383), Expect = 6.329e-168
Identity = 340/913 (37.24%), Postives = 531/913 (58.16%), Query Frame = 3
Query:  177 RKTISQWTKDYLEDKYLRLQDDHETLKKHARLQEXXXXXXXXXXXXXXSDAKKNGDIT--PKT--------DDFEEFRRKCSILESQNGLLKDKVKLLQSQLLAQGKKASVYDNVPSRIKSGAIERSNSIQNSGRKNNIR-VIKPRGELYPLSPRRDESVTGDQSLISLNKVVEDLK--YEVHRLQIEN----EELLKKAYRREDEKL----------SPEHYKSNLKDNLDMIRVTRDIKEKEIQVNVLHGKYEDLKTKQQYLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEPD--LEPLAPEI-LERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDI-NFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGN-----EMSVVEARRP-------IDS----MNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYMYQDNSFT 2774
            R+ +S+ +++ LED++LRL D++  LK+HAR QE KIK++ TKL+++ +D K+   +   PK         +  E+ + K   LE QN  LK+++   + QL  QG + + Y+NV SRI +G   R  + +N+G +   R  IK +      +P    +  G+  L      + +L+   +  R QIE      E+LK   RR++ ++               +SN++DN++MI++ + + EK   ++ + GK+  L+ KQ+ L  ++  +    + L  +L+       + E Q+ ++    +RI +L+   ND +KE  LLKE+ DKL + AF+   E  W+ KE   + +IAQLE  LK D+++K  +L++L++ERD+ +   +E   L+L+  E + Q++EL  ++K +++E  +N  E+ EAL++I+ ++     Q   +L F+ K+D   ++DL R + E +  HAET+QELEKTR++L  Q+KI+ DY+ E E ++++++ +++DYE ++ +Y  LLDIRAARIHKLEAQLKDIAYGT+  + +  + PD  ++     I LERGEN+ EIHI +V  + + ++   DK+P  F T+ FYDFE Q T V+RG   E++  ++YLV ++D FL Y+ KNT   E+HQA   EY T+AACQ+   +I EKS              +  C A L+G +    DI NFG +EYW RL+ PMDQ IR YRE+ KA GYI  N      M  +  + P        DS    +NEL I I  C  L+SR  HLQP PY+ YKF+D + H +  IPSSN P+F D    PV MN DL +YLK ++L  YV D+ D  E++Y+G   +PLI L H++ ISG FEL D+Q    GT+ V L W+ +Y+    S T
Sbjct:   39 RQAVSRVSREELEDRFLRLHDENILLKQHARKQEDKIKRMATKLIRLVNDKKRYERVGGGPKRLGRDVEMEEMIEQLQEKVHELEKQNETLKNRLISAKQQLQTQGYRQTPYNNVQSRINTG---RRKANENAGLQECPRKGIKFQDADVAETPHPMFTKYGNSLLEEARGEIRNLENVIQSQRGQIEELEHLAEILKTQLRRKENEIELSLLQLREQQATDQRSNIRDNVEMIKLHKQLVEKSNALSAMEGKFIQLQEKQRTLRISHDALMANGDELNMQLKEQRLKCCSLEKQLHSMKFSERRIEELQDRINDLEKERELLKENYDKLYDSAFSAAHEEQWKLKEQQLKVQIAQLETALKSDLTDKTEILDRLKTERDQNEKLVQENRELQLQYLEQKQQLDELKKRIKLYNQENDINADELSEALLLIKAQKE----QKNGDLSFLVKVDSEINKDLERSMRELQATHAETVQELEKTRNMLIMQHKINKDYQMEVEAVTRKMENLQQDYELKVEQYVHLLDIRAARIHKLEAQLKDIAYGTKQYKFKPEIMPDDSVDEFDETIHLERGENLFEIHINKVTFSSEVLQASGDKEPVTFCTYAFYDFELQTTPVVRGLHPEYNFTSQYLVHVNDLFLQYIQKNTITLEVHQAYSTEYETIAACQLKFHEILEKSG-------------RIFCTASLIGTK---GDIPNFGTVEYWFRLRVPMDQAIRLYRERAKALGYITSNFKGPEHMQSLSQQAPKTAQLSSTDSTDGNLNELHITIRCCNHLQSRASHLQPHPYVVYKFFDFADHDTAIIPSSNDPQFDDHMYFPVPMNMDLDRYLKSESLSFYVFDDSDTQENIYIGKVNVPLISLAHDRCISGIFELTDHQKHPAGTIHVILKWKFAYLPPSGSIT 928          

HSP 2 Score: 59.6918 bits (143), Expect = 4.163e-8
Identity = 42/139 (30.22%), Postives = 73/139 (52.52%), Query Frame = 3
Query: 3513 DEIVVEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTETISLQKPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATMLT--EEPNKYIVFTLVQEPTADSE-ADCEDIGTAKVNVKTLLKESRNLENERIPIY 3920
            ++I +EI ++ + DS  +  D+ I+ ++VE R   +  E T  +SL KP   Q +    YN+     V    N   R  +  +L   E PN+ + FT+V +P  D +  +CEDIG A V++  + +E R+L  + I ++
Sbjct: 1067 EKIRIEIIALSLNDS-QVTMDDTIQRLFVECRFYSLPAEET-PVSLPKPKSGQWVY---YNYSNVIYVDKENNKAKRDILKAILQKQEMPNRSLRFTVVSDPPEDEQDLECEDIGVAHVDLADMFQEGRDLIEQNIDVF 1200          
BLAST of NPHP8 vs. Ensembl Human
Match: RPGRIP1L (RPGRIP1 like [Source:HGNC Symbol;Acc:HGNC:29168])

HSP 1 Score: 538.11 bits (1385), Expect = 9.731e-168
Identity = 340/913 (37.24%), Postives = 531/913 (58.16%), Query Frame = 3
Query:  177 RKTISQWTKDYLEDKYLRLQDDHETLKKHARLQEXXXXXXXXXXXXXXSDAKKNGDIT--PKT--------DDFEEFRRKCSILESQNGLLKDKVKLLQSQLLAQGKKASVYDNVPSRIKSGAIERSNSIQNSGRKNNIR-VIKPRGELYPLSPRRDESVTGDQSLISLNKVVEDLK--YEVHRLQIEN----EELLKKAYRREDEKL----------SPEHYKSNLKDNLDMIRVTRDIKEKEIQVNVLHGKYEDLKTKQQYLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEPD--LEPLAPEI-LERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDI-NFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGN-----EMSVVEARRP-------IDS----MNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYMYQDNSFT 2774
            R+ +S+ +++ LED++LRL D++  LK+HAR QE KIK++ TKL+++ +D K+   +   PK         +  E+ + K   LE QN  LK+++   + QL  QG + + Y+NV SRI +G   R  + +N+G +   R  IK +      +P    +  G+  L      + +L+   +  R QIE      E+LK   RR++ ++               +SN++DN++MI++ + + EK   ++ + GK+  L+ KQ+ L  ++  +    + L  +L+       + E Q+ ++    +RI +L+   ND +KE  LLKE+ DKL + AF+   E  W+ KE   + +IAQLE  LK D+++K  +L++L++ERD+ +   +E   L+L+  E + Q++EL  ++K +++E  +N  E+ EAL++I+ ++     Q   +L F+ K+D   ++DL R + E +  HAET+QELEKTR++L  Q+KI+ DY+ E E ++++++ +++DYE ++ +Y  LLDIRAARIHKLEAQLKDIAYGT+  + +  + PD  ++     I LERGEN+ EIHI +V  + + ++   DK+P  F T+ FYDFE Q T V+RG   E++  ++YLV ++D FL Y+ KNT   E+HQA   EY T+AACQ+   +I EKS              +  C A L+G +    DI NFG +EYW RL+ PMDQ IR YRE+ KA GYI  N      M  +  + P        DS    +NEL I I  C  L+SR  HLQP PY+ YKF+D + H +  IPSSN P+F D    PV MN DL +YLK ++L  YV D+ D  E++Y+G   +PLI L H++ ISG FEL D+Q    GT+ V L W+ +Y+    S T
Sbjct:   39 RQAVSRVSREELEDRFLRLHDENILLKQHARKQEDKIKRMATKLIRLVNDKKRYERVGGGPKRLGRDVEMEEMIEQLQEKVHELEKQNETLKNRLISAKQQLQTQGYRQTPYNNVQSRINTG---RRKANENAGLQECPRKGIKFQDADVAETPHPMFTKYGNSLLEEARGEIRNLENVIQSQRGQIEELEHLAEILKTQLRRKENEIELSLLQLREQQATDQRSNIRDNVEMIKLHKQLVEKSNALSAMEGKFIQLQEKQRTLRISHDALMANGDELNMQLKEQRLKCCSLEKQLHSMKFSERRIEELQDRINDLEKERELLKENYDKLYDSAFSAAHEEQWKLKEQQLKVQIAQLETALKSDLTDKTEILDRLKTERDQNEKLVQENRELQLQYLEQKQQLDELKKRIKLYNQENDINADELSEALLLIKAQKE----QKNGDLSFLVKVDSEINKDLERSMRELQATHAETVQELEKTRNMLIMQHKINKDYQMEVEAVTRKMENLQQDYELKVEQYVHLLDIRAARIHKLEAQLKDIAYGTKQYKFKPEIMPDDSVDEFDETIHLERGENLFEIHINKVTFSSEVLQASGDKEPVTFCTYAFYDFELQTTPVVRGLHPEYNFTSQYLVHVNDLFLQYIQKNTITLEVHQAYSTEYETIAACQLKFHEILEKSG-------------RIFCTASLIGTK---GDIPNFGTVEYWFRLRVPMDQAIRLYRERAKALGYITSNFKGPEHMQSLSQQAPKTAQLSSTDSTDGNLNELHITIRCCNHLQSRASHLQPHPYVVYKFFDFADHDTAIIPSSNDPQFDDHMYFPVPMNMDLDRYLKSESLSFYVFDDSDTQENIYIGKVNVPLISLAHDRCISGIFELTDHQKHPAGTIHVILKWKFAYLPPSGSIT 928          

HSP 2 Score: 60.077 bits (144), Expect = 3.859e-8
Identity = 42/139 (30.22%), Postives = 73/139 (52.52%), Query Frame = 3
Query: 3513 DEIVVEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTETISLQKPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATMLT--EEPNKYIVFTLVQEPTADSE-ADCEDIGTAKVNVKTLLKESRNLENERIPIY 3920
            ++I +EI ++ + DS  +  D+ I+ ++VE R   +  E T  +SL KP   Q +    YN+     V    N   R  +  +L   E PN+ + FT+V +P  D +  +CEDIG A V++  + +E R+L  + I ++
Sbjct: 1113 EKIRIEIIALSLNDS-QVTMDDTIQRLFVECRFYSLPAEET-PVSLPKPKSGQWVY---YNYSNVIYVDKENNKAKRDILKAILQKQEMPNRSLRFTVVSDPPEDEQDLECEDIGVAHVDLADMFQEGRDLIEQNIDVF 1246          
BLAST of NPHP8 vs. Ensembl Human
Match: RPGRIP1L (RPGRIP1 like [Source:HGNC Symbol;Acc:HGNC:29168])

HSP 1 Score: 537.724 bits (1384), Expect = 2.464e-167
Identity = 340/913 (37.24%), Postives = 531/913 (58.16%), Query Frame = 3
Query:  177 RKTISQWTKDYLEDKYLRLQDDHETLKKHARLQEXXXXXXXXXXXXXXSDAKKNGDIT--PK--------TDDFEEFRRKCSILESQNGLLKDKVKLLQSQLLAQGKKASVYDNVPSRIKSGAIERSNSIQNSGRKNNIR-VIKPRGELYPLSPRRDESVTGDQSLISLNKVVEDLK--YEVHRLQIEN----EELLKKAYRREDEKL----------SPEHYKSNLKDNLDMIRVTRDIKEKEIQVNVLHGKYEDLKTKQQYLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEPD--LEPLAPEI-LERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDI-NFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGN-----EMSVVEARRP-------IDS----MNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYMYQDNSFT 2774
            R+ +S+ +++ LED++LRL D++  LK+HAR QE KIK++ TKL+++ +D K+   +   PK         +  E+ + K   LE QN  LK+++   + QL  QG + + Y+NV SRI +G   R  + +N+G +   R  IK +      +P    +  G+  L      + +L+   +  R QIE      E+LK   RR++ ++               +SN++DN++MI++ + + EK   ++ + GK+  L+ KQ+ L  ++  +    + L  +L+       + E Q+ ++    +RI +L+   ND +KE  LLKE+ DKL + AF+   E  W+ KE   + +IAQLE  LK D+++K  +L++L++ERD+ +   +E   L+L+  E + Q++EL  ++K +++E  +N  E+ EAL++I+ ++     Q   +L F+ K+D   ++DL R + E +  HAET+QELEKTR++L  Q+KI+ DY+ E E ++++++ +++DYE ++ +Y  LLDIRAARIHKLEAQLKDIAYGT+  + +  + PD  ++     I LERGEN+ EIHI +V  + + ++   DK+P  F T+ FYDFE Q T V+RG   E++  ++YLV ++D FL Y+ KNT   E+HQA   EY T+AACQ+   +I EKS              +  C A L+G +    DI NFG +EYW RL+ PMDQ IR YRE+ KA GYI  N      M  +  + P        DS    +NEL I I  C  L+SR  HLQP PY+ YKF+D + H +  IPSSN P+F D    PV MN DL +YLK ++L  YV D+ D  E++Y+G   +PLI L H++ ISG FEL D+Q    GT+ V L W+ +Y+    S T
Sbjct:   39 RQAVSRVSREELEDRFLRLHDENILLKQHARKQEDKIKRMATKLIRLVNDKKRYERVGGGPKRLGRDVEMEEMIEQLQEKVHELEKQNETLKNRLISAKQQLQTQGYRQTPYNNVQSRINTG---RRKANENAGLQECPRKGIKFQDADVAETPHPMFTKYGNSLLEEARGEIRNLENVIQSQRGQIEELEHLAEILKTQLRRKENEIELSLLQLREQQATDQRSNIRDNVEMIKLHKQLVEKSNALSAMEGKFIQLQEKQRTLRISHDALMANGDELNMQLKEQRLKCCSLEKQLHSMKFSERRIEELQDRINDLEKERELLKENYDKLYDSAFSAAHEEQWKLKEQQLKVQIAQLETALKSDLTDKTEILDRLKTERDQNEKLVQENRELQLQYLEQKQQLDELKKRIKLYNQENDINADELSEALLLIKAQKE----QKNGDLSFLVKVDSEINKDLERSMRELQATHAETVQELEKTRNMLIMQHKINKDYQMEVEAVTRKMENLQQDYELKVEQYVHLLDIRAARIHKLEAQLKDIAYGTKQYKFKPEIMPDDSVDEFDETIHLERGENLFEIHINKVTFSSEVLQASGDKEPVTFCTYAFYDFELQTTPVVRGLHPEYNFTSQYLVHVNDLFLQYIQKNTITLEVHQAYSTEYETIAACQLKFHEILEKSG-------------RIFCTASLIGTK---GDIPNFGTVEYWFRLRVPMDQAIRLYRERAKALGYITSNFKGPEHMQSLSQQAPKTAQLSSTDSTDGNLNELHITIRCCNHLQSRASHLQPHPYVVYKFFDFADHDTAIIPSSNDPQFDDHMYFPVPMNMDLDRYLKSESLSFYVFDDSDTQENIYIGKVNVPLISLAHDRCISGIFELTDHQKHPAGTIHVILKWKFAYLPPSGSIT 928          

HSP 2 Score: 59.6918 bits (143), Expect = 4.296e-8
Identity = 42/139 (30.22%), Postives = 73/139 (52.52%), Query Frame = 3
Query: 3513 DEIVVEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTETISLQKPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATMLT--EEPNKYIVFTLVQEPTADSE-ADCEDIGTAKVNVKTLLKESRNLENERIPIY 3920
            ++I +EI ++ + DS  +  D+ I+ ++VE R   +  E T  +SL KP   Q +    YN+     V    N   R  +  +L   E PN+ + FT+V +P  D +  +CEDIG A V++  + +E R+L  + I ++
Sbjct: 1147 EKIRIEIIALSLNDS-QVTMDDTIQRLFVECRFYSLPAEET-PVSLPKPKSGQWVY---YNYSNVIYVDKENNKAKRDILKAILQKQEMPNRSLRFTVVSDPPEDEQDLECEDIGVAHVDLADMFQEGRDLIEQNIDVF 1280          
BLAST of NPHP8 vs. Ensembl Zebrafish
Match: rpgrip1l (RPGRIP1 like [Source:ZFIN;Acc:ZDB-GENE-081104-81])

HSP 1 Score: 483.411 bits (1243), Expect = 6.167e-148
Identity = 324/924 (35.06%), Postives = 523/924 (56.60%), Query Frame = 3
Query:  141 NAVIPKMDLAQ---ERKTISQWTKDYLEDKYLRLQDDHETLKKHARLQEXXXXXXXXXXXXXXSDAKK--NGDITPKTDDFEEFRRKCSILESQNGLLKDKVKLLQSQLLAQGKKASVYDNVPSRIKSGA--IERSNSIQNSGR----KNNIRVIKPRGELYP---LSPRRDESVTGDQ--SLISLNKVVEDLKYEVHRLQIENEELLKKAYRREDEKL----------SPEHYKSNLKDNLDMIRVTRDIKEKEIQVNVLHGKY----EDLKTKQQY-------LERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEPD--LEPLAPEI-----LERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDIN-FGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGNEMSVVEARRPIDS--------MNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYM 2753
             A +P   L+Q   ER+ +S+ +++ LEDKYLRLQD++ TLK+H   QE KI+++ TKL+++  D K+   G      +  EE + K   LE QN  LK ++   + QL  Q ++ + Y ++ SRI +G   +  +++   + R    K  +R ++      P   L PR   S+  +    + +L  V+E  + ++  L+  + E+++   +R D +                +  +KDN++MI++ + + EK   + VL G++    E +KT +         +E  NR++ +E      RL+S        E QI +  +  + + +L+    D +KE  LLKE+ DKL   AF+  +E+ WR +E   + ++AQLE  LK D+++K  +L+K+++ERD  +N  +E   L+LR  E + Q+EE+ D++KFF+KE+ ++  E+ EALM+I+ +R    +Q + EL F++K++++   D+ R L E +  +AET+QELEKTR++L  Q+KI+ DY+ E E +++ +D++K +YE +  + A+LLD+RAA+I KLEAQLKDIAYGT+      +  PD   + +  E      L RGEN+LEIH+G+   + +AVE++KDKDP  F T+ FYDFE Q+T V+ G   ++   ++YLV++DD FLNYL+ N+   E+  A G  + T+AA Q+    +             + +G K     +LVG+   S +I  FG LEYW++LK  MDQ IR Y+E++KA G++  +         P  S        +NEL I I  C  LK +  H QPSPYI YK YD   H +  IP +  P+F D    P+ MNS+L  +L+ + L +YV D+LD +  +YLG A +PL  L H+K I+G FEL D     +G + V L W  +Y+
Sbjct:   19 GAALPDSLLSQNIRERQNVSKLSREELEDKYLRLQDENLTLKQHTCKQEDKIRRMATKLIRLVKDRKQRDGGRDVEMEEMMEELQEKVQELEKQNEGLKRRLLAAKQQLQVQSRRHTPYAHIQSRINTGLRRVPDTHTPVTTSRPHTPKAALRHVEGEMSAKPPQSLLPRYGHSLLDEARAEIRNLENVIESQQMQMEELE-RSAEMMRDQLKRRDREFEESLLQVREQQASGQRLTIKDNVEMIKLQKLLSEKANTLAVLEGRFLQQQESMKTLKASHDAALLKVEDGNRQLKEE------RLKSL-----QLETQITSRALEHRHLLELQERIQDLEKERDLLKENCDKLVKSAFDVSQEQKWRTREQQLKLQVAQLETALKSDLADKNQILDKIKAERDVNENLTQENKQLQLRYLEQKQQLEEIKDRMKFFTKESEIDAAELSEALMLIKVRR----SQKSGELGFLEKVEEDVKVDVERSLKELQATYAETVQELEKTRNMLIIQHKINKDYQAEVEAVNRMMDDLKLEYELKSEKLAQLLDMRAAKIRKLEAQLKDIAYGTKT----HVFRPDETSDDVTDEFEGTVQLARGENLLEIHLGKGQFSPEAVESLKDKDPSTFCTYAFYDFELQSTPVVHGERPDYSFSSQYLVRVDDLFLNYLHTNSITVEIQLAEGLNFRTVAAGQIRLNQL------------LERDG-KVFSTIQLVGV---SDEIQVFGSLEYWLKLKVSMDQAIRLYKERVKALGFLKTSLRDSKAFSVPAPSSSSLMNGDLNELSISIHSCCNLKPKGPHTQPSPYIVYKLYDFPDHDTPIIPCTTEPQFEDHMVFPMTMNSNLDAFLRSEALVVYVFDDLDVENQLYLGKARVPLDSLAHDKTITGLFELTDPAGLPSGQINVTLKWSFTYL 906          
BLAST of NPHP8 vs. Ensembl Zebrafish
Match: rpgrip1l (RPGRIP1 like [Source:ZFIN;Acc:ZDB-GENE-081104-81])

HSP 1 Score: 483.411 bits (1243), Expect = 6.167e-148
Identity = 324/924 (35.06%), Postives = 523/924 (56.60%), Query Frame = 3
Query:  141 NAVIPKMDLAQ---ERKTISQWTKDYLEDKYLRLQDDHETLKKHARLQEXXXXXXXXXXXXXXSDAKK--NGDITPKTDDFEEFRRKCSILESQNGLLKDKVKLLQSQLLAQGKKASVYDNVPSRIKSGA--IERSNSIQNSGR----KNNIRVIKPRGELYP---LSPRRDESVTGDQ--SLISLNKVVEDLKYEVHRLQIENEELLKKAYRREDEKL----------SPEHYKSNLKDNLDMIRVTRDIKEKEIQVNVLHGKY----EDLKTKQQY-------LERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEPD--LEPLAPEI-----LERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDIN-FGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGNEMSVVEARRPIDS--------MNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYM 2753
             A +P   L+Q   ER+ +S+ +++ LEDKYLRLQD++ TLK+H   QE KI+++ TKL+++  D K+   G      +  EE + K   LE QN  LK ++   + QL  Q ++ + Y ++ SRI +G   +  +++   + R    K  +R ++      P   L PR   S+  +    + +L  V+E  + ++  L+  + E+++   +R D +                +  +KDN++MI++ + + EK   + VL G++    E +KT +         +E  NR++ +E      RL+S        E QI +  +  + + +L+    D +KE  LLKE+ DKL   AF+  +E+ WR +E   + ++AQLE  LK D+++K  +L+K+++ERD  +N  +E   L+LR  E + Q+EE+ D++KFF+KE+ ++  E+ EALM+I+ +R    +Q + EL F++K++++   D+ R L E +  +AET+QELEKTR++L  Q+KI+ DY+ E E +++ +D++K +YE +  + A+LLD+RAA+I KLEAQLKDIAYGT+      +  PD   + +  E      L RGEN+LEIH+G+   + +AVE++KDKDP  F T+ FYDFE Q+T V+ G   ++   ++YLV++DD FLNYL+ N+   E+  A G  + T+AA Q+    +             + +G K     +LVG+   S +I  FG LEYW++LK  MDQ IR Y+E++KA G++  +         P  S        +NEL I I  C  LK +  H QPSPYI YK YD   H +  IP +  P+F D    P+ MNS+L  +L+ + L +YV D+LD +  +YLG A +PL  L H+K I+G FEL D     +G + V L W  +Y+
Sbjct:   19 GAALPDSLLSQNIRERQNVSKLSREELEDKYLRLQDENLTLKQHTCKQEDKIRRMATKLIRLVKDRKQRDGGRDVEMEEMMEELQEKVQELEKQNEGLKRRLLAAKQQLQVQSRRHTPYAHIQSRINTGLRRVPDTHTPVTTSRPHTPKAALRHVEGEMSAKPPQSLLPRYGHSLLDEARAEIRNLENVIESQQMQMEELE-RSAEMMRDQLKRRDREFEESLLQVREQQASGQRLTIKDNVEMIKLQKLLSEKANTLAVLEGRFLQQQESMKTLKASHDAALLKVEDGNRQLKEE------RLKSL-----QLETQITSRALEHRHLLELQERIQDLEKERDLLKENCDKLVKSAFDVSQEQKWRTREQQLKLQVAQLETALKSDLADKNQILDKIKAERDVNENLTQENKQLQLRYLEQKQQLEEIKDRMKFFTKESEIDAAELSEALMLIKVRR----SQKSGELGFLEKVEEDVKVDVERSLKELQATYAETVQELEKTRNMLIIQHKINKDYQAEVEAVNRMMDDLKLEYELKSEKLAQLLDMRAAKIRKLEAQLKDIAYGTKT----HVFRPDETSDDVTDEFEGTVQLARGENLLEIHLGKGQFSPEAVESLKDKDPSTFCTYAFYDFELQSTPVVHGERPDYSFSSQYLVRVDDLFLNYLHTNSITVEIQLAEGLNFRTVAAGQIRLNQL------------LERDG-KVFSTIQLVGV---SDEIQVFGSLEYWLKLKVSMDQAIRLYKERVKALGFLKTSLRDSKAFSVPAPSSSSLMNGDLNELSISIHSCCNLKPKGPHTQPSPYIVYKLYDFPDHDTPIIPCTTEPQFEDHMVFPMTMNSNLDAFLRSEALVVYVFDDLDVENQLYLGKARVPLDSLAHDKTITGLFELTDPAGLPSGQINVTLKWSFTYL 906          
BLAST of NPHP8 vs. Ensembl Zebrafish
Match: rpgrip1 (RPGR interacting protein 1 [Source:ZFIN;Acc:ZDB-GENE-091204-394])

HSP 1 Score: 209.149 bits (531), Expect = 3.909e-54
Identity = 232/933 (24.87%), Postives = 420/933 (45.02%), Query Frame = 3
Query:  153 PKMDLAQERKTISQWTKDYLEDKYLRLQDDHETLKKHARLQEXXXXXXXXXXXXXXSDAKKNGDITPKTDDFEEFRRKCSILESQNGLLKDKVKLLQSQLLAQGKKASVYDNVPSRIKSGAIERSNSIQNSGRKNNIRVIKPRGELYPLSPRRDESVTGDQSLISLNKVVEDLKYEVHRLQIENEELLKKAYRREDE---------KLSPEHYKSNLKDNLDMIRVTRDIKEKEIQVNVLHGKYEDLKTK--------QQYLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTV-------LRKRINDLEATNNDFKKEIYLLKESNDKLTN---DAFNTERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKE-------MSNLRLRNYELQAQIEE-------LSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILE------------PDLEPLAPEILERGENILEIHIGRVCLTQ-----QAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGA-EYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDINFGVLEYWIRLKHPMDQVIRQYREKLKAEG---YIMGNEMSVVEARRPIDSM----NELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDES-VYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSY 2750
            P++   ++R+ + +  ++ LED+  RLQ+++  LK+H+R QE K+++L TKLL++   +  +G      D  EE   + + LESQ G L+ K+ L +  +L  G +  +       +      R  +     R     +   RGE+  L            +L+S + V+E  +  V  L++  + L +    +E E         K   + ++  +KDN+D+IR+ + + EK   + V+  K+  L+          Q+ L+ +   +  ++E L+ +L+         EGQ+   T        L++R+ DLE   N  KK    L ES   + N   D    + ER    +E  +R ++ +L+  L+   SE+  +  + E  R  +D  +KE       +  LR ++  L+ ++ +       L +KL   +KE  ++ +++ E L+ I+  R     Q    + F+ K D  K +D +R L   + ++AET+ EL+KTR LL  Q++++ D + E   + ++ +  +++   R  E  +LL  R  +I  L+AQLK++AY  RN +    L+            P +E      L  GE++LE+H+     T       A +  + +    F T+ F DFE  +T ++ G    +   ++Y +   D     +       ELHQA G  +++T    ++S  +              +  G +   R  L+G+         G+LE+W+ L HP  +      E++ +     +  G+E +  E     D      NEL + + RC GL +R   L P  Y+ Y+ YD   H++  I     P F D    P+ + +D+ +YL + +L +YV D+ D   S  YL    IPL  L   + I G + L D   +  G + V L W++ +
Sbjct:   41 PQVLKIKDRQRLFRVPREQLEDQCHRLQEENTLLKQHSRTQEQKLRRLSTKLLRLKHGSSASGRDGELEDTIEELEARVATLESQKGALQSKLNLAKQHILDLGVRTHIRPRTGRGVDGDGGVRRAAQTAPARCGISSLDDTRGEMDRLL-----------ALLSRSTVIESQQGRVAELELTAQSLRETLRDKEREIEGIVKDLRKQQVDGHRLIIKDNVDVIRLQKQLSEKSAALLVIQEKFGGLQEAYENQLEEGQKSLKESQEALLGKVEELSEQLKQEKQRVLTLEGQLSAATFSLQALGELQERVLDLEGERNLLKKSYDSLLESTMSIQNHQGDKHEEKEERKEELREEGWREELQRLKERLEEARSERKTLEQEKEQMRHEIDQVKKEKERDKDMVMFLREKHDCLEREVLQHRQEVTLLQEKLDSVTKEFDMSVEDLSETLLQIKAFRMQQETQGV--MRFL-KTDV-KFEDTSRDLTAVQASYAETVLELQKTRDLLLLQHRLNADLQNEMTTVLEKSESEREENRRRAEEKDKLLKSRGLQISNLQAQLKELAYSPRNNKRAIPLQYTWTGLEQDSVRPTVESAIITHLHGGESLLEVHLTGATFTPLGLRLMAQDTGEHQGVATFCTYGFLDFEVLSTSLMSGGQPNYGFTSQYALSAFDLEKLMVQGGFIAVELHQALGGVKFLTRGRARISLME------------ALQRRGERVKNRTNLIGVDGEV----IGILEFWVCL-HPQVERTEPQMERVTSRTPVRHTRGSEWAHGEPEEMYDFGVGIPNELEVVLERCVGLSTRWPGLLPDAYLTYRLYDLPPHSTPIIQCCVDPVFEDSASYPLAVTTDVLEYLNVGSLWVYVFDDGDSQTSHTYLAKTPIPLRSLAAGRPIRGDYVLRDPAGSPRGMVRVSLRWKYPF 941          

HSP 2 Score: 83.9593 bits (206), Expect = 1.052e-15
Identity = 52/148 (35.14%), Postives = 88/148 (59.46%), Query Frame = 3
Query: 3489 PIKPELNPDEIVVEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTET-ISLQKPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATML-TEEPNK-YIVFTLVQEPTADSEADCEDIGTAKVNVKTLLKESRNLENERIPIYS 3923
            P KP+   D + VEI S+    S+ +  D ++  +YVEYRL G+ +E+TET +SL+KP+  +EI   +YNF +   V       +R ++ TML   +PN+  + FT+V EP  + E +CED+G A ++++ LL    ++  ++I + S
Sbjct: 1128 PPKPQKKGDRLRVEILSLSFNPSSSIALDQSVHQVYVEYRLLGVPMETTETPMSLRKPTDGEEI---HYNFTRVIHVDSVGAAPLRHYLYTMLEGTDPNQGRLKFTVVSEPMKEQE-ECEDVGYAYLDLRELLLTGNDVIEKQINVVS 1271          
BLAST of NPHP8 vs. Ensembl Zebrafish
Match: rpgrip1 (RPGR interacting protein 1 [Source:ZFIN;Acc:ZDB-GENE-091204-394])

HSP 1 Score: 171.014 bits (432), Expect = 1.646e-42
Identity = 172/682 (25.22%), Postives = 310/682 (45.45%), Query Frame = 3
Query:  834 VNVLHGKYEDLKTKQQYLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTN---DAFNTERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKE-------MSNLRLRNYELQAQIEE-------LSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILE------------PDLEPLAPEILERGENILEIHIGRVCLTQ-----QAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGA-EYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDINFGVLEYWIRLKHPMDQVIRQYREKLKAEG---YIMGNEMSVVEARRPIDSM----NELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDES-VYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSY 2750
            +N+  G+ + LK  Q+ L     E+S+++++   R+ + +     A   ++ +  L++R+ DLE   N  KK    L ES   + N   D    + ER    +E  +R ++ +L+  L+   SE+  +  + E  R  +D  +KE       +  LR ++  L+ ++ +       L +KL   +KE  ++ +++ E L+ I+  R     Q    + F+ K D  K +D +R L   + ++AET+ EL+KTR LL  Q++++ D + E   + ++ +  +++   R  E  +LL  R  +I  L+AQLK++AY  RN +    L+            P +E      L  GE++LE+H+     T       A +  + +    F T+ F DFE  +T ++ G    +   ++Y +   D     +       ELHQA G  +++T    ++S  +              +  G +   R  L+G+         G+LE+W+ L HP  +      E++ +     +  G+E +  E     D      NEL + + RC GL +R   L P  Y+ Y+ YD   H++  I     P F D    P+ + +D+ +YL + +L +YV D+ D   S  YL    IPL  L   + I G + L D   +  G + V L W++ +
Sbjct:   19 LNIPKGQ-KSLKESQEALLGKVEELSEQLKQEKQRVLTLEGQLSAATFSLQALGELQERVLDLEGERNLLKKSYDSLLESTMSIQNHQGDKHEEKEERKEELREEGWREELQRLKERLEEARSERKTLEQEKEQMRHEIDQVKKEKERDKDMVMFLREKHDCLEREVLQHRQEVTLLQEKLDSVTKEFDMSVEDLSETLLQIKAFRMQQETQGV--MRFL-KTDV-KFEDTSRDLTAVQASYAETVLELQKTRDLLLLQHRLNADLQNEMTTVLEKSESEREENRRRAEEKDKLLKSRGLQISNLQAQLKELAYSPRNNKRAIPLQYTWTGLEQDSVRPTVESAIITHLHGGESLLEVHLTGATFTPLGLRLMAQDTGEHQGVATFCTYGFLDFEVLSTSLMSGGQPNYGFTSQYALSAFDLEKLMVQGGFIAVELHQALGGVKFLTRGRARISLME------------ALQRRGERVKNRTNLIGVDGEV----IGILEFWVCL-HPQVERTEPQMERVTSRTPVRHTRGSEWAHGEPEEMYDFGVGIPNELEVVLERCVGLSTRWPGLLPDAYLTYRLYDLPPHSTPIIQCCVDPVFEDSASYPLAVTTDVLEYLNVGSLWVYVFDDGDSQTSHTYLAKTPIPLRSLAAGRPIRGDYVLRDPAGSPRGMVRVSLRWKYPF 678          

HSP 2 Score: 83.1889 bits (204), Expect = 1.782e-15
Identity = 52/148 (35.14%), Postives = 88/148 (59.46%), Query Frame = 3
Query: 3489 PIKPELNPDEIVVEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTET-ISLQKPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATML-TEEPNK-YIVFTLVQEPTADSEADCEDIGTAKVNVKTLLKESRNLENERIPIYS 3923
            P KP+   D + VEI S+    S+ +  D ++  +YVEYRL G+ +E+TET +SL+KP+  +EI   +YNF +   V       +R ++ TML   +PN+  + FT+V EP  + E +CED+G A ++++ LL    ++  ++I + S
Sbjct:  867 PPKPQKKGDRLRVEILSLSFNPSSSIALDQSVHQVYVEYRLLGVPMETTETPMSLRKPTDGEEI---HYNFTRVIHVDSVGAAPLRHYLYTMLEGTDPNQGRLKFTVVSEPMKEQE-ECEDVGYAYLDLRELLLTGNDVIEKQINVVS 1010          
BLAST of NPHP8 vs. Ensembl Zebrafish
Match: rpgrip1 (RPGR interacting protein 1 [Source:ZFIN;Acc:ZDB-GENE-091204-394])

HSP 1 Score: 166.007 bits (419), Expect = 6.549e-41
Identity = 163/631 (25.83%), Postives = 285/631 (45.17%), Query Frame = 3
Query:  987 NVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTN---DAFNTERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKE-------MSNLRLRNYELQAQIEE-------LSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILE------------PDLEPLAPEILERGENILEIHIGRVCLTQ-----QAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGA-EYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDINFGVLEYWIRLKHPMDQVIRQYREKLKAEG---YIMGNEMSVVEARRPIDSM----NELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDES-VYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSY 2750
            +V  L++R+ DLE   N  KK    L ES   + N   D    + ER    +E  +R ++ +L+  L+   SE+  +  + E  R  +D  +KE       +  LR ++  L+ ++ +       L +KL   +KE  ++ +++ E L+ I+  R     Q    + F+ K D  K +D +R L   + ++AET+ EL+KTR LL  Q++++ D + E   + ++ +  +++   R  E  +LL  R  +I  L+AQLK++AY  RN +    L+            P +E      L  GE++LE+H+     T       A +  + +    F T+ F DFE  +T ++ G    +   ++Y +   D     +       ELHQA G  +++T    ++S  +              +  G +   R  L+G+         G+LE+W+ L HP  +      E++ +     +  G+E +  E     D      NEL + + RC GL +R   L P  Y+ Y+ YD   H++  I     P F D    P+ + +D+ +YL + +L +YV D+ D   S  YL    IPL  L   + I G + L D   +  G + V L W++ +
Sbjct:   96 SVLQLQERVLDLEGERNLLKKSYDSLLESTMSIQNHQGDKHEEKEERKEELREEGWREELQRLKERLEEARSERKTLEQEKEQMRHEIDQVKKEKERDKDMVMFLREKHDCLEREVLQHRQEVTLLQEKLDSVTKEFDMSVEDLSETLLQIKAFRMQQETQGV--MRFL-KTDV-KFEDTSRDLTAVQASYAETVLELQKTRDLLLLQHRLNADLQNEMTTVLEKSESEREENRRRAEEKDKLLKSRGLQISNLQAQLKELAYSPRNNKRAIPLQYTWTGLEQDSVRPTVESAIITHLHGGESLLEVHLTGATFTPLGLRLMAQDTGEHQGVATFCTYGFLDFEVLSTSLMSGGQPNYGFTSQYALSAFDLEKLMVQGGFIAVELHQALGGVKFLTRGRARISLME------------ALQRRGERVKNRTNLIGVDGEV----IGILEFWVCL-HPQVERTEPQMERVTSRTPVRHTRGSEWAHGEPEEMYDFGVGIPNELEVVLERCVGLSTRWPGLLPDAYLTYRLYDLPPHSTPIIQCCVDPVFEDSASYPLAVTTDVLEYLNVGSLWVYVFDDGDSQTSHTYLAKTPIPLRSLAAGRPIRGDYVLRDPAGSPRGMVRVSLRWKYPF 705          

HSP 2 Score: 82.8037 bits (203), Expect = 2.210e-15
Identity = 52/148 (35.14%), Postives = 88/148 (59.46%), Query Frame = 3
Query: 3489 PIKPELNPDEIVVEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTET-ISLQKPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATML-TEEPNK-YIVFTLVQEPTADSEADCEDIGTAKVNVKTLLKESRNLENERIPIYS 3923
            P KP+   D + VEI S+    S+ +  D ++  +YVEYRL G+ +E+TET +SL+KP+  +EI   +YNF +   V       +R ++ TML   +PN+  + FT+V EP  + E +CED+G A ++++ LL    ++  ++I + S
Sbjct:  894 PPKPQKKGDRLRVEILSLSFNPSSSIALDQSVHQVYVEYRLLGVPMETTETPMSLRKPTDGEEI---HYNFTRVIHVDSVGAAPLRHYLYTMLEGTDPNQGRLKFTVVSEPMKEQE-ECEDVGYAYLDLRELLLTGNDVIEKQINVVS 1037          
BLAST of NPHP8 vs. Ensembl Xenopus
Match: RPGRIP1L (RPGRIP1-like [Source:NCBI gene;Acc:100271765])

HSP 1 Score: 441.039 bits (1133), Expect = 6.140e-134
Identity = 305/900 (33.89%), Postives = 505/900 (56.11%), Query Frame = 3
Query:  168 AQERKTISQWTKDYLEDKYLRLQDDHETLKKHARLQEXXXXXXXXXXXXXXSDAKK--NGDITPKTDD--------FEEFRRKCSILESQNGLLKDKVKLLQSQLLAQGKKASVYDNVPSRIKSGAIERSNSI--QNSGRKNNIRVIKPRGELYPLSPRRDESVTGDQ--SLISLNKVVEDLKYEV----HRLQIENEELLKKAYRREDEKLS-----PEHYKSNLKDNLDMIRVTRDIKEKEIQVNVLHGKYEDLKTKQQYLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEPD--LEPLAPEI-LERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDINFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIM-------GNEMSVVEARRPI-----DSMNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYM 2753
             +ER+ +S+ +++ LED+YLR+ D++  LK+HAR QE KIK++ TKL+++  D KK   G  T +            E+ + +   LE Q   L+ ++   + QL  QG + S Y+ V SR+ SG  + +  +    S RK     +        + PR   S+  D    + +L  VVE  +  +    H   I   EL  K    E+  L          ++ +K+N+ MI++ + + +K      + G+++ L   QQ ++ +      +++ L ++L+     + N E ++++ T+ ++R  +L    +D +KE  LLKE+ DK+ +   + E++R  RE+++    +IAQLE  LK D+S+K  +L+K+  E+++ +  ++E   LRL+  E + Q+EE   + +FF+KE  ++  E+ EAL++I+ K   +    + E DF +  +K+     T++LL    NHAET+QELEKTR++L TQ+KI+ DY+ E E I+++++ I+ DYE +L +YA  LD+RAARI KLEAQLKDIAYGT+  ++ T +  D  ++     + LE GEN+LEIHI ++  +  A+E   D++P  F T+ FYDFE Q T V+RG    +D  ++Y +++DD FL Y+ K+T   E+H A G +Y T+A CQ+   +I EKS              +    + LVG++ +++  ++G ++YW RL  PM+Q IR Y+E+ KA G+I        GN  S++     +     D++N+L I I  C  LKSR    +PS Y+ Y F+  + H +  I +S+SP+F D    PV M+S L QYLK + L  +V D+ D     Y+G A +PL+ L  ++ ISG+FEL D    S GT++V L W  +Y+
Sbjct:   10 VKERQALSRISREELEDRYLRIHDENLLLKQHARKQEEKIKRMATKLIRLVQDRKKAEQGSGTSRRSGRDVELEEIIEQLQERVRELEKQKESLQHRLIAAKQQLQTQGHRHSPYNYVQSRVNSGLRKVAEGVLMHESIRKGMFFFLWGSISTQVILPRYGHSLLEDARAEIRNLENVVEAQRSRIEELEHSTDILRHELQSKEKEYEESFLQFREQQATEKRTTIKENVVMIKLQKQLADKTHAFTEMDGRFQQL---QQSMKTSQEAFLSQVDDLNNQLKEERLKSFNLEKRLQSSTLSQRRTEELLDRISDLEKERDLLKENYDKIYS---SQEQQRKLREQQL--MLQIAQLETALKSDLSDKNEMLDKIRQEKEQNEKLDEENRKLRLQVLEQKQQLEEFHSRFRFFTKENDVDMAELSEALLLIKQKNKNLMFLGSIEDDFSKASEKS-----TKELL---ANHAETVQELEKTRNMLITQHKINKDYQTEVEVITKKVESIQHDYEIKLEQYAHALDVRAARIRKLEAQLKDIAYGTKQYKLTTDITQDDEVDEFDETVHLEWGENMLEIHISKIAFSPTAIETFGDQEPATFCTYAFYDFELQTTPVVRGLRPVYDFTSQYRIRVDDLFLQYIQKSTASLEVHIALGTDYKTVALCQLRFHEILEKSG-------------RIFSASMLVGVQGDTE--SYGTVDYWFRLCVPMEQAIRLYQERAKALGFITSNVREPKGNNQSIIITEPHLYTSADDNLNKLYITIKSCSNLKSRSSPQEPSAYVGYTFFSFADHFTSIIQNSDSPQFEDCMCFPVPMSSSLDQYLKSEVLVFFVFDDNDSINK-YIGKAQVPLLSLAQDRCISGTFELTDKNGHSTGTIKVTLKWNATYL 877          

HSP 2 Score: 60.077 bits (144), Expect = 3.482e-8
Identity = 40/142 (28.17%), Postives = 73/142 (51.41%), Query Frame = 3
Query: 3489 PIKPELNPDEIVVEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTETISLQKPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATMLTEEPNKYIVFTLVQEPTADSE-ADCEDIGTAKVNVKTLLKESRNLENERI 3911
             +   L  ++I +EI S+ +  ++D+  ++ I+ ++VEYR   I  E T  +SLQKP+   +I    YN+     V    N   R  + +        ++ FT+V +P  D +  DC+DIG A +N+  +L+  +++ N  I
Sbjct:  936 AVNESLQFEKIRIEIISLSLNSTSDVAQNDTIQKLFVEYRFCNIVTEET-PVSLQKPASGLQI---YYNYSNVIHVDKENNQANRDLLRS--------FVKFTVVSDPPEDEQDLDCDDIGFASINLSEILQSGKDVINRSI 1065          
BLAST of NPHP8 vs. Ensembl Xenopus
Match: RPGRIP1L (RPGRIP1-like [Source:NCBI gene;Acc:100271765])

HSP 1 Score: 445.277 bits (1144), Expect = 9.943e-134
Identity = 302/908 (33.26%), Postives = 514/908 (56.61%), Query Frame = 3
Query:  168 AQERKTISQWTKDYLEDKYLRLQDDHETLKKHARLQEXXXXXXXXXXXXXXSDAKK--NGDITPKTDD--------FEEFRRKCSILESQNGLLKDKVKLLQSQLLAQGKKASVYDNVPSRIKSG------------AIERSNSIQN-SGRKNNIRVIKPRGELYPLSPRRDESVTGDQSLISLNKVVEDLKYEV----HRLQIENEELLKKAYRREDEKLSPEHYKSNLKDNLDMIRVTRDIKEKEIQVNVLHGKYEDLKTKQQYLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNT----ERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEPD--LEPLAPEI-LERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDINFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIM-------GNEMSVVEARRPI-----DSMNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYM 2753
             +ER+ +S+ +++ LED+YLR+ D++  LK+HAR QE KIK++ TKL+++  D KK   G  T +            E+ + +   LE Q   L+ ++   + QL  QG + S Y+ V SR+ SG            +I +   IQ+      + +VI PR     L   R E    +  + +    +E+L++      H LQ + +E  ++++ +  E+ + E  ++ +K+N+ MI++ + + +K      + G+++ L+   + ++ +      +++ L ++L+     + N E ++++ T+ ++R  +L    +D +KE  LLKE+ DK+ + AF+     E++R  RE+++    +IAQLE  LK D+S+K  +L+K+  E+++ +  ++E   LRL+  E + Q+EE   + +FF+KE  ++  E+ EAL++I+ +    + Q    L F+  I+ +  +   +   E   NHAET+QELEKTR++L TQ+KI+ DY+ E E I+++++ I+ DYE +L +YA  LD+RAARI KLEAQLKDIAYGT+  ++ T +  D  ++     + LE GEN+LEIHI ++  +  A+E   D++P  F T+ FYDFE Q T V+RG    +D  ++Y +++DD FL Y+ K+T   E+H A G +Y T+A CQ+   +I EKS              +    + LVG++ +++  ++G ++YW RL  PM+Q IR Y+E+ KA G+I        GN  S++     +     D++N+L I I  C  LKSR    +PS Y+ Y F+  + H +  I +S+SP+F D    PV M+S L QYLK + L  +V D+ D     Y+G A +PL+ L  ++ ISG+FEL D    S GT++V L W  +Y+
Sbjct:   36 VKERQALSRISREELEDRYLRIHDENLLLKQHARKQEEKIKRMATKLIRLVQDRKKAEQGSGTSRRSGRDVELEEIIEQLQERVRELEKQKESLQHRLIAAKQQLQTQGHRHSPYNYVQSRVNSGLRKVAEGVLMHESIRKGMQIQDPEMTSKSTQVILPRYGHSLLEDARAEIRNLENVVEAQRSRIEELEHSTDILRHELQSKEKEY-EESFLQFREQQATEK-RTTIKENVVMIKLQKQLADKTHAFTEMDGRFQQLQQDLKSMKTSQEAFLSQVDDLNNQLKEERLKSFNLEKRLQSSTLSQRRTEELLDRISDLEKERDLLKENYDKIYSSAFDVNNSQEQQRKLREQQL--MLQIAQLETALKSDLSDKNEMLDKIRQEKEQNEKLDEENRKLRLQVLEQKQQLEEFHSRFRFFTKENDVDMAELSEALLLIKTR----NQQKNKNLMFLGSIEDDFSKASEKSTKELLANHAETVQELEKTRNMLITQHKINKDYQTEVEVITKKVESIQHDYEIKLEQYAHALDVRAARIRKLEAQLKDIAYGTKQYKLTTDITQDDEVDEFDETVHLEWGENMLEIHISKIAFSPTAIETFGDQEPATFCTYAFYDFELQTTPVVRGLRPVYDFTSQYRIRVDDLFLQYIQKSTASLEVHIALGTDYKTVALCQLRFHEILEKSG-------------RIFSASMLVGVQGDTE--SYGTVDYWFRLCVPMEQAIRLYQERAKALGFITSNVREPKGNNQSIIITEPHLYTSADDNLNKLYITIKSCSNLKSRSSPQEPSAYVGYTFFSFADHFTSIIQNSDSPQFEDCMCFPVPMSSSLDQYLKSEVLVFFVFDDNDSINK-YIGKAQVPLLSLAQDRCISGTFELTDKNGHSTGTIKVTLKWNATYL 919          

HSP 2 Score: 73.9442 bits (180), Expect = 2.122e-12
Identity = 47/150 (31.33%), Postives = 83/150 (55.33%), Query Frame = 3
Query: 3489 PIKPELNP--DEIVVEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTETISLQKPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATMLTE--EPNKYIVFTLVQEPTADSE-ADCEDIGTAKVNVKTLLKESRNLENERIPIYS 3923
            P++ +L P  ++I +EI S+ +  ++D+  ++ I+ ++VEYR   I  E T  +SLQKP+   +I    YN+     V    N   R  + ++L +    N  + FT+V +P  D +  DC+DIG A +N+  +L+  +++ N  I IYS
Sbjct: 1094 PVRKDLKPQFEKIRIEIISLSLNSTSDVAQNDTIQKLFVEYRFCNIVTEET-PVSLQKPASGLQIY---YNYSNVIHVDKENNQANRDLLRSLLNDPNTSNGSVKFTVVSDPPEDEQDLDCDDIGFASINLSEILQSGKDVINRSIEIYS 1239          
BLAST of NPHP8 vs. Ensembl Xenopus
Match: RPGRIP1L (RPGRIP1-like [Source:NCBI gene;Acc:100271765])

HSP 1 Score: 436.032 bits (1120), Expect = 3.581e-132
Identity = 303/897 (33.78%), Postives = 501/897 (55.85%), Query Frame = 3
Query:  168 AQERKTISQWTKDYLEDKYLRLQDDHETLKKHARLQEXXXXXXXXXXXXXXSDAKK--NGDITPKTDD--------FEEFRRKCSILESQNGLLKDKVKLLQSQLLAQGKKASVYDNVPSRIKSGAIERSNSI--QNSGRKNNIRVIKPRGELYPLSPRRDESVTGDQ--SLISLNKVVEDLKYEV----HRLQIENEELLKKAYRREDEKLS-----PEHYKSNLKDNLDMIRVTRDIKEKEIQVNVLHGKYEDLKTKQQYLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEPD--LEPLAPEI-LERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDINFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIM-------GNEMSVVEARRPI--DSMNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYM 2753
             +ER+ +S+ +++ LED+YLR+ D++  LK+HAR QE KIK++ TKL+++  D KK   G  T +            E+ + +   LE Q   L+ ++   + QL  QG + S Y+ V SR+ SG  + +  +    S RK     +        + PR   S+  D    + +L  VVE  +  +    H   I   EL  K    E+  L          ++ +K+N+ MI++ + + +K      + G+++ L+   Q           +++ L ++L+     + N E ++++ T+ ++R  +L    +D +KE  LLKE+ DK+ +   + E++R  RE+++    +IAQLE  LK D+S+K  +L+K+  E+++ +  ++E   LRL+  E + Q+EE   + +FF+KE  ++  E+ EAL++I+ K   +    + E DF +  +K+     T++LL    NHAET+QELEKTR++L TQ+KI+ DY+ E E I+++++ I+ DYE +L +YA  LD+RAARI KLEAQLKDIAYGT+  ++ T +  D  ++     + LE GEN+LEIHI ++  +  A+E   D++P  F T+ FYDFE Q T V+RG    +D  ++Y +++DD FL Y+ K+T   E+H A G +Y T+A CQ+   +I EKS              +    + LVG++ +++  ++G ++YW RL  PM+Q IR Y+E+ KA G+I        GN  + +     +  D++N+L I I  C  LKSR    +PS Y+ Y F+  + H +  I +S+SP+F D    PV M+S L QYLK + L  +V D+ D     Y+G A +PL+ L  ++ ISG+FEL D    S GT++V L W  +Y+
Sbjct:    9 VKERQALSRISREELEDRYLRIHDENLLLKQHARKQEEKIKRMATKLIRLVQDRKKAEQGSGTSRRSGRDVELEEIIEQLQERVRELEKQKESLQHRLIAAKQQLQTQGHRHSPYNYVQSRVNSGLRKVAEGVLMHESIRKGMFFFLWGSISTQVILPRYGHSLLEDARAEIRNLENVVEAQRSRIEELEHSTDILRHELQSKEKEYEESFLQFREQQATEKRTTIKENVVMIKLQKQLADKTHAFTEMDGRFQQLQQTSQ------EAFLSQVDDLNNQLKEERLKSFNLEKRLQSSTLSQRRTEELLDRISDLEKERDLLKENYDKIYS---SQEQQRKLREQQL--MLQIAQLETALKSDLSDKNEMLDKIRQEKEQNEKLDEENRKLRLQVLEQKQQLEEFHSRFRFFTKENDVDMAELSEALLLIKQKNKNLMFLGSIEDDFSKASEKS-----TKELL---ANHAETVQELEKTRNMLITQHKINKDYQTEVEVITKKVESIQHDYEIKLEQYAHALDVRAARIRKLEAQLKDIAYGTKQYKLTTDITQDDEVDEFDETVHLEWGENMLEIHISKIAFSPTAIETFGDQEPATFCTYAFYDFELQTTPVVRGLRPVYDFTSQYRIRVDDLFLQYIQKSTASLEVHIALGTDYKTVALCQLRFHEILEKSG-------------RIFSASMLVGVQGDTE--SYGTVDYWFRLCVPMEQAIRLYQERAKALGFITSNVREPKGNNQAQIFTTIGLSDDNLNKLYITIKSCSNLKSRSSPQEPSAYVGYTFFSFADHFTSIIQNSDSPQFEDCMCFPVPMSSSLDQYLKSEVLVFFVFDDNDSINK-YIGKAQVPLLSLAQDRCISGTFELTDKNGHSTGTIKVTLKWNATYL 870          

HSP 2 Score: 62.7734 bits (151), Expect = 4.658e-9
Identity = 41/136 (30.15%), Postives = 74/136 (54.41%), Query Frame = 3
Query: 3513 DEIVVEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTETISLQKPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATMLTE--EPNKYIVFTLVQEPTADSE-ADCEDIGTAKVNVKTLLKESRNLENERI 3911
            ++I +EI S+ +  ++D+  ++ I+ ++VEYR   I  E T  +SLQKP+   +I    YN+     V    N   R  + ++L +    N  + FT+V +P  D +  DC+DIG A +N+  +L+  +++ N  I
Sbjct:  917 EKIRIEIISLSLNSTSDVAQNDTIQKLFVEYRFCNIVTEET-PVSLQKPASGLQI---YYNYSNVIHVDKENNQANRDLLRSLLNDPNTSNGSVKFTVVSDPPEDEQDLDCDDIGFASINLSEILQSGKDVINRSI 1048          
BLAST of NPHP8 vs. Ensembl Xenopus
Match: myrf (myelin regulatory factor [Source:Xenbase;Acc:XB-GENE-1020968])

HSP 1 Score: 65.0846 bits (157), Expect = 8.997e-10
Identity = 102/424 (24.06%), Postives = 218/424 (51.42%), Query Frame = 3
Query:  150 IPKMDLAQERKTISQWTKDYLEDKYLRLQDDHETLKKHARLQEXXXXXXXXXXXXXXSD---------AKKNGDITPKTDDFEEFRRKCSILESQNGLLKDKVKLLQSQLLAQ-GKKASVYDNVPSRIKSGAIERSNSIQNSGRKNNIRV--IKPRGELYPLSPRRDESVTGDQSLISLNKVVEDLKYEVHRLQIENEELLK--KAYRREDEKL--------SPEHYKSNLKDNLDMIRVTRDIKEKEIQVNVLHGKYEDLK-TKQQYLERNNREMS-------DEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNK--LESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKL 1325
            + + DL   R+ +S  +++ LED ++R+ +++  LK HAR  E KIK++GTKLL++TSD         A+ +G      +  E+ + +   LE +N  L+ K+   + +L  Q G +   Y  V +R  SG   R N +     K  +RV  ++ R           E+++ D++   + ++   ++ + +R+  ++  +LK  ++ R +D ++          E+ ++++++N+ +IR+ ++++EK   +  L  ++  LK + +  L++N + ++        +++ LTS+L++        E + ++V  L++ + + +    D +KE  LLKE+ D L   + N +     +  E   R KI+ LE  +   +S+K   LNK  L+ ER++ ++ +KE+S L ++  E   +++   +K+
Sbjct:   48 VKEKDLKTHRR-VSHISREELEDNFIRIHEENILLKDHARKMEDKIKRMGTKLLRVTSDLAQTGKSFGARHDGRDLEAEETIEDLQDRVRDLEHKNESLRHKLVTYKQRLQVQNGCRHCPYSTVAARTDSGV--RKNIVLPHNIKRGLRVQSLEARPPQVCQVQACGETLS-DEAREEIERLFNLIESQNNRVDDKSTVVLKSMESMRSKDAEMMLYLQKMQQAENQRTSIQENVMLIRLQKELREKNTTLCALKEQFHQLKESYETELQQNQKSLTLSHEAVLTQLQDLTSQLKAERAKVVAMEIEQQSVLNLQRSLQEFQERVTDLEKENALLKENYDSLLKSSLNEDNISSKQAIESELRGKISLLEEQIHHHISDK--TLNKEHLQHEREQNEHLKKEVSQLHMQLLEKIQEVKSYQEKV 465          

HSP 2 Score: 65.0846 bits (157), Expect = 1.065e-9
Identity = 42/149 (28.19%), Postives = 84/149 (56.38%), Query Frame = 3
Query: 3489 PIKPELNPDEIV-VEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTET-ISLQKPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATML-TEEPNKYIV---FTLVQEPTADSEADCEDIGTAKVNVKTLLKESRNLENERIPI 3917
            P  PE  P  ++ VEI S+ +   ++++ D+ ++ ++VE+R  G+  E TET +SL+KP+  +E   + Y+F K   +  +++   R  +  +L   + N  IV   FT+V +P  + E +C D+G A ++++ LL+ + +   E + +
Sbjct: 1098 PSVPEKPPSSMIRVEIMSLTLNPYSEVMGDSAVQRLFVEFRFAGVPPEETETPVSLRKPNQGEE---LYYHFSKVIHLDGSEHAERRDFLYMLLEGSDSNGDIVRLKFTVVSDPINEDEEECCDVGYAYMDLRPLLRRAEDKAEETLQV 1243          
BLAST of NPHP8 vs. Ensembl Mouse
Match: Rpgrip1l (Rpgrip1-like [Source:MGI Symbol;Acc:MGI:1920563])

HSP 1 Score: 521.161 bits (1341), Expect = 8.301e-162
Identity = 330/910 (36.26%), Postives = 531/910 (58.35%), Query Frame = 3
Query:  177 RKTISQWTKDYLEDKYLRLQDDHETLKKHARLQEXXXXXXXXXXXXXXSDAKKNGDIT--PKT--------DDFEEFRRKCSILESQNGLLKDKVKLLQSQLLAQGKKASVYDNVPSRIKSG---AIERSNSIQNSGRKNNIRVIKPRGELYPLSPRRDESVTGDQ--SLISLNKVVEDLKYEVHRLQIENEELLKKAYRREDE-KLS--------PEHYKSNLKDNLDMIRVTRDIKEKEIQVNVLHGKYEDLKTKQQYLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEPD--LEPLAPEI-LERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDI-NFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGN-------EMSVVEAR-----RPIDS----MNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYMYQDNSFT 2774
            R+ +S+ +++ LED++LRL D++  LK+HAR QE KIK++ TKL+++ +D K+   +   PK         +  E+ + K   LE QN +LK+++   + QL  QG + + Y  V +R+ +G   A   + S +  G+    + +     + P   +   S+  +    + +L  V++  + ++  L+   E L  +  R+E+E +LS            +SN++DN++ I++ + + EK   ++V+ GK+  L+ KQ+ L  ++  +    + L  +L+       + E Q+ +V    +R+ +L+   ND +KE  LLKE+ DKL N AF+   E  W+ KE   + +IAQLE  LK D+++K  VL+KL++ERD+ +   +E  +L+L+  + + ++ EL  +LKFF++E+ +N  ++ EAL++I+ ++     Q   +L F++K+D   ++DL R + E +  HAET+QELEKTR++L  Q+KI+ DY+ E E ++Q+++ +++DYE ++ +Y  LLDIRAARI KLEAQLKDIAYGT+  + +  + PD  ++     I LERGEN+ EIHI +V  + + +    DK+   F T+ FYDFE Q T ++RG   E++  ++YLV ++D FL Y+ KNT   ELHQA   +Y T+AACQ+   +I EKS              +  C   LVG +    DI NFG +EYW RL+ PMDQ IR YRE+ KA GYI  N       ++S  +A       P +S    +NEL + +  C GL+SR  +LQP  Y+ YKF+D   H +  +PSSN P+F D    PV MN DL +YLK ++L  YV D+ D  E++Y+G   +PLI L H+K ISG FEL D +  + GT++V L W+ +Y+    S T
Sbjct:   39 RQAVSRVSREELEDRFLRLHDENILLKQHARKQEDKIKRMATKLIRLVNDKKRYERVGGGPKRLGRDVEMEEMIEQLQEKVHELERQNEVLKNRLISAKQQLQVQGHRQTSYSRVQARVNTGRRRASASAGSQECPGKGLRFQNVDEAETVQPTLTKYSNSLLEEARGEIRNLENVIQSQRGQIEELEHLAEILKTQLKRKENEIELSLLQLREQQATDQRSNIRDNVETIKLHKQLVEKSNALSVIEGKFIQLQEKQRTLRISHDALMANGDELNKQLKEQRLKCCSLEKQLHSVRFSERRVEELQDRINDLEKERELLKENYDKLYNSAFSAAHEEQWKLKEQQMKVQIAQLETALKSDLTDKTEVLDKLKTERDQNEKLVQENRDLQLQCLQQKQRLHELQSRLKFFNQESDINADDLSEALLLIKAQKE----QKNGDLSFLEKVDSKINKDLDRSMKELQATHAETVQELEKTRNMLIMQHKINKDYQMEVETVTQKMENLQQDYELKVEQYVHLLDIRAARIQKLEAQLKDIAYGTKQYKFKPEIMPDDSVDEFDETIHLERGENLFEIHINKVTFSSEVLRASGDKELVTFCTYAFYDFELQTTPIVRGLYPEYNFTSQYLVHVNDLFLQYIQKNTVTLELHQAHSTDYETIAACQLRFHEILEKSG-------------RIFCTTSLVGTK---GDIPNFGTVEYWFRLRVPMDQAIRLYRERAKALGYITSNFKKPEKMQLSSQQAATTAQISPAESTDGNLNELHVTVKCCTGLQSRASYLQPHAYVVYKFFDFPDHDTAIVPSSNDPQFDDHMCFPVPMNMDLDRYLKSESLSFYVFDDSDTQENIYMGKVNVPLISLAHDKCISGIFELMDKEKHAAGTIQVILKWKFTYLPPSGSIT 928          

HSP 2 Score: 54.299 bits (129), Expect = 1.578e-6
Identity = 45/164 (27.44%), Postives = 86/164 (52.44%), Query Frame = 3
Query: 3513 DEIVVEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTETISLQKPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATMLT--EEPNKYIVFTLVQEPTADSE-ADCEDIGTAKVNVKTLLKESRNLENERIPIYSYKNKSVXXXXXXXXXXXLGVLRAI 3995
            +EI +EI ++ + DS  +  ++ I+ +++E R   +  E T  +SL KP   Q +    YN+     +    N  +R  +  +L   E P++ + FT+V +P  D +  +CEDIG A V++  L ++ R++  + I +   +     IG + VT++ L  LR++
Sbjct: 1096 EEIRIEIIALNLNDS-QITREDTIQRLFIECRFYSLPAEET-PMSLPKPQSGQWV---YYNYSNVIYLDKENNPAVRDILKAILQRRELPHRSVRFTVVSDPPEDEQDLECEDIGVAHVDLADLFQKGRDIIEQDIDVLDARTDGGTIGKLKVTVEALHALRSV 1254          
BLAST of NPHP8 vs. Ensembl Mouse
Match: Rpgrip1 (retinitis pigmentosa GTPase regulator interacting protein 1 [Source:MGI Symbol;Acc:MGI:1932134])

HSP 1 Score: 301.982 bits (772), Expect = 1.161e-83
Identity = 213/697 (30.56%), Postives = 357/697 (51.22%), Query Frame = 3
Query:  765 KSNLKDNLDMIRVTRDIKEK-------EIQVNVLHGKYEDLKTKQQ-YLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIA--QLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQST--PELDFIQKID-KNKDQ-DLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEPDL--EPLAPE---------ILERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDINFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGNEMSVVEARR---------PIDSMNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYM 2753
            ++++K+N+++IR+ + ++E+       E Q+  +   YEDL  K Q  L+  +     ++  L + L      A +   Q+ +V++L+  + + +    D +KE  LL +S D+L  +  ++  +      + ++  ++   QL   +   + + G  L + +  R   + A ++   L+ ++ ++  Q E+  + L+  +  AS +P+E+ E           + AQ T  P+ D  +  + K +D+ DL++ L E +++HAET  ELEKTR +L  Q KI+  Y++E E    + D   +D+EE+L     LLD + +RI +LE QLKD+AYGT        L P L  EPLA           +L   EN+ E+H+ +  LT  A+    D  P  F T+ FYDFET  T +  G    +D  ++Y+V+ D   L+YL   +   +LHQA  +EY  LA   +S   +                  + H  A L G    +   + GVLEYW+RL  P+   ++   ++ KA+ Y+    +SV+ AR+              NEL + I RC GL+SR+   QPSPY+ Y+F+    H ++ IP+S++P F D    PV + SDL QYL+ + L +YV D+ DP+   YLG A +PL+ L  NK+I G F L D+   SNG+++V+L W+  Y+
Sbjct:  228 RASIKENVELIRLKKLLQERNTSLAATEAQLTRVQEAYEDLLQKNQGILDTAHNAFLSQVNELKAELSEESKKAVSLRTQLGDVSILQITLKEFQVRVEDLEKERKLLSDSYDRLLENMLDSSHQPLDSSHQPHWSTELTGKQLPPQVCPLLDQMGTALEETKVFRQATNKAAQD-GKLKFQDTDILYQHEQEEESLQSTATVAS-SPEELCE-----------LAAQPTLLPQTDQRESSEPKAQDENDLSQVLSELQVSHAETTLELEKTRDMLLLQRKINMCYQEELEATLTKADRENRDHEEKLERLNHLLDFKNSRIKQLEEQLKDVAYGT--------LPPSLCLEPLAAHRGDDEVDMSLLHPSENLFELHVHQAFLTPAALTQAGDTQPTTFCTYSFYDFETHCTPLSTGPQPLYDFTSQYVVQADYLLLHYLQGTSVRLDLHQAMASEYHVLATGWISLDKVLGTVE-------------RVHGLATLAG----AGGEDLGVLEYWMRLCLPLKPSLQACNKRKKAQAYL---SVSVLGARKVQSNESRSETWAPQNELRVEITRCCGLRSRRLGRQPSPYVMYRFFTFPDHDTIIIPASSNPYFKDQALFPVLVTSDLDQYLRREALSVYVFDDEDPEPGSYLGRAQVPLLPLAQNKSIKGDFNLTDSGEKSNGSIKVQLDWKSHYL 883          

HSP 2 Score: 77.411 bits (189), Expect = 1.245e-13
Identity = 49/173 (28.32%), Postives = 98/173 (56.65%), Query Frame = 3
Query: 3498 PELNPDEIVVEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTET-ISLQKPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATMLTEEPN--KYIVFTLVQEPTADSEADCEDIGTAKVNVKTLLKESRNLENERIPIYSYKNKSVXXXXXXXXXXXLGVLRAIEKEL 4007
            P+ + +++ +EI S+     AD+++D  I+ +YVEY+   + L  TET +SL+KP   +EI   +++F K  D+   ++   RQ +  ML  + +      FT+V +P  + + +C+DIG A + +  + +  +++  + + I S +N+++ IG + V++Q    L  I KE+
Sbjct: 1145 PKADSEKMCIEIVSLAFCPEADVMSDETIQQVYVEYKFCDLPLSETETPMSLRKPRAGEEI---HFHFSKVIDLDPVEHQSRRQFLFAMLHAQDSDEGRFKFTVVSDPLDEEKKECQDIGYAYLELWQIFQSGKDILEQELEIVSPRNQAIQIGRLKVSLQAAAALHGIYKEM 1314          
BLAST of NPHP8 vs. Ensembl Mouse
Match: Rpgrip1 (retinitis pigmentosa GTPase regulator interacting protein 1 [Source:MGI Symbol;Acc:MGI:1932134])

HSP 1 Score: 295.049 bits (754), Expect = 3.030e-81
Identity = 213/708 (30.08%), Postives = 357/708 (50.42%), Query Frame = 3
Query:  765 KSNLKDNLDMIRVTRDIKEK-------EIQVNVLHGKYEDLKTKQQ-YLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIA--QLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQST--PELDFIQKID-KNKDQ-DLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEA-----------QLKDIAYGTRNTQIETILEPDL--EPLAPE---------ILERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDINFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGNEMSVVEARR---------PIDSMNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYM 2753
            ++++K+N+++IR+ + ++E+       E Q+  +   YEDL  K Q  L+  +     ++  L + L      A +   Q+ +V++L+  + + +    D +KE  LL +S D+L  +  ++  +      + ++  ++   QL   +   + + G  L + +  R   + A ++   L+ ++ ++  Q E+  + L+  +  AS +P+E+ E           + AQ T  P+ D  +  + K +D+ DL++ L E +++HAET  ELEKTR +L  Q KI+  Y++E E    + D   +D+EE+L     LLD + +RI +LE            QLKD+AYGT        L P L  EPLA           +L   EN+ E+H+ +  LT  A+    D  P  F T+ FYDFET  T +  G    +D  ++Y+V+ D   L+YL   +   +LHQA  +EY  LA   +S   +                  + H  A L G    +   + GVLEYW+RL  P+   ++   ++ KA+ Y+    +SV+ AR+              NEL + I RC GL+SR+   QPSPY+ Y+F+    H ++ IP+S++P F D    PV + SDL QYL+ + L +YV D+ DP+   YLG A +PL+ L  NK+I G F L D+   SNG+++V+L W+  Y+
Sbjct:  228 RASIKENVELIRLKKLLQERNTSLAATEAQLTRVQEAYEDLLQKNQGILDTAHNAFLSQVNELKAELSEESKKAVSLRTQLGDVSILQITLKEFQVRVEDLEKERKLLSDSYDRLLENMLDSSHQPLDSSHQPHWSTELTGKQLPPQVCPLLDQMGTALEETKVFRQATNKAAQD-GKLKFQDTDILYQHEQEEESLQSTATVAS-SPEELCE-----------LAAQPTLLPQTDQRESSEPKAQDENDLSQVLSELQVSHAETTLELEKTRDMLLLQRKINMCYQEELEATLTKADRENRDHEEKLERLNHLLDFKNSRIKQLEGILRSHGLPTSEQLKDVAYGT--------LPPSLCLEPLAAHRGDDEVDMSLLHPSENLFELHVHQAFLTPAALTQAGDTQPTTFCTYSFYDFETHCTPLSTGPQPLYDFTSQYVVQADYLLLHYLQGTSVRLDLHQAMASEYHVLATGWISLDKVLGTVE-------------RVHGLATLAG----AGGEDLGVLEYWMRLCLPLKPSLQACNKRKKAQAYL---SVSVLGARKVQSNESRSETWAPQNELRVEITRCCGLRSRRLGRQPSPYVMYRFFTFPDHDTIIIPASSNPYFKDQALFPVLVTSDLDQYLRREALSVYVFDDEDPEPGSYLGRAQVPLLPLAQNKSIKGDFNLTDSGEKSNGSIKVQLDWKSHYL 894          

HSP 2 Score: 77.411 bits (189), Expect = 1.280e-13
Identity = 49/173 (28.32%), Postives = 98/173 (56.65%), Query Frame = 3
Query: 3498 PELNPDEIVVEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTET-ISLQKPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATMLTEEPN--KYIVFTLVQEPTADSEADCEDIGTAKVNVKTLLKESRNLENERIPIYSYKNKSVXXXXXXXXXXXLGVLRAIEKEL 4007
            P+ + +++ +EI S+     AD+++D  I+ +YVEY+   + L  TET +SL+KP   +EI   +++F K  D+   ++   RQ +  ML  + +      FT+V +P  + + +C+DIG A + +  + +  +++  + + I S +N+++ IG + V++Q    L  I KE+
Sbjct: 1156 PKADSEKMCIEIVSLAFCPEADVMSDETIQQVYVEYKFCDLPLSETETPMSLRKPRAGEEI---HFHFSKVIDLDPVEHQSRRQFLFAMLHAQDSDEGRFKFTVVSDPLDEEKKECQDIGYAYLELWQIFQSGKDILEQELEIVSPRNQAIQIGRLKVSLQAAAALHGIYKEM 1325          
BLAST of NPHP8 vs. Ensembl Mouse
Match: Rpgrip1 (retinitis pigmentosa GTPase regulator interacting protein 1 [Source:MGI Symbol;Acc:MGI:1932134])

HSP 1 Score: 155.992 bits (393), Expect = 1.021e-37
Identity = 76/196 (38.78%), Postives = 116/196 (59.18%), Query Frame = 3
Query: 2193 ENSKDINFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGNEMSVVEARR---------PIDSMNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYM 2753
            E +   + GVLEYW+RL  P+   ++   ++ KA+ Y+    +SV+ AR+              NEL + I RC GL+SR+   QPSPY+ Y+F+    H ++ IP+S++P F D    PV + SDL QYL+ + L +YV D+ DP+   YLG A +PL+ L  NK+I G F L D+   SNG+++V+L W+  Y+
Sbjct:  540 EGAGGEDLGVLEYWMRLCLPLKPSLQACNKRKKAQAYL---SVSVLGARKVQSNESRSETWAPQNELRVEITRCCGLRSRRLGRQPSPYVMYRFFTFPDHDTIIIPASSNPYFKDQALFPVLVTSDLDQYLRREALSVYVFDDEDPEPGSYLGRAQVPLLPLAQNKSIKGDFNLTDSGEKSNGSIKVQLDWKSHYL 732          

HSP 2 Score: 77.411 bits (189), Expect = 1.136e-13
Identity = 49/173 (28.32%), Postives = 98/173 (56.65%), Query Frame = 3
Query: 3498 PELNPDEIVVEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTET-ISLQKPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATMLTEEPN--KYIVFTLVQEPTADSEADCEDIGTAKVNVKTLLKESRNLENERIPIYSYKNKSVXXXXXXXXXXXLGVLRAIEKEL 4007
            P+ + +++ +EI S+     AD+++D  I+ +YVEY+   + L  TET +SL+KP   +EI   +++F K  D+   ++   RQ +  ML  + +      FT+V +P  + + +C+DIG A + +  + +  +++  + + I S +N+++ IG + V++Q    L  I KE+
Sbjct:  952 PKADSEKMCIEIVSLAFCPEADVMSDETIQQVYVEYKFCDLPLSETETPMSLRKPRAGEEI---HFHFSKVIDLDPVEHQSRRQFLFAMLHAQDSDEGRFKFTVVSDPLDEEKKECQDIGYAYLELWQIFQSGKDILEQELEIVSPRNQAIQIGRLKVSLQAAAALHGIYKEM 1121          

HSP 3 Score: 77.411 bits (189), Expect = 1.312e-13
Identity = 83/327 (25.38%), Postives = 166/327 (50.76%), Query Frame = 3
Query:  765 KSNLKDNLDMIRVTRDIKEK-------EIQVNVLHGKYEDLKTKQQ-YLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIA--QLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQST--PELDFIQKID-KNKDQ-DLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEA 1703
            ++++K+N+++IR+ + ++E+       E Q+  +   YEDL  K Q  L+  +     ++  L + L      A +   Q+ +V++L+  + + +    D +KE  LL +S D+L  +  ++  +      + ++  ++   QL   +   + + G  L + +  R   + A ++   L+ ++ ++  Q E+  + L+  +  AS +P+E+ E           + AQ T  P+ D  +  + K +D+ DL++ L E +++HAET  ELEKTR +L  Q KI+  Y++E E    + D   +D+EE+L     LLD + +RI +LE 
Sbjct:  228 RASIKENVELIRLKKLLQERNTSLAATEAQLTRVQEAYEDLLQKNQGILDTAHNAFLSQVNELKAELSEESKKAVSLRTQLGDVSILQITLKEFQVRVEDLEKERKLLSDSYDRLLENMLDSSHQPLDSSHQPHWSTELTGKQLPPQVCPLLDQMGTALEETKVFRQATNKAAQD-GKLKFQDTDILYQHEQEEESLQSTATVAS-SPEELCE-----------LAAQPTLLPQTDQRESSEPKAQDENDLSQVLSELQVSHAETTLELEKTRDMLLLQRKINMCYQEELEATLTKADRENRDHEEKLERLNHLLDFKNSRIKQLEG 541          
BLAST of NPHP8 vs. Ensembl Mouse
Match: Rpgrip1l (Rpgrip1-like [Source:MGI Symbol;Acc:MGI:1920563])

HSP 1 Score: 97.0561 bits (240), Expect = 1.047e-21
Identity = 44/101 (43.56%), Postives = 64/101 (63.37%), Query Frame = 3
Query: 1800 GENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDI 2102
            GEN+ EIHI +V  + + +    DK+   F T+ FYDFE Q T ++RG   E++  ++YLV ++D FL Y+ KNT   ELHQA   +Y T+AACQ+   +I
Sbjct:    1 GENLFEIHINKVTFSSEVLRASGDKELVTFCTYAFYDFELQTTPIVRGLYPEYNFTSQYLVHVNDLFLQYIQKNTVTLELHQAHSTDYETIAACQLRFHEI 101          
BLAST of NPHP8 vs. UniProt
Match: sp|Q68CZ1|FTM_HUMAN (Protein fantom OS=Homo sapiens OX=9606 GN=RPGRIP1L PE=1 SV=2)

HSP 1 Score: 537.724 bits (1384), Expect = 1.183e-166
Identity = 340/913 (37.24%), Postives = 531/913 (58.16%), Query Frame = 3
Query:  177 RKTISQWTKDYLEDKYLRLQDDHETLKKHARLQEXXXXXXXXXXXXXXSDAKKNGDIT--PK--------TDDFEEFRRKCSILESQNGLLKDKVKLLQSQLLAQGKKASVYDNVPSRIKSGAIERSNSIQNSGRKNNIR-VIKPRGELYPLSPRRDESVTGDQSLISLNKVVEDLK--YEVHRLQIEN----EELLKKAYRREDEKL----------SPEHYKSNLKDNLDMIRVTRDIKEKEIQVNVLHGKYEDLKTKQQYLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEPD--LEPLAPEI-LERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDI-NFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGN-----EMSVVEARRP-------IDS----MNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYMYQDNSFT 2774
            R+ +S+ +++ LED++LRL D++  LK+HAR QE KIK++ TKL+++ +D K+   +   PK         +  E+ + K   LE QN  LK+++   + QL  QG + + Y+NV SRI +G   R  + +N+G +   R  IK +      +P    +  G+  L      + +L+   +  R QIE      E+LK   RR++ ++               +SN++DN++MI++ + + EK   ++ + GK+  L+ KQ+ L  ++  +    + L  +L+       + E Q+ ++    +RI +L+   ND +KE  LLKE+ DKL + AF+   E  W+ KE   + +IAQLE  LK D+++K  +L++L++ERD+ +   +E   L+L+  E + Q++EL  ++K +++E  +N  E+ EAL++I+ ++     Q   +L F+ K+D   ++DL R + E +  HAET+QELEKTR++L  Q+KI+ DY+ E E ++++++ +++DYE ++ +Y  LLDIRAARIHKLEAQLKDIAYGT+  + +  + PD  ++     I LERGEN+ EIHI +V  + + ++   DK+P  F T+ FYDFE Q T V+RG   E++  ++YLV ++D FL Y+ KNT   E+HQA   EY T+AACQ+   +I EKS              +  C A L+G +    DI NFG +EYW RL+ PMDQ IR YRE+ KA GYI  N      M  +  + P        DS    +NEL I I  C  L+SR  HLQP PY+ YKF+D + H +  IPSSN P+F D    PV MN DL +YLK ++L  YV D+ D  E++Y+G   +PLI L H++ ISG FEL D+Q    GT+ V L W+ +Y+    S T
Sbjct:   39 RQAVSRVSREELEDRFLRLHDENILLKQHARKQEDKIKRMATKLIRLVNDKKRYERVGGGPKRLGRDVEMEEMIEQLQEKVHELEKQNETLKNRLISAKQQLQTQGYRQTPYNNVQSRINTG---RRKANENAGLQECPRKGIKFQDADVAETPHPMFTKYGNSLLEEARGEIRNLENVIQSQRGQIEELEHLAEILKTQLRRKENEIELSLLQLREQQATDQRSNIRDNVEMIKLHKQLVEKSNALSAMEGKFIQLQEKQRTLRISHDALMANGDELNMQLKEQRLKCCSLEKQLHSMKFSERRIEELQDRINDLEKERELLKENYDKLYDSAFSAAHEEQWKLKEQQLKVQIAQLETALKSDLTDKTEILDRLKTERDQNEKLVQENRELQLQYLEQKQQLDELKKRIKLYNQENDINADELSEALLLIKAQKE----QKNGDLSFLVKVDSEINKDLERSMRELQATHAETVQELEKTRNMLIMQHKINKDYQMEVEAVTRKMENLQQDYELKVEQYVHLLDIRAARIHKLEAQLKDIAYGTKQYKFKPEIMPDDSVDEFDETIHLERGENLFEIHINKVTFSSEVLQASGDKEPVTFCTYAFYDFELQTTPVVRGLHPEYNFTSQYLVHVNDLFLQYIQKNTITLEVHQAYSTEYETIAACQLKFHEILEKSG-------------RIFCTASLIGTK---GDIPNFGTVEYWFRLRVPMDQAIRLYRERAKALGYITSNFKGPEHMQSLSQQAPKTAQLSSTDSTDGNLNELHITIRCCNHLQSRASHLQPHPYVVYKFFDFADHDTAIIPSSNDPQFDDHMYFPVPMNMDLDRYLKSESLSFYVFDDSDTQENIYIGKVNVPLISLAHDRCISGIFELTDHQKHPAGTIHVILKWKFAYLPPSGSIT 928          

HSP 2 Score: 59.6918 bits (143), Expect = 2.063e-7
Identity = 42/139 (30.22%), Postives = 73/139 (52.52%), Query Frame = 3
Query: 3513 DEIVVEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTETISLQKPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATMLT--EEPNKYIVFTLVQEPTADSE-ADCEDIGTAKVNVKTLLKESRNLENERIPIY 3920
            ++I +EI ++ + DS  +  D+ I+ ++VE R   +  E T  +SL KP   Q +    YN+     V    N   R  +  +L   E PN+ + FT+V +P  D +  +CEDIG A V++  + +E R+L  + I ++
Sbjct: 1147 EKIRIEIIALSLNDS-QVTMDDTIQRLFVECRFYSLPAEET-PVSLPKPKSGQWVY---YNYSNVIYVDKENNKAKRDILKAILQKQEMPNRSLRFTVVSDPPEDEQDLECEDIGVAHVDLADMFQEGRDLIEQNIDVF 1280          
BLAST of NPHP8 vs. UniProt
Match: sp|Q8CG73|FTM_MOUSE (Protein fantom OS=Mus musculus OX=10090 GN=Rpgrip1l PE=1 SV=2)

HSP 1 Score: 521.161 bits (1341), Expect = 5.806e-161
Identity = 330/910 (36.26%), Postives = 531/910 (58.35%), Query Frame = 3
Query:  177 RKTISQWTKDYLEDKYLRLQDDHETLKKHARLQEXXXXXXXXXXXXXXSDAKKNGDIT--PKT--------DDFEEFRRKCSILESQNGLLKDKVKLLQSQLLAQGKKASVYDNVPSRIKSG---AIERSNSIQNSGRKNNIRVIKPRGELYPLSPRRDESVTGDQ--SLISLNKVVEDLKYEVHRLQIENEELLKKAYRREDE-KLS--------PEHYKSNLKDNLDMIRVTRDIKEKEIQVNVLHGKYEDLKTKQQYLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEPD--LEPLAPEI-LERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDI-NFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGN-------EMSVVEAR-----RPIDS----MNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYMYQDNSFT 2774
            R+ +S+ +++ LED++LRL D++  LK+HAR QE KIK++ TKL+++ +D K+   +   PK         +  E+ + K   LE QN +LK+++   + QL  QG + + Y  V +R+ +G   A   + S +  G+    + +     + P   +   S+  +    + +L  V++  + ++  L+   E L  +  R+E+E +LS            +SN++DN++ I++ + + EK   ++V+ GK+  L+ KQ+ L  ++  +    + L  +L+       + E Q+ +V    +R+ +L+   ND +KE  LLKE+ DKL N AF+   E  W+ KE   + +IAQLE  LK D+++K  VL+KL++ERD+ +   +E  +L+L+  + + ++ EL  +LKFF++E+ +N  ++ EAL++I+ ++     Q   +L F++K+D   ++DL R + E +  HAET+QELEKTR++L  Q+KI+ DY+ E E ++Q+++ +++DYE ++ +Y  LLDIRAARI KLEAQLKDIAYGT+  + +  + PD  ++     I LERGEN+ EIHI +V  + + +    DK+   F T+ FYDFE Q T ++RG   E++  ++YLV ++D FL Y+ KNT   ELHQA   +Y T+AACQ+   +I EKS              +  C   LVG +    DI NFG +EYW RL+ PMDQ IR YRE+ KA GYI  N       ++S  +A       P +S    +NEL + +  C GL+SR  +LQP  Y+ YKF+D   H +  +PSSN P+F D    PV MN DL +YLK ++L  YV D+ D  E++Y+G   +PLI L H+K ISG FEL D +  + GT++V L W+ +Y+    S T
Sbjct:   39 RQAVSRVSREELEDRFLRLHDENILLKQHARKQEDKIKRMATKLIRLVNDKKRYERVGGGPKRLGRDVEMEEMIEQLQEKVHELERQNEVLKNRLISAKQQLQVQGHRQTSYSRVQARVNTGRRRASASAGSQECPGKGLRFQNVDEAETVQPTLTKYSNSLLEEARGEIRNLENVIQSQRGQIEELEHLAEILKTQLKRKENEIELSLLQLREQQATDQRSNIRDNVETIKLHKQLVEKSNALSVIEGKFIQLQEKQRTLRISHDALMANGDELNKQLKEQRLKCCSLEKQLHSVRFSERRVEELQDRINDLEKERELLKENYDKLYNSAFSAAHEEQWKLKEQQMKVQIAQLETALKSDLTDKTEVLDKLKTERDQNEKLVQENRDLQLQCLQQKQRLHELQSRLKFFNQESDINADDLSEALLLIKAQKE----QKNGDLSFLEKVDSKINKDLDRSMKELQATHAETVQELEKTRNMLIMQHKINKDYQMEVETVTQKMENLQQDYELKVEQYVHLLDIRAARIQKLEAQLKDIAYGTKQYKFKPEIMPDDSVDEFDETIHLERGENLFEIHINKVTFSSEVLRASGDKELVTFCTYAFYDFELQTTPIVRGLYPEYNFTSQYLVHVNDLFLQYIQKNTVTLELHQAHSTDYETIAACQLRFHEILEKSG-------------RIFCTTSLVGTK---GDIPNFGTVEYWFRLRVPMDQAIRLYRERAKALGYITSNFKKPEKMQLSSQQAATTAQISPAESTDGNLNELHVTVKCCTGLQSRASYLQPHAYVVYKFFDFPDHDTAIVPSSNDPQFDDHMCFPVPMNMDLDRYLKSESLSFYVFDDSDTQENIYMGKVNVPLISLAHDKCISGIFELMDKEKHAAGTIQVILKWKFTYLPPSGSIT 928          
BLAST of NPHP8 vs. UniProt
Match: sp|Q9GLM3|RPGR1_BOVIN (X-linked retinitis pigmentosa GTPase regulator-interacting protein 1 OS=Bos taurus OX=9913 GN=RPGRIP1 PE=1 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 8.071e-92
Identity = 223/701 (31.81%), Postives = 363/701 (51.78%), Query Frame = 3
Query:  765 KSNLKDNLDMIRVTRDIKEK-------EIQVNVLHGKYEDLKTKQQ-YLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDW-REKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSD--KLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKID-KNKDQD-LTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEP----------DLEPLAPEILERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDINFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGNEMSVVEARR------PIDSMNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYMYQDNSFTKP 2780
            ++++K+N+ +IR+ + + E+       + Q+  +   YE L  K Q  L   +  +  ++  L + L+     A + + Q+ +V++L+  + + +    D +KE  LL ++ DKL     ++  +  W  E     + K++QL+  L  ++ EK  +L +L  E+ +  + E E+++L      LQ   +E+ D   +  FS+                +      H     E   IQ  + KN+++  L++ L E +++HAET  ELEKTR +L  Q KI+  Y++E E +  + D   KD+E +L    +LLD++  RI++LE QLKD+AYGTR  Q+   L+P          D+ P       + EN+ E+HI +  LT  A+    D  P  F T+ FYDFET  T ++ G    +D  ++Y+V+ID  FL+YL   +   +LHQA  +E+ TLAA  + C D   ++              + H  A L G    +    FGVLEYW+RL+ P+   ++ Y ++ KA+ Y+  N +   EA++         + NEL + IIRC GL+SR    QPSPY+ Y+F+  S H +  IP+S++P F DL R PV + SDL QYL+ + L +YV D+ D +   YLG   +PL+ L  NK+I G F L D     NG+++V L W   Y+  +N F KP
Sbjct:  219 RASIKENIQLIRLKKLLHERNTSLAVTKAQLTEVQAAYETLLHKNQGILGAAHNALLSQVNELRAELKEESKKAVSLKSQMEDVSILQITLKEFQERVEDLEKERKLLNDNYDKLLESMLDSSNQPQWSHELGEQLQQKVSQLQDQLDVEMKEKREILLQLSQEKAQNKDLELEVTSL------LQKHKQEVEDLQNISTFSQSPD-------------RQSAPATHPALFQETIQIQPCEPKNQEEKKLSQMLSELQVSHAETTLELEKTRDMLILQRKINVCYQEELEAMMTKADNENKDHEAKLERLNQLLDLKNKRINQLEEQLKDVAYGTR--QLPLCLKPLPAHENEDKVDISPW-----HQSENLFELHIHQAFLTSAALAQAGDTQPTTFCTYSFYDFETHCTPLVVGPQPLYDFTSQYVVEIDSLFLHYLQGASAQLDLHQAIASEHHTLAAGWI-CFDRVLETVE------------RVHGSATLTG----TGGEVFGVLEYWMRLRFPIRSSLQAYNKRKKAQAYLAANVLGAWEAQKDEPRSGTWKNQNELRVEIIRCCGLRSRSLGAQPSPYVMYRFFTFSDHDTTIIPASSNPYFRDLARFPVLVTSDLDQYLRREALSVYVFDDEDSEPGSYLGRVQVPLLPLAQNKSIQGDFNLTDPVGEPNGSVQVHLDWGSCYLPPEN-FPKP 875          

HSP 2 Score: 72.0182 bits (175), Expect = 3.481e-11
Identity = 41/136 (30.15%), Postives = 80/136 (58.82%), Query Frame = 3
Query: 3498 PELNPDEIVVEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTET-ISLQKPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATML-TEEPNK-YIVFTLVQEPTADSEADCEDIGTAKVNVKTLLKESRNL 3896
            P+ + +++ +EI S+     A+++ D N++ +YVEYR   + L  TET +SL+KP   +EI    ++F K  D+   +    RQ + TML  E+P + ++ FT+V +P  + + +C+++G A + +  +L   R++
Sbjct: 1046 PKADSEKMCIEIVSLAFYPEAEVMCDENVEQVYVEYRFYDLPLSETETPVSLRKPRAGEEI---YFHFSKVIDLDPVEQKERRQFLFTMLIGEDPEQGHLKFTVVSDPIEEEKKECQEVGYAYLELWPMLVSGRDI 1178          
BLAST of NPHP8 vs. UniProt
Match: sp|Q9EPQ2|RPGR1_MOUSE (X-linked retinitis pigmentosa GTPase regulator-interacting protein 1 OS=Mus musculus OX=10090 GN=Rpgrip1 PE=1 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 2.119e-80
Identity = 213/708 (30.08%), Postives = 357/708 (50.42%), Query Frame = 3
Query:  765 KSNLKDNLDMIRVTRDIKEK-------EIQVNVLHGKYEDLKTKQQ-YLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIA--QLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQST--PELDFIQKID-KNKDQ-DLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEA-----------QLKDIAYGTRNTQIETILEPDL--EPLAPE---------ILERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDINFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGNEMSVVEARR---------PIDSMNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYM 2753
            ++++K+N+++IR+ + ++E+       E Q+  +   YEDL  K Q  L+  +     ++  L + L      A +   Q+ +V++L+  + + +    D +KE  LL +S D+L  +  ++  +      + ++  ++   QL   +   + + G  L + +  R   + A ++   L+ ++ ++  Q E+  + L+  +  AS +P+E+ E           + AQ T  P+ D  +  + K +D+ DL++ L E +++HAET  ELEKTR +L  Q KI+  Y++E E    + D   +D+EE+L     LLD + +RI +LE            QLKD+AYGT        L P L  EPLA           +L   EN+ E+H+ +  LT  A+    D  P  F T+ FYDFET  T +  G    +D  ++Y+V+ D   L+YL   +   +LHQA  +EY  LA   +S   +                  + H  A L G    +   + GVLEYW+RL  P+   ++   ++ KA+ Y+    +SV+ AR+              NEL + I RC GL+SR+   QPSPY+ Y+F+    H ++ IP+S++P F D    PV + SDL QYL+ + L +YV D+ DP+   YLG A +PL+ L  NK+I G F L D+   SNG+++V+L W+  Y+
Sbjct:  228 RASIKENVELIRLKKLLQERNTSLAATEAQLTRVQEAYEDLLQKNQGILDTAHNAFLSQVNELKAELSEESKKAVSLRTQLGDVSILQITLKEFQVRVEDLEKERKLLSDSYDRLLENMLDSSHQPLDSSHQPHWSTELTGKQLPPQVCPLLDQMGTALEETKVFRQATNKAAQD-GKLKFQDTDILYQHEQEEESLQSTATVAS-SPEELCE-----------LAAQPTLLPQTDQRESSEPKAQDENDLSQVLSELQVSHAETTLELEKTRDMLLLQRKINMCYQEELEATLTKADRENRDHEEKLERLNHLLDFKNSRIKQLEGILRSHGLPTSEQLKDVAYGT--------LPPSLCLEPLAAHRGDDEVDMSLLHPSENLFELHVHQAFLTPAALTQAGDTQPTTFCTYSFYDFETHCTPLSTGPQPLYDFTSQYVVQADYLLLHYLQGTSVRLDLHQAMASEYHVLATGWISLDKVLGTVE-------------RVHGLATLAG----AGGEDLGVLEYWMRLCLPLKPSLQACNKRKKAQAYL---SVSVLGARKVQSNESRSETWAPQNELRVEITRCCGLRSRRLGRQPSPYVMYRFFTFPDHDTIIIPASSNPYFKDQALFPVLVTSDLDQYLRREALSVYVFDDEDPEPGSYLGRAQVPLLPLAQNKSIKGDFNLTDSGEKSNGSIKVQLDWKSHYL 894          

HSP 2 Score: 77.411 bits (189), Expect = 8.956e-13
Identity = 49/173 (28.32%), Postives = 98/173 (56.65%), Query Frame = 3
Query: 3498 PELNPDEIVVEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTET-ISLQKPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATMLTEEPN--KYIVFTLVQEPTADSEADCEDIGTAKVNVKTLLKESRNLENERIPIYSYKNKSVXXXXXXXXXXXLGVLRAIEKEL 4007
            P+ + +++ +EI S+     AD+++D  I+ +YVEY+   + L  TET +SL+KP   +EI   +++F K  D+   ++   RQ +  ML  + +      FT+V +P  + + +C+DIG A + +  + +  +++  + + I S +N+++ IG + V++Q    L  I KE+
Sbjct: 1156 PKADSEKMCIEIVSLAFCPEADVMSDETIQQVYVEYKFCDLPLSETETPMSLRKPRAGEEI---HFHFSKVIDLDPVEHQSRRQFLFAMLHAQDSDEGRFKFTVVSDPLDEEKKECQDIGYAYLELWQIFQSGKDILEQELEIVSPRNQAIQIGRLKVSLQAAAALHGIYKEM 1325          
BLAST of NPHP8 vs. UniProt
Match: sp|Q96KN7|RPGR1_HUMAN (X-linked retinitis pigmentosa GTPase regulator-interacting protein 1 OS=Homo sapiens OX=9606 GN=RPGRIP1 PE=1 SV=2)

HSP 1 Score: 281.182 bits (718), Expect = 4.074e-76
Identity = 212/711 (29.82%), Postives = 365/711 (51.34%), Query Frame = 3
Query:  765 KSNLKDNLDMIRVTRDIKEK-------EIQVNVLHGKYEDLKTKQQ-YLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTER---ERDWREKEMNYRAKIAQLELTLKRD--VSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYE----LQ--AQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEA-----------QLKDIAYGTR--NTQIETI-LEPDLEPLAPEILERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDINFGVLEYWIRLKHPMDQVIRQYREKLKAEGY----IMGNEMSVVEARRP--IDSMNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYMYQDNSFTKP 2780
            ++++K+ +++IR+ + + E+       + Q+  +   YE L  K Q  L   +  +  ++  L + L+     A + + Q+ +V++L+  + + +    D +KE  LL ++ DKL     ++     +  W  + +  + +    +L  + D  + +K  VL +L  E+ + ++ + E++N+  ++ +    LQ  A I +  D+      E + +P  ++E   I           S P+          +++ L++ L E +++HAET  ELEKTR +L  Q KI+  Y++E E +  + D   +D++E+L    RLLD++  RI +LE            QLKD+AYGTR  +  +ET+    D + +   +L +GEN+ E+HI +  LT  A+    D  P  F T+ FYDFET  T +  G    +D  ++Y+++ D  FL+YL + +   ++HQA  +E+ TLAA  + C D   ++              K H  A L+G    +    FGVLEYW+RL+ P+   ++   ++ KA+ Y    ++G   +  E  R    +  NEL I I +C GL+SR    QPSPY  Y+F+  S H +  IP+SN+P F D  R PV + SDL  YL+ + L I+V D+ D +   YLG A +PL+ L  N++I G F L D     NG+++V+L W+  Y+  + SF KP
Sbjct:  267 RASIKEKVELIRLKKLLHERNASLVMTKAQLTEVQEAYETLLQKNQGILSAAHEALLKQVNELRAELKEESKKAVSLKSQLEDVSILQMTLKEFQERVEDLEKERKLLNDNYDKLLESMLDSSDSSSQPHWSNELIAEQLQQQVSQLQDQLDAELEDKRKVLLELSREKAQNEDLKLEVTNILQKHKQEVELLQNAATISQPPDR----QSEPATHPAVLQENTQI---------EPSEPK--------NQEEKKLSQVLNELQVSHAETTLELEKTRDMLILQRKINVCYQEELEAMMTKADNDNRDHKEKLERLTRLLDLKNNRIKQLEGILRSHDLPTSEQLKDVAYGTRPLSLCLETLPAHGDEDKVDISLLHQGENLFELHIHQAFLTSAALAQAGDTQPTTFCTYSFYDFETHCTPLSVGPQPLYDFTSQYVMETDSLFLHYLQEASARLDIHQAMASEHSTLAAGWI-CFDRVLETVE------------KVHGLATLIG----AGGEEFGVLEYWMRLRFPIKPSLQACNKRKKAQVYLSTDVLGGRKAQEEEFRSESWEPQNELWIEITKCCGLRSRWLGTQPSPYAVYRFFTFSDHDTAIIPASNNPYFRDQARFPVLVTSDLDHYLRREALSIHVFDDEDLEPGSYLGRARVPLLPLAKNESIKGDFNLTDPAEKPNGSIQVQLDWKFPYIPPE-SFLKP 938          

HSP 2 Score: 78.9518 bits (193), Expect = 3.375e-13
Identity = 52/173 (30.06%), Postives = 104/173 (60.12%), Query Frame = 3
Query: 3498 PELNPDEIVVEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTET-ISLQKPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATMLT-EEPNK-YIVFTLVQEPTADSEADCEDIGTAKVNVKTLLKESRNLENERIPIYSYKNKSVXXXXXXXXXXXLGVLRAIEKEL 4007
            P+ + +++ +EI S+     A++++D NIK +YVEY+   + L  TET +SL+KP   +EI   +++F K  D+   +    R+ +  ML  ++P++ ++ FT+V +P  + + +CE++G A + +  +L+  R++  + + I S ++ +  IG + V++Q   VL AI KE+
Sbjct: 1111 PKADSEKMCIEIVSLAFYPEAEVMSDENIKQVYVEYKFYDLPLSETETPVSLRKPRAGEEI---HFHFSKVIDLDPQEQQGRRRFLFDMLNGQDPDQGHLKFTVVSDPLDEEKKECEEVGYAYLQLWQILESGRDILEQELDIVSPEDLATPIGRLKVSLQAAAVLHAIYKEM 1280          
BLAST of NPHP8 vs. TrEMBL
Match: gnl|BL_ORD_ID|20335739 (tr|A0A0H3YJP0|A0A0H3YJP0_SCHMD NPHP8 OS=Schmidtea mediterranea OX=79327 GN=NPHP8 PE=2 SV=1)

HSP 1 Score: 2508.79 bits (6501), Expect = 0.000e+0
Identity = 1320/1320 (100.00%), Postives = 1320/1320 (100.00%), Query Frame = 3
Query:   54 MNLQYQAPNTPNSARYKSQDLYSDSNTDLNAVIPKMDLAQERKTISQWTKDYLEDKYLRLQDDHETLKKHARLQEXXXXXXXXXXXXXXSDAKKNGDITPKTDDFEEFRRKCSILESQNGLLKDKVKLLQSQLLAQGKKASVYDNVPSRIKSGAIERSNSIQNSGRKNNIRVIKPRGELYPLSPRRDESVTGDQSLISLNKVVEDLKYEVHRLQIENEELLKKAYRREDEKLSPEHYKSNLKDNLDMIRVTRDIKEKEIQVNVLHGKYEDLKTKQQYLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEPDLEPLAPEILERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDINFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGNEMSVVEARRPIDSMNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYMYQDNSFTKPINSVALLPGEEGIKNENQPSRHTAPVKEETKDQPDAADYSKQIPNATPKEIRTPKKKERQKKPNQEVMDSGLMSPPAVQIVKGILKNRENIQPEKSLSESLKDKDVLEALIMPDLQIKDDSPIESTKSALEEDIKPTSSLERSREIXXXXXXXXXXXXXSTIDDTVLTKPNTEESKPISSNKVSQPNTYESEXXXXXXXXXXXXXXXLVNDPASGTNNILSENXXXXXXXXXXXXSPIKPELNPDEIVVEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTETISLQKPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATMLTEEPNKYIVFTLVQEPTADSEADCEDIGTAKVNVKTLLKESRNLENERIPIYSYKNKSVXXXXXXXXXXXLGVLRAIEKELKT 4013
            MNLQYQAPNTPNSARYKSQDLYSDSNTDLNAVIPKMDLAQERKTISQWTKDYLEDKYLRLQDDHETLKKHARLQELKIKKLGTKLLKITSDAKKNGDITPKTDDFEEFRRKCSILESQNGLLKDKVKLLQSQLLAQGKKASVYDNVPSRIKSGAIERSNSIQNSGRKNNIRVIKPRGELYPLSPRRDESVTGDQSLISLNKVVEDLKYEVHRLQIENEELLKKAYRREDEKLSPEHYKSNLKDNLDMIRVTRDIKEKEIQVNVLHGKYEDLKTKQQYLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEPDLEPLAPEILERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIFEKSSSQEGSKFSKSNGLKYHCRAKLVGLRENSKDINFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGNEMSVVEARRPIDSMNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYMYQDNSFTKPINSVALLPGEEGIKNENQPSRHTAPVKEETKDQPDAADYSKQIPNATPKEIRTPKKKERQKKPNQEVMDSGLMSPPAVQIVKGILKNRENIQPEKSLSESLKDKDVLEALIMPDLQIKDDSPIESTKSALEEDIKPTSSLERSREIKEKLEAAAKKLEKSTIDDTVLTKPNTEESKPISSNKVSQPNTYESEKKKKKQPKKTPSKSTLVNDPASGTNNILSENDDVIVDKKVKKKSPIKPELNPDEIVVEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTETISLQKPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATMLTEEPNKYIVFTLVQEPTADSEADCEDIGTAKVNVKTLLKESRNLENERIPIYSYKNKSVIIGYIIVTIQILGVLRAIEKELKT
Sbjct:    1 MNLQYQAPNTPNSARYKSQDLYSDSNTDLNAVIPKMDLAQERKTISQWTKDYLEDKYLRLQDDHETLKKHARLQELKIKKLGTKLLKITSDAKKNGDITPKTDDFEEFRRKCSILESQNGLLKDKVKLLQSQLLAQGKKASVYDNVPSRIKSGAIERSNSIQNSGRKNNIRVIKPRGELYPLSPRRDESVTGDQSLISLNKVVEDLKYEVHRLQIENEELLKKAYRREDEKLSPEHYKSNLKDNLDMIRVTRDIKEKEIQVNVLHGKYEDLKTKQQYLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEPDLEPLAPEILERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIFEKSSSQEGSKFSKSNGLKYHCRAKLVGLRENSKDINFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGNEMSVVEARRPIDSMNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYMYQDNSFTKPINSVALLPGEEGIKNENQPSRHTAPVKEETKDQPDAADYSKQIPNATPKEIRTPKKKERQKKPNQEVMDSGLMSPPAVQIVKGILKNRENIQPEKSLSESLKDKDVLEALIMPDLQIKDDSPIESTKSALEEDIKPTSSLERSREIKEKLEAAAKKLEKSTIDDTVLTKPNTEESKPISSNKVSQPNTYESEKKKKKQPKKTPSKSTLVNDPASGTNNILSENDDVIVDKKVKKKSPIKPELNPDEIVVEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTETISLQKPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATMLTEEPNKYIVFTLVQEPTADSEADCEDIGTAKVNVKTLLKESRNLENERIPIYSYKNKSVIIGYIIVTIQILGVLRAIEKELKT 1320          
BLAST of NPHP8 vs. TrEMBL
Match: gnl|BL_ORD_ID|23516486 (tr|A0A210PNG1|A0A210PNG1_MIZYE Protein fantom OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT14288 PE=4 SV=1)

HSP 1 Score: 619.002 bits (1595), Expect = 0.000e+0
Identity = 384/1049 (36.61%), Postives = 624/1049 (59.49%), Query Frame = 3
Query:  168 AQERKTISQWTKDYLEDKYLRLQDDHETLKKHARLQEXXXXXXXXXXXXXXSDAKKNGDI---TPKT---------DDFEEFRRKCSILESQNGLLKDKVKLLQSQLLAQGKKASVYDNVPSRIKSGAIERSNSIQNSGRKNNIRVI----KPRGELY--PLSPRRDESVT---------GDQSLISLNKVVEDLKYEVHRLQIENEELLKKAYRRED-----EKLSPEHYKSNLKDNLDMIRVTRDIKEKEIQVNVLHGKYEDLKTKQQYLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEPDLEPLAPEI-----LERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGL-RENSKDINFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGNEMSVVEA---------RRPIDSMNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYMY------QDNSFTKPINSVALLPGEEGIKNENQPSRHT--APVKEETKDQPDAADYSKQIPNATPKEIRTPKKKERQKKPNQEVMDSGLMSPPAVQ------IVKGILKNRENIQPEKSLSESLKDKDVLEALI-MPDLQ 3128
            AQ+R+ +S+W +D LEDKYLR+ +++  LKKHAR QE KIK++ TKLL++ +D KK  ++    P+          +  EE   K   L+ QN  LK+K+ +L  Q LA  K+ + Y++V SRI +G I R+    +S    N+RV      P+G +   P  PR   S+           D  +  L + +E  + EV  ++   +  LK+A   ED     ++++ E  +  +++N+D+IR+ R++KEK  +   L  KY  L+   Q ++ ++  M  E+ERL  ++    +     + +++  T    ++ +L       +KE  +LKE+N+K  N AF+ +RER+WR++E   + +IAQLE TLK D+ EKGG+L++L SE+D+ +  +     +++ +Y+ + + ++L  K+KFF+KE++++  EIEEAL++++ +R     Q  PE DF+QK+D  KD+D++R L+  + ++AETI ELEKTR++L  Q+KI+ DY+QE E  + RL+E++K+YE +L EYARLLDIRAARI KLE QL+D+AYGT+  +I   +  D E    +      LERG+N+ EIH+ +VCL+ + V+ I D +P +F TW+F++FE Q+T VL+G+  EFD  ++Y+VK+DDFFL++L K++   ELHQ+ G +Y T+AACQ+  K+IF K+              + H  A L G+       I FG +EYWIRL+ PMDQ +R Y+E+ KA GY+  NE +  EA         +RP D++NEL ++I+RC  +K R+ ++QPSPY  Y+F+D + H +V + S+N+PE++D    PV M  +L  YLK   L+++V D+ DP+++ YLG+A +PLI L HNK+I G FEL       NGT+E+EL WQ++Y+       QD    + +      P ++   ++ Q    +   PVK+ ++    AA + +  P+AT   +  P +  R+ +P +++    L + P+ +       VKG++    +I P  S+S+S+ +    +  I MPD Q
Sbjct:   25 AQQRRMVSRWDRDSLEDKYLRMYEENLILKKHARKQEDKIKRMATKLLRLVNDKKKTNEVDGGEPRGKKVKDVEMEEKVEELSEKIRSLDKQNLQLKEKL-MLSKQQLATNKRTTPYNHVGSRISTG-IARTQPQPDSRLAKNMRVTGPMDSPQGRMTGSPTQPRYGHSLLENARADLHHKDDHIAQLQEQMEMYEMEVENMR--QQLRLKEAEHEEDLVKIKQQITAEQ-RVTVQENIDLIRLQREVKEKSTKFFTLQEKYVLLEQNMQTMKHSHDSMLMEMERLNMQVNEEQNRVLTLQNELKFGTTNNSKLIELNEQIMSLEKETQILKEANEKFVNSAFDLDREREWRQRENALKVQIAQLEATLKADLGEKGGILDQLASEKDQHERLQATFRQVQVEHYQQKEEYDDLKQKMKFFTKESAIDFTEIEEALVLVKQRRQ----QELPEPDFLQKVDNEKDKDVSRSLVILQADYAETIHELEKTRNMLVIQHKINKDYQQEVEIATNRLEEVRKEYEMKLDEYARLLDIRAARIKKLEVQLRDVAYGTKQFKIAPPV--DEEDAIADFDETIHLERGQNLFEIHVQKVCLSDEGVKQIGDDEPSVFCTWEFFEFEIQSTPVLKGSRPEFDFTSQYIVKVDDFFLHFLQKDSCTLELHQSFGQDYRTIAACQLVFKEIFNKTHG------------RIHGTATLTGVDSSGGAGIGFGSVEYWIRLRVPMDQALRLYKERTKALGYVTSNEKAATEALQALDETAAKRPADNVNELHVKILRCSDIKPRRDNVQPSPYCIYQFFDFNDHDTVILASTNNPEYNDHMTYPVPMTKELDHYLKTFQLKVFVFDDTDPEQTAYLGIADVPLIPLAHNKSIQGIFELKGANSKINGTVEMELRWQYTYIMSKGVRIQDPPVMEEVAPPYAPPHQDQSDSDRQSVAESDITPVKQRSR---VAAKFPE--PSATSTPMPAPPES-REGEPAKKIPKRRLHAEPSQEPSLVNDAVKGVIS---DIMP-SSMSDSMTETLPAQPSIHMPDNQ 1040          

HSP 2 Score: 96.2857 bits (238), Expect = 4.461e-16
Identity = 61/169 (36.09%), Postives = 100/169 (59.17%), Query Frame = 3
Query: 3519 IVVEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTET-ISLQKPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATML-TEEPNK-YIVFTLVQEPT-ADSEADCEDIGTAKVNVKTLLKESRNLENERIPIYSYKNKSVXXXXXXXXXXXLGVLRAIEKELKT 4013
            + + IS + + + A++L  +NI+ ++V Y   GI  +  ET  SL KP   Q+I    +NF KTF V   KNY  RQ +A+ML  ++P +  I FT+V EP   D E DCED+G A V++KT+L +  N+  + + +   KN+  +IG + +++  L  L+A+E E++ 
Sbjct: 1210 VTITISHLSLEEGANVLHRDNIRQLFVAYNFLGIEPQELETPFSLPKPKPGQQIA---FNFSKTFQVDIEKNYTRRQFLASMLLPDDPEQGRIRFTIVSEPPDEDMEGDCEDVGVAWVSIKTILMKRENIIEQDVEVLDVKNEKNVIGSLNLSVDCLAALQAVENEMQV 1375          
BLAST of NPHP8 vs. TrEMBL
Match: gnl|BL_ORD_ID|20303324 (tr|D2ILT1|D2ILT1_SCHMD RPGRIP1L-like protein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 308/308 (100.00%), Postives = 308/308 (100.00%), Query Frame = 3
Query: 1587 ESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEPDLEPLAPEILERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDINFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGNEMSVVEARRPIDSMNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHD 2510
            ESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEPDLEPLAPEILERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIFEKSSSQEGSKFSKSNGLKYHCRAKLVGLRENSKDINFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGNEMSVVEARRPIDSMNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHD
Sbjct:    1 ESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEPDLEPLAPEILERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIFEKSSSQEGSKFSKSNGLKYHCRAKLVGLRENSKDINFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGNEMSVVEARRPIDSMNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHD 308          
BLAST of NPHP8 vs. TrEMBL
Match: gnl|BL_ORD_ID|21112975 (tr|A0A2T7NIC5|A0A2T7NIC5_POMCA C2 domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_19065 PE=4 SV=1)

HSP 1 Score: 585.874 bits (1509), Expect = 0.000e+0
Identity = 352/908 (38.77%), Postives = 566/908 (62.33%), Query Frame = 3
Query:  168 AQERKTISQWTKDYLEDKYLRLQDDHETLKKHARLQEXXXXXXXXXXXXXXSDAKKN-------GDITPKTDDFEEFRRKCSILESQNGLLKDKVKLLQSQLL--AQGKKASVYDNVPSRIKSGAIERSNSIQNSGR-KNNIRVIKPRGE----LYPLSPRRDESVTGDQSLISLNKVVEDL-----KYEVHRLQIEN---EELLKKAYRRED-----EKLSPEHYKSNLKDNLDMIRVTRDIKEKEIQVNVLHGKYEDLKTKQQYLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQI---------ETILEPDLEPLAPEILERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDINFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGNEMSVVE---------ARRPIDSMNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASN-GTLEVELTWQHSYM 2753
            AQ+R+ +S+  +D LEDKYLRL +++  LKKHAR QE KIK++ TKLL++ +D KK+       G      +   E + K   LE  N  LK+K+ L + Q L  A  K+   Y+ V SRI +G I +  ++Q   R   N+RVI P  +       L   R + V  +++ +   +++  +     K  ++ L+IEN   +  L++A   ED     ++++ E  +S +++N+DMI++ R++KEK  ++  L  KY  ++   + L +N+  +  E+ERL+ +++   +     + ++RN    +KR  +L+    D ++EI  LKE+N+K  + AF+ ERER+WR++E   + +IAQLE TLK D+ EKG ++++  +ERD  +  + E   L++  ++++ + +++ +KLKFF+KE++L+  E+E+AL++++ K+     ++ P+ DF+QK+D   ++D  R+LLE +  +AET+ ELEKTR++L  Q+ I+ DY++E E  +++L++ KK+YE +L EYARLLDIRAARI KLEAQL+D+AYGTR  ++            LE  L+      LERG+N+ EIHI +V L++ AV +I D++P LF TWDF++FE+Q+T VLRG+   +D  ++Y+VK+DDFFL+YL K +   ELHQ+ G +Y T+AACQ+  KDIF+K               + H  A L G+ +    + +G +EYW+RL+ PMDQ +R Y+E+ KA GY+  N++   E         ARRP+D++NEL I++I C  LKSR+  +QPSPY  Y+F+D+S H +V + +SN+PEFHD +  PV M  +L QYL++ +LQIYV D+ DP E+ Y+G+  IPL+ L   K I G+FEL         GT+++E+ WQH Y+
Sbjct:   27 AQQRRMVSKLDRDELEDKYLRLSEENLLLKKHARKQEDKIKRMATKLLRLVNDKKKHDLEIGKAGREVAAEEQLMELKGKVQNLEKINSHLKEKLALTKQQALTLAAAKRTMPYNYVQSRISTG-IPKPPTVQIDPRITKNLRVIGPSQDAPKRFATLQASRADHVVMEEAHMEKRQLLNTIDQLHEKLSMYELEIENLKEQNRLREAEFEEDIIKIKQQITSEQRQS-VQENIDMIKLQREVKEKSTRLIGLQNKYTAMEEDTRALRQNHDHILMEMERLSMQVKEEQNRVLTLQNELRNAATGQKRTLELQEQVVDLQREIDTLKEANEKFVSSAFDLEREREWRQRENKLKVQIAQLEATLKSDLGEKGSIIDRYANERDAHEKLQLEFRELQITYFQMKEKCDDMEEKLKFFTKESALDLTELEDALVLVKQKKQ----RAAPDPDFLQKVDMEINKDHKRQLLELQAEYAETVLELEKTRNMLVVQHNINKDYQKELESSNKQLEDTKKEYELKLDEYARLLDIRAARIKKLEAQLRDVAYGTRQYRVPPPDDDVESSVDLEESLQ------LERGQNLFEIHIEKVSLSEDAVRHIGDEEPSLFCTWDFFEFESQSTPVLRGSRPVYDFTSQYIVKVDDFFLHYLQKGSCTLELHQSFGQDYRTVAACQLVFKDIFDKPQG------------RIHGMAVLTGVADGETGVGYGTIEYWVRLRVPMDQALRLYKERTKALGYLSANKVQAEEVLQALDEKAARRPLDNINELHIKVISCAKLKSRRDDVQPSPYCVYQFFDYSDHDTVCVRNSNNPEFHDHKTFPVPMTPELDQYLRVTHLQIYVFDDTDPVETSYIGIVEIPLMLLRTQKQIKGTFELKRQDGTMGIGTMDLEIYWQHEYI 910          

HSP 2 Score: 83.9593 bits (206), Expect = 2.706e-12
Identity = 58/171 (33.92%), Postives = 95/171 (55.56%), Query Frame = 3
Query: 3513 DEIVVEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTET-ISLQKPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATMLT--EEPNKYIVFTLVQEPTADSE-ADCEDIGTAKVNVKTLLKESRNLENERIPIYSYKNKSVXXXXXXXXXXXLGVLRAIEKELKT 4013
            D + V +S + + + +  + + NIK ++V Y   G+  + TET  SL KP    +I    +NF +T  V   ++   RQH+A ML    E    I FT+V EP  D + ADCED+G A V+V+ +LK   +L++  I I+   N   +IG + VT++ L  L+A++ E++ 
Sbjct: 1188 DTVTVVVSHLSLEEDSPPMVNPNIKQLFVAYSFVGLPPQDTETPFSLPKPRPQSQIA---FNFSRTIAVDMKRHLERRQHLALMLLPDHEDQGRIRFTVVSEPPEDEQDADCEDVGVAYVSVRDILKNKADLKDADIDIFDVGNPKRVIGQMNVTVECLAALQAVDLEMQV 1355          
BLAST of NPHP8 vs. TrEMBL
Match: gnl|BL_ORD_ID|20333361 (tr|A0A1S3IMU7|A0A1S3IMU7_LINUN protein fantom isoform X3 OS=Lingula unguis OX=7574 GN=LOC106165255 PE=4 SV=1)

HSP 1 Score: 585.489 bits (1508), Expect = 0.000e+0
Identity = 355/933 (38.05%), Postives = 587/933 (62.92%), Query Frame = 3
Query:  168 AQERKTISQWTKDYLEDKYLRLQDDHETLKKHARLQEXXXXXXXXXXXXXXSD---------AKKNGDITPKTDDFEEFRRKCSILESQNGLLKDKVKLLQSQLLAQGKKASVYDNVPSRIKSGAIERSNSIQNSGRKNNIRVIKPR----GELYPLSPRRDESVTGD--------QSLI-----SLNKVVEDLKYEVHRLQIENEELLKKAYRREDEKLSPEHYKSNLKDNLDMIRVTRDIKEKEIQVNVLHGKYEDLKTKQQYLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEPDLEPLAPEI-----LERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDINFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGNEMSVVEARRPI---------DSMNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYMYQDNSFTKPINSVALLPGEEGIKNENQPSRH 2846
            AQ+R+ +++W+K+ LEDKYLR+ +++  LKKHAR QE KIK++ TKLL++ SD         AK+  DI  + +  EE   K   LE +NGLLK+K+ + + QL  QGK+ + Y +V SRI +G I +  + +   R  N+RV  PR        P  PR   S+  +        + +I      +N   +D+++   +L+++  E  +   R + +++S E  +  L++N+D+IR+ R++K+K  ++  L  KY  ++   + ++ ++ ++  E+E L  +L+  ++   + + +++  +  R++I +LE    D KKE  +LKE+N+KL + AF+ ERER+WR++E   + +IAQL+ TLK DV EKGG+L++L  ER+  +  EKE+ +L L++ +L+ Q +EL +K+KFF+KE++++  EIEEAL++++ K+     ++  EL+F++++D+ K++DL ++++  +  HAETI ELEKTR++L  Q+KI+ DY+ E E ++++++E + +++ +L EYARLLDIRAARI KLE+QLKDIAYGTR  +I    E   E    E      L+RGEN+ EIHI +V L+ + ++ + D+ P +F T+DFY+F+TQ+T V++G  ++F+   +++VK+DDFFL+Y+ K++   ELHQA G  Y T+AA Q+  +DIF+K               + H   +L G+ E +  + +G L+YW+RLK PMDQ +R Y+E+ KA GYI  N  +   A + +         D++NEL +++++C G+K+R+  +QPSPY+ YKF+D   H +  + SSN+P F D +  PV M +DL  YLK Q+LQ+YV D+ DP+E+ YLG+A++PL+ L H+K I G FELH      NGT++V+L WQ++Y+    S   P   +A  P    +K E  P  H
Sbjct:   36 AQQRRMVARWSKEELEDKYLRMYEENLLLKKHARKQEDKIKRMATKLLRLVSDKKKAQQEPGAKRVRDIETE-EMLEELHGKIRNLEKENGLLKEKLMVTKQQLSTQGKRNTPYSHVESRINTG-IPKPPTSERITR--NLRVAGPRESQRSVHSPGLPRYGHSLLEEARAENRHLEGVIEQQNEQINIYEQDIEFLREQLRVKEAEFEEDLLRIK-QQMSAEQ-RVTLQENVDLIRLQREVKDKATKLTSLQEKYTRMEENLRTVKSSHDQVLREMEALNQQLKQEENRVMSLQNELKLGSTSRRKIVELEEQIIDLKKESEILKEANEKLVSSAFDLEREREWRQREQALKVQIAQLDATLKADVGEKGGILDRLSHERETNERLEKELRDLNLQHLQLKEQHDELKEKMKFFTKESAIDFSEIEEALVLVKQKKE---KKAHLELEFLERVDEEKNKDLEKQVVLLQAEHAETIDELEKTRNMLIVQHKINKDYQMEVEAVTKKMEENRLEFDTKLDEYARLLDIRAARIKKLESQLKDIAYGTRQYRIPPREEGMEESEVEEFDESLHLQRGENLFEIHISKVTLSSEGLKQLGDEAPSIFCTYDFYEFDTQSTAVMKGAVADFEFTYQFVVKVDDFFLHYVQKDSTTVELHQAFGTNYQTVAAGQLKFRDIFDKPHG------------RVHGSIQLAGVGEGAVGLLYGTLDYWVRLKVPMDQALRLYKERTKALGYIESNVRATETALKTLDDSSVNRAEDNVNELHVKVLKCTGVKARRGEVQPSPYVVYKFFDFPDHDTSIVQSSNNPNFSDHKTFPVPMTADLDIYLKSQHLQVYVFDDTDPEEAAYLGMASVPLLPLSHDKAIKGIFELHAPDGTVNGTVDVQLKWQYTYLPPSISTKTPAQILATTP----MKPEKVPLLH 943          

HSP 2 Score: 95.1301 bits (235), Expect = 1.198e-15
Identity = 62/171 (36.26%), Postives = 105/171 (61.40%), Query Frame = 3
Query: 3507 NPDEIVVEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTET-ISLQKPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATM-LTEEPNK-YIVFTLVQEPTADSE-ADCEDIGTAKVNVKTLLKESRNLENERIPIYSYKNKSVXXXXXXXXXXXLGVLRAIEKEL 4007
            NPD +VV I+ + + + A  L++  ++ ++VEYR  G   E  ET +SL KP  +Q+I    +NFKK F V    +Y  RQ++A+M L ++P++  I FT+V EP  D E  +C D+GTA V++  +L++  ++ +  IPIY    +S +IG++ VT++    L A++ E+
Sbjct: 1229 NPDTVVVTIAHLSLEEGASALSNPAVQQLFVEYRFLGFPAEELETPVSLPKPKPDQQI---YFNFKKVFHVDAQDHYESRQYLASMLLPDDPDEGRIRFTVVSEPPEDDESGECNDVGTAFVSLTEILEKKEDVIDRDIPIYDIDEESTVIGHLNVTVECYAALHAVKLEM 1396          
BLAST of NPHP8 vs. Ensembl Cavefish
Match: rpgrip1l (RPGRIP1 like [Source:NCBI gene;Acc:103034464])

HSP 1 Score: 496.123 bits (1276), Expect = 1.851e-152
Identity = 326/911 (35.78%), Postives = 524/911 (57.52%), Query Frame = 3
Query:  168 AQERKTISQWTKDYLEDKYLRLQDDHETLKKHARLQEXXXXXXXXXXXXXXSDAKK-----------NGDITPKTDDFEEFRRKCSILESQNGLLKDKVKLLQSQLLAQGKKASVYDNVPSRIKSGAIE-RSNSIQNSGRKNNIRVIKPR---GELYPLSPRRDESVTGDQSLISLNKVVEDLK--YEVHRLQIE----NEELLKKAYR---REDEKLSPEHYK--------SNLKDNLDMIRVTRDIKEKEIQVNVLHGKYEDLKTKQQYLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEPDL--EPLAPEI-----LERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDIN-FGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGNEMSVVEAR---------RPIDSMNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYM 2753
            A+ R+ +++ +++ LED+YLRLQD++  LK+H   QE KIK++ TKL+++  D K+            G      +  EE + K   LE QN  LK ++ + + QL  Q  + + Y +V SRI SG    R ++   S R    R +  R   GE+    P+      G   L      + +L+   E  R QIE    + E+L+   R   RE E+ S  H K        S +K+N++MI++ + + EK     VL G++  L+  Q+ ++ ++     +++ LT +L+     +   E Q+   T+  +R  +L     D +KE  LLKE+ DKL + AF+  +E+ W+ KE   + +IAQLE+ LK D+++K  +L+K+++ERD  +N  +E   L+L+  E + ++EE+ +++KFF+KE+ ++  E+ EALM+I+ +R     Q+  EL F+ KID+    D+   L E +  HAET+QELEKTR++L  Q+KI+ DY+ E E +++++D++K + E +  + A+LLD+RAA+I KLEAQLKDIAYGT+      +  PD+  + +A E      L RGEN+LE+H+G    + +A+E++ DKDP  F T+ FYDFE Q+T V+ G+   ++  ++YLVK+DD FL+YL+ ++   E+  A G  Y T+AA Q+    + E+               K     +LVG+   S +I  FG L+YW+RL+ P++Q IR Y+E+ KA GY+  +     +A          +  DS+NEL + +  C  L+SR  H QPSPY+ YK YD   H +  IPS+  P+F D    PV MN+DL  YL+ + L +YV D+LD +  +YLG A +PLI L H+K I+G FEL D++ A++G ++V L W+ +Y+
Sbjct:   34 ARARQAVAKVSREELEDRYLRLQDENLLLKQHTHKQEDKIKRMATKLIRLVKDRKRVEQMTSAGRAVGGRDVEMEEMMEELQEKVQELEKQNEGLKQRLLIAKHQLQTQSHRPTPYSHVQSRINSGLRRLRQDTPPLSQRPLTPRGVGSRHVEGEISSKPPQGHLPRYGHSLLDEARSEIRNLENVIESQRAQIEEMERSAEMLRDQLRSKEREYEE-SLHHIKEQQASGQRSTIKENVEMIKLQKQLTEKGNAFIVLEGRFLQLQESQKTMKASHDAAMAKVDELTGQLKEERLKSVGLESQLHIKTLEERRTGELLMRIQDLEKERDLLKENCDKLISSAFDVSQEQKWKTKEQQLKLQIAQLEMALKSDLTDKNQILDKIKAERDLNENLMQENKELQLQFLEQKQKLEEIKNRMKFFTKESEIDAAELSEALMLIKVRRT----QANGELGFLGKIDEKIHVDVESSLKELQATHAETVQELEKTRNMLIIQHKINKDYQAEVEAVTRKMDDLKLENELKQEKLAQLLDMRAAKIKKLEAQLKDIAYGTKT----HVFRPDVTEDDVADEFDETVHLARGENLLEVHLGTALFSPEALESLGDKDPSTFCTYAFYDFELQSTAVVWGSQPTYNFTSQYLVKVDDLFLHYLHSSSVTVEVQLAEGLAYRTIAAGQLRPSQVLEREG-------------KVFGTLQLVGV---SGEIQAFGTLDYWLRLRVPIEQAIRLYKERAKALGYLSSSLRDQSQASTSSVPSTSFKKDDSLNELHVTVRCCSILRSRGPHSQPSPYVIYKLYDFPDHDTPIIPSTCEPQFEDHVTFPVAMNADLDAYLRAEALILYVFDDLDLENQLYLGKARVPLISLAHDKAITGMFELVDSEGAASGYIDVTLKWKLTYL 919          
BLAST of NPHP8 vs. Ensembl Cavefish
Match: rpgrip1 (protein fantom-like [Source:NCBI gene;Acc:103030220])

HSP 1 Score: 208.764 bits (530), Expect = 4.053e-54
Identity = 224/933 (24.01%), Postives = 425/933 (45.55%), Query Frame = 3
Query:  171 QERKTISQWTKDYLEDKYLRLQDDHETLKKHARLQEXXXXXXXXXXXXXXSD--AKKNGDITPKTDDFEEFRRKCSILESQNGLLKDKVKLLQSQLLAQGKKASVYDNVPSRIKSGAIERSNSIQNSGRKNNIRVIKPRGELYPLSPRRDESV--TGDQSLISLNKVVEDLKYEVHRLQIENEELLKKAYRREDEKLSPEHYKSNLKDNLDMIRVTRDIKEKEIQVNVLHGKYEDLKTK--------QQYLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAK---------IAQLELTLKRDVSEKGGVLNKLESERDR--------VDNAEKE---MSNLRLRNYELQAQI-------EELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRN-----------TQIET-ILEPDLEPLAPEILERGENILEIHIGRVCLTQQAVENIK---------DKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGA-EYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDINFGVLEYWIRLKHPMDQVIRQYREKL---KAEGYIMGNEMSVVEARRPIDSM--------NELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDE-SVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSY 2750
            +ER+ + +  +++LE++ LRLQ+++  LK+H R+QE K+++L TKLL++         G      D  +E   + + LE Q   L+ K+ + + Q+L+   +          ++     R  +     R  +  +   R E+  L      SV  T +  +  L    + L+  +   + E E+ +K+  R++ +      ++ ++K+N+D+IR+ + + EK   + VL  K+  L+          Q+ L  +   +  ++E L+ +L+         EGQ+    +  + + +L+    D + E  LLK+  D L     + +  ++  E +   R +         + +LE  L+++  E+    + LE  +DR        ++  E+E    + LR ++  ++ ++         L +KL   ++E  ++ +++ E LM I+  R  + +Q    L F+  + + K  D +++L   + +HAET+ EL KT+ LL  Q+++ ND + E +   +R +  +++  +  TE  +LL  RA +I+ L+ QLKD AY  RN           T +E  +++P  E  +  +L  GE++LEIH+     T   +  +K          ++   F T+ F DFE  +T ++ G+   +   + Y +   D         +   ELHQA G  +++T    ++  + +             +  G +   RA L G    S+    GVLE+W+RL HP  +    ++++     AE +     M     +     +        NEL + + RC GL SR   L P  Y+ Y+ YD   H++ T+     P F D    P+ + +DL +YLK+ +L +YV D+ +      YL    +PL  L   + I G + L D   A  GT+ V L W++ +
Sbjct:   45 KERQRVFKVPREHLEEQCLRLQEENTLLKQHTRIQEQKLRRLSTKLLRLRYGHPGSAGGREADTEDTIQELETRVATLEGQKEALQGKLSVARQQILSLTGRPHHRPRTARGVEVDGGVRRAAQTAPARYAHSSLEDTREEIEKLHALLRSSVLETQNMRVTELELAAQSLRDTLKEKEREIEDTVKELRRQQVDG-----HRLSIKENVDVIRLQKQLSEKSTALLVLQEKFTSLQEAYEAKLEEDQKSLRESQGALLGKVEELSEQLKEEKQRVLMLEGQLSTAALSLQSLQELQEKVTDLEGERNLLKKGYDTLLESTLSAQSHQEEHEDKERERERRREEKRRAELQRLEEILEQERRER----DDLEIAKDRMRREHERTLEEREQEKALATELREKHVSMEQEVLQHKQEAASLQEKLSRVTQEFDMSVEDLSETLMQIKAFRLQLKSQEG--LRFL--VTEEKMMDSSQELSALQASHAETVVELHKTQHLLLMQHRLCNDLQAELKLELERAEMERQENRKWATEKDKLLKSRALQINSLQGQLKDFAYSPRNYNRAIPQQYTWTGVEQEVMQPMEENTSITLLREGESLLEIHLLGATFTPVGLRTMKQDRAGDTRGQQEVVTFCTYAFLDFEMHSTPLISGSQPNYGFTSSYTLSAHDLTKLGGQGASVHAELHQALGGVQFITRGRARIPLEGV------------LQRRGEQIKGRANLTG----SEGEILGVLEFWVRL-HPQIEPKEAHKDRATDRTAERWATHKPMDWSHIQPETQEIFDYGGGIPNELEVVLERCVGLSSRWPGLLPDSYLTYRLYDLPPHSTPTVLCCEDPVFSDSTTYPLAVTADLMEYLKVGSLWVYVFDDSEGRAPQTYLAKTPVPLQPLAAGRPIKGDYVLRDPAGAPRGTVRVHLQWRYPF 947          

HSP 2 Score: 81.2629 bits (199), Expect = 7.497e-15
Identity = 51/140 (36.43%), Postives = 85/140 (60.71%), Query Frame = 3
Query: 3513 DEIVVEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTET-ISLQKPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATML-TEEPNK-YIVFTLVQEPTADSEADCEDIGTAKVNVKTLLKESRNLENERIPIYS 3923
            D + VEI S+    S+ +  D +++ +YVEYRL GI +E+TET +SL+KP+  +E+   +YNF +   V   +   +R ++ TML   +PN   + FT+V EP  D E +CED+G A ++++ LL    ++  ++I I S
Sbjct: 1123 DRLRVEILSLLFDPSSSVALDQSVQQVYVEYRLLGIPMETTETPMSLRKPTKGEEV---HYNFSRVIHVDSMEAAPLRHYLYTMLEGTDPNSGRLKFTVVSEPLND-EDECEDVGQAYLDLQELLLTGNDVVEKQIDIIS 1258          
BLAST of NPHP8 vs. Ensembl Medaka
Match: rpgrip1l (protein fantom [Source:NCBI gene;Acc:101169939])

HSP 1 Score: 327.791 bits (839), Expect = 1.309e-92
Identity = 270/914 (29.54%), Postives = 471/914 (51.53%), Query Frame = 3
Query:  162 DLAQERKT-----ISQWTKDYLEDKYLRLQDDHETLKKHARLQEXXXXXXXXXXXXXXSDAKK-----NGDITPKT--------DDFEEFRRKCSILESQNGLLKDKVKLLQSQLL-AQGKKASVYDNVPSRIKSG--AIERSNSIQNSGRKNNIRVI-----KPRGELYPLSPRRDESVTGDQ--SLISLNKVVEDLKYEVHRLQIENEELLKKAYRREDEKLSPEHY-----------KSNLKDNLDMIRVTRDIKEKEIQVNVLHGKYEDLKTKQQYLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEPDLEPLAPEILER--GENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDINFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGNEM--SVVEARRPIDSMNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYMYQDNSFT 2774
            DLA  R       +S+ ++D LED++ RL ++   LK+H   Q+ KI+KLGTKL+++  D ++      G + P +        +  EE +     L+++   LK ++ + ++Q++ +Q  + + Y  V  ++ SG   +    S  +  R   +R        P G+L    PR   S+  +    + +LN V+E  + ++  L+  +E L ++  ++E E    EH            +S +  N+ +I++ + + ++   V +L G++  L+  QQ L+        ++E LT++L+     +   E  ++N  + + +   L+   ++ ++E  LL+E N +L + AF+  +++ W+ +E   + +I+QLE  LK D+ +K  +L+K+++ERDR +   +E   + LR  E + Q+EELS +LKF S+E   +  E+ EAL++I+ ++    +Q + +L F+ + + +  ++ +  + E    HAET QELEKTR LL  + +I  DY+ E E + ++ ++ + +YE++L    +LLD RAA+IHKLEA+ KDIAY  +     T  EP     + E   R   EN++E  I  V L+   ++ + D +   F T+ FY FE  AT V+ G S ++D  + Y V +D  FL+YL K++   ELHQA   ++ T+ + ++  +D+  +                 H    L G + +      G LEY +RLK PM +  R   E   +  +    ++  SV       DS NEL I I RC  L+S      PSPY+ YKFY    H S T+     PEF+DL+   V M+SDL +YL+ + L+IYV D  +    +++G A + L+ L +++  SG FEL D      G +EV   W+ +Y+    S T
Sbjct:   31 DLAGNRHAWAPQDVSRVSRDELEDRFFRLHEETLQLKQHIHKQDEKIRKLGTKLVRLVKDRERLQQMAAGKVQPPSRVRDIETEEMIEELQENVRGLQAEKEELKQRLLVAKNQVINSQRWRPTPYGRVQPQVDSGLAKLRDDASSPSRARPRGLRSWDTERKPPTGQL----PRYGHSLLEEARGEIRNLNNVIESQQSQIEELERASELLREELKKKEAE--YEEHLQQMRQQQTFSLRSQVNSNVSLIKLQKQLADRSNVVTMLEGRFVSLQEAQQTLKTCLDGAMAKVEELTAQLKEERLKSLELETVVQNANITKTQREKLQERIHELEQERDLLREENKRLQHSAFDISQQQKWQLQEQQLKLQISQLETALKADLVDKNEILDKMKAERDRNEQLAEENRRVHLRILEQKQQLEELSSRLKFCSRENDYSEAELTEALLLIKTRK----SQRSGDLGFLAEEEGSNSKETS--IRELRAAHAETFQELEKTRKLLSMESRICKDYKAELEVVVEKANKDRAEYEQKLKHQTQLLDARAAKIHKLEAKFKDIAYSPKT--FMTRAEPADTGESDEASGRTSCENLVEFQIVSVSLSPATLQALGDAELSTFCTYSFYLFELHATPVVTGVSPKYDFTSRYAVSMDKHFLDYLDKSSVTVELHQAQ--DWKTIGSGEIRLQDLLGREG-------------SVHGSIPLFGTQGSP---CLGSLEYCLRLKTPMAETKRLLAETAASSAHSAHPQLLPSVT------DSWNELFITIHRCSDLRSVHSQF-PSPYVVYKFYSFPDHPSATVHDCCDPEFNDLKSYFVPMDSDLDRYLRSETLRIYVFDFKEERMDMFVGKAAVSLLPLVNDQTFSGVFELVDPSGRPAGHIEVLFGWKLTYVPPPGSVT 905          
BLAST of NPHP8 vs. Ensembl Medaka
Match: rpgrip1l (protein fantom [Source:NCBI gene;Acc:101169939])

HSP 1 Score: 292.738 bits (748), Expect = 6.745e-81
Identity = 260/914 (28.45%), Postives = 456/914 (49.89%), Query Frame = 3
Query:  162 DLAQERKT-----ISQWTKDYLEDKYLRLQDDHETLKKHARLQEXXXXXXXXXXXXXXSDAKK-----NGDITPKT--------DDFEEFRRKCSILESQNGLLKDKVKLLQSQLL-AQGKKASVYDNVPSRIKSG--AIERSNSIQNSGRKNNIRVI-----KPRGELYPLSPRRDESVTGDQ--SLISLNKVVEDLKYEVHRLQIENEELLKKAYRREDEKLSPEHY-----------KSNLKDNLDMIRVTRDIKEKEIQVNVLHGKYEDLKTKQQYLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEPDLEPLAPEILER--GENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDINFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGNEM--SVVEARRPIDSMNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYMYQDNSFT 2774
            DLA  R       +S+ ++D LED++ RL ++   LK+H   Q+ KI+KLGTKL+++  D ++      G + P +        +  EE +     L+++   LK ++ + ++Q++ +Q  + + Y  V  ++ SG   +    S  +  R   +R        P G+L    PR   S+  +    + +LN V+E  + ++  L+  +E L ++  ++E E    EH            +S +  N+ +I++ + + ++   V +L G++  L+  QQ L+        ++E LT++L+     +   E  ++N  + + +   L+   ++ ++E  LL+E N +L + AF+  +++ W+ +E   + +I+QLE  LK D+ +K  +L+K+++ERDR +   +E   + LR  E + Q+EELS +LKF S+E   +  E+ EAL++I+ ++    +Q + +L F+ + + +  ++ +  + E    HAET QELEKTR LL  + +I  DY+ E E + ++ ++ + +YE++L    +LLD RAA+IHKLEA+ KDIAY  +     T  EP     + E   R   EN++E  I  V L+   ++ + D +   F T                          Y V +D  FL+YL K++   ELHQA   ++ T+ + ++  +D+  +                 H    L G + +      G LEY +RLK PM +  R   E   +  +    ++  SV       DS NEL I I RC  L+S      PSPY+ YKFY    H S T+     PEF+DL+   V M+SDL +YL+ + L+IYV D  +    +++G A + L+ L +++  SG FEL D      G +EV   W+ +Y+    S T
Sbjct:   57 DLAGNRHAWAPQDVSRVSRDELEDRFFRLHEETLQLKQHIHKQDEKIRKLGTKLVRLVKDRERLQQMAAGKVQPPSRVRDIETEEMIEELQENVRGLQAEKEELKQRLLVAKNQVINSQRWRPTPYGRVQPQVDSGLAKLRDDASSPSRARPRGLRSWDTERKPPTGQL----PRYGHSLLEEARGEIRNLNNVIESQQSQIEELERASELLREELKKKEAE--YEEHLQQMRQQQTFSLRSQVNSNVSLIKLQKQLADRSNVVTMLEGRFVSLQEAQQTLKTCLDGAMAKVEELTAQLKEERLKSLELETVVQNANITKTQREKLQERIHELEQERDLLREENKRLQHSAFDISQQQKWQLQEQQLKLQISQLETALKADLVDKNEILDKMKAERDRNEQLAEENRRVHLRILEQKQQLEELSSRLKFCSRENDYSEAELTEALLLIKTRK----SQRSGDLGFLAEEEGSNSKETS--IRELRAAHAETFQELEKTRKLLSMESRICKDYKAELEVVVEKANKDRAEYEQKLKHQTQLLDARAAKIHKLEAKFKDIAYSPKT--FMTRAEPADTGESDEASGRTSCENLVEFQIVSVSLSPATLQALGDAELSTFCT--------------------------YAVSMDKHFLDYLDKSSVTVELHQAQ--DWKTIGSGEIRLQDLLGREG-------------SVHGSIPLFGTQGSP---CLGSLEYCLRLKTPMAETKRLLAETAASSAHSAHPQLLPSVT------DSWNELFITIHRCSDLRSVHSQF-PSPYVVYKFYSFPDHPSATVHDCCDPEFNDLKSYFVPMDSDLDRYLRSETLRIYVFDFKEERMDMFVGKAAVSLLPLVNDQTFSGVFELVDPSGRPAGHIEVLFGWKLTYVPPPGSVT 905          
BLAST of NPHP8 vs. Planmine SMEST
Match: SMESG000076081.1 (SMESG000076081.1)

HSP 1 Score: 2499.93 bits (6478), Expect = 0.000e+0
Identity = 1313/1320 (99.47%), Postives = 1316/1320 (99.70%), Query Frame = 3
Query:   54 MNLQYQAPNTPNSARYKSQDLYSDSNTDLNAVIPKMDLAQERKTISQWTKDYLEDKYLRLQDDHETLKKHARLQEXXXXXXXXXXXXXXSDAKKNGDITPKTDDFEEFRRKCSILESQNGLLKDKVKLLQSQLLAQGKKASVYDNVPSRIKSGAIERSNSIQNSGRKNNIRVIKPRGELYPLSPRRDESVTGDQSLISLNKVVEDLKYEVHRLQIENEELLKKAYRREDEKLSPEHYKSNLKDNLDMIRVTRDIKEKEIQVNVLHGKYEDLKTKQQYLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEPDLEPLAPEILERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIXXXXXXXXXXXXXXXNGLKYHCRAKLVGLRENSKDINFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGNEMSVVEARRPIDSMNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYMYQDNSFTKPINSVALLPGEEGIKNENQPSRHTAPVKEETKDQPDAADYSKQIPNATPKEIRTPKKKERQKKPNQEVMDSGLMSPPAVQIVKGILKNRENIQPEKSLSESLKDKDVLEALIMPDLQIKDDSPIESTKSALEEDIKPTSSLERSREIXXXXXXXXXXXXXSTIDDTVLTKPNTEESKPISSNKVSQPNTYESEXXXXXXXXXXXXXXXLVNDPASGTNNILSENXXXXXXXXXXXXSPIKPELNPDEIVVEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTETISLQKPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATMLTEEPNKYIVFTLVQEPTADSEADCEDIGTAKVNVKTLLKESRNLENERIPIYSYKNKSVXXXXXXXXXXXLGVLRAIEKELKT 4013
            MNLQYQAPNTPNSARYKSQDLYSDSNTDLNA IPKMDLAQERKTISQWTKDYLEDKYLRLQDDHETLKKHARLQELKIKKLGTKLLKITSDAKKNGDITPKTDDFEEFRRKCSILESQNGLLKDKVKLLQSQLLAQGKKASVYDNVPSRIKSGAIERSNSIQNSGRKNNIRVIKPRGELYPLSPRRDESVTGDQSLISLNKVVEDLKYEVHRLQIENEELLKKAYRREDEKLSPEHYKSNLKDNLDMIRVTRDIKEKEIQVNVLHGKYEDLKTKQQYLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEPDLEPLAPEILERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIFEKSSSQEGSKFSKSNGLKYHCRAKLVGLRENSKDINFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGNEMSVVEARRPIDSMNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFEL+DNQHA+NGTLEVELTWQHSYMYQDNSFTKPINSVALLPGEEGIKNENQPSRHTAPVKEETKDQPDAADYSKQIPNATPKEIRTPKKKERQKKPNQEVMDSGLMSPPAVQIVKGILKNRENIQPEKSLSESLKDKDVLEALIMPDLQIKDDSPIESTKSALEEDIKPTSSLERSREIKEKLEAAAKKLEKSTIDDTVLTKPNTEESKPISSNKVSQPNTYE EKKKKKQPKKTPSKSTLVNDP SGTNNILSENDDVIVDKKVKKKSPIKPELNPDEIVVEI+SVEIADSADLLTDNNIKFIYVEYRLPGISLESTETISLQKPS NQEIKKMNYNFKKTFDVSFNKNYMIRQHIATMLTEEPNKYIVFTLVQEPTADSEADCEDIGTAKVNVKTLLKESRNLENERIPIYSYKNKSVIIGYIIVTIQILGVLRAIEKELKT
Sbjct:    1 MNLQYQAPNTPNSARYKSQDLYSDSNTDLNAAIPKMDLAQERKTISQWTKDYLEDKYLRLQDDHETLKKHARLQELKIKKLGTKLLKITSDAKKNGDITPKTDDFEEFRRKCSILESQNGLLKDKVKLLQSQLLAQGKKASVYDNVPSRIKSGAIERSNSIQNSGRKNNIRVIKPRGELYPLSPRRDESVTGDQSLISLNKVVEDLKYEVHRLQIENEELLKKAYRREDEKLSPEHYKSNLKDNLDMIRVTRDIKEKEIQVNVLHGKYEDLKTKQQYLERNNREMSDEIERLTSRLRSTDDFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFNTERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAEKEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRNMVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLRTQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEAQLKDIAYGTRNTQIETILEPDLEPLAPEILERGENILEIHIGRVCLTQQAVENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFLNYLYKNTFPFELHQATGAEYVTLAACQMSCKDIFEKSSSQEGSKFSKSNGLKYHCRAKLVGLRENSKDINFGVLEYWIRLKHPMDQVIRQYREKLKAEGYIMGNEMSVVEARRPIDSMNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYDHSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDPDESVYLGVATIPLIQLCHNKNISGSFELYDNQHAANGTLEVELTWQHSYMYQDNSFTKPINSVALLPGEEGIKNENQPSRHTAPVKEETKDQPDAADYSKQIPNATPKEIRTPKKKERQKKPNQEVMDSGLMSPPAVQIVKGILKNRENIQPEKSLSESLKDKDVLEALIMPDLQIKDDSPIESTKSALEEDIKPTSSLERSREIKEKLEAAAKKLEKSTIDDTVLTKPNTEESKPISSNKVSQPNTYEPEKKKKKQPKKTPSKSTLVNDPVSGTNNILSENDDVIVDKKVKKKSPIKPELNPDEIVVEITSVEIADSADLLTDNNIKFIYVEYRLPGISLESTETISLQKPSFNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATMLTEEPNKYIVFTLVQEPTADSEADCEDIGTAKVNVKTLLKESRNLENERIPIYSYKNKSVIIGYIIVTIQILGVLRAIEKELKT 1320          
The following BLAST results are available for this feature:
BLAST of NPHP8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPGRIP1L2.503e-16837.24RPGRIP1 like [Source:HGNC Symbol;Acc:HGNC:29168][more]
RPGRIP1L5.312e-16837.24RPGRIP1 like [Source:HGNC Symbol;Acc:HGNC:29168][more]
RPGRIP1L6.329e-16837.24RPGRIP1 like [Source:HGNC Symbol;Acc:HGNC:29168][more]
RPGRIP1L9.731e-16837.24RPGRIP1 like [Source:HGNC Symbol;Acc:HGNC:29168][more]
RPGRIP1L2.464e-16737.24RPGRIP1 like [Source:HGNC Symbol;Acc:HGNC:29168][more]
back to top
BLAST of NPHP8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NPHP8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NPHP8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpgrip1l6.167e-14835.06RPGRIP1 like [Source:ZFIN;Acc:ZDB-GENE-081104-81][more]
rpgrip1l6.167e-14835.06RPGRIP1 like [Source:ZFIN;Acc:ZDB-GENE-081104-81][more]
rpgrip13.909e-5424.87RPGR interacting protein 1 [Source:ZFIN;Acc:ZDB-GE... [more]
rpgrip11.646e-4225.22RPGR interacting protein 1 [Source:ZFIN;Acc:ZDB-GE... [more]
rpgrip16.549e-4125.83RPGR interacting protein 1 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of NPHP8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
RPGRIP1L6.140e-13433.89RPGRIP1-like [Source:NCBI gene;Acc:100271765][more]
RPGRIP1L9.943e-13433.26RPGRIP1-like [Source:NCBI gene;Acc:100271765][more]
RPGRIP1L3.581e-13233.78RPGRIP1-like [Source:NCBI gene;Acc:100271765][more]
myrf8.997e-1024.06myelin regulatory factor [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of NPHP8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rpgrip1l8.301e-16236.26Rpgrip1-like [Source:MGI Symbol;Acc:MGI:1920563][more]
Rpgrip11.161e-8330.56retinitis pigmentosa GTPase regulator interacting ... [more]
Rpgrip13.030e-8130.08retinitis pigmentosa GTPase regulator interacting ... [more]
Rpgrip11.021e-3738.78retinitis pigmentosa GTPase regulator interacting ... [more]
Rpgrip1l1.047e-2143.56Rpgrip1-like [Source:MGI Symbol;Acc:MGI:1920563][more]
back to top
BLAST of NPHP8 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q68CZ1|FTM_HUMAN1.183e-16637.24Protein fantom OS=Homo sapiens OX=9606 GN=RPGRIP1L... [more]
sp|Q8CG73|FTM_MOUSE5.806e-16136.26Protein fantom OS=Mus musculus OX=10090 GN=Rpgrip1... [more]
sp|Q9GLM3|RPGR1_BOVIN8.071e-9231.81X-linked retinitis pigmentosa GTPase regulator-int... [more]
sp|Q9EPQ2|RPGR1_MOUSE2.119e-8030.08X-linked retinitis pigmentosa GTPase regulator-int... [more]
sp|Q96KN7|RPGR1_HUMAN4.074e-7629.82X-linked retinitis pigmentosa GTPase regulator-int... [more]
back to top
BLAST of NPHP8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203357390.000e+0100.00tr|A0A0H3YJP0|A0A0H3YJP0_SCHMD NPHP8 OS=Schmidtea ... [more]
gnl|BL_ORD_ID|235164864.461e-1636.61tr|A0A210PNG1|A0A210PNG1_MIZYE Protein fantom OS=M... [more]
gnl|BL_ORD_ID|203033240.000e+0100.00tr|D2ILT1|D2ILT1_SCHMD RPGRIP1L-like protein (Frag... [more]
gnl|BL_ORD_ID|211129752.706e-1238.77tr|A0A2T7NIC5|A0A2T7NIC5_POMCA C2 domain-containin... [more]
gnl|BL_ORD_ID|203333611.198e-1538.05tr|A0A1S3IMU7|A0A1S3IMU7_LINUN protein fantom isof... [more]
back to top
BLAST of NPHP8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpgrip1l1.851e-15235.78RPGRIP1 like [Source:NCBI gene;Acc:103034464][more]
rpgrip14.053e-5424.01protein fantom-like [Source:NCBI gene;Acc:10303022... [more]
back to top
BLAST of NPHP8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NPHP8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NPHP8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NPHP8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpgrip1l1.309e-9229.54protein fantom [Source:NCBI gene;Acc:101169939][more]
rpgrip1l6.745e-8128.45protein fantom [Source:NCBI gene;Acc:101169939][more]
back to top
BLAST of NPHP8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000076081.10.000e+099.47SMESG000076081.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30032498
GenBankAKN21709.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032498 ID=SMED30032498|Name=NPHP8|organism=Schmidtea mediterranea sexual|type=transcript|length=4152bp
TTATTGTGTATAATATAAATAAACTTATGAAATAAACTATCGAGTTATTT
GTGATGAATTTACAGTATCAAGCACCAAATACACCGAATTCCGCTCGGTA
TAAATCCCAAGATTTATATTCCGATTCCAATACCGATTTGAATGCAGTTA
TACCTAAAATGGATTTAGCACAAGAAAGAAAAACTATTTCTCAGTGGACA
AAAGACTATTTAGAAGATAAATATTTACGTCTTCAAGATGATCATGAAAC
TTTGAAGAAACATGCAAGATTACAGGAATTGAAAATAAAAAAATTAGGTA
CAAAGTTACTCAAAATAACCAGTGACGCAAAGAAAAATGGAGATATCACA
CCGAAAACTGACGACTTTGAAGAATTTCGTAGAAAATGCTCAATTTTGGA
ATCTCAAAATGGTTTATTAAAAGATAAGGTGAAGCTACTTCAATCACAGT
TATTAGCCCAAGGAAAGAAAGCATCCGTTTATGATAATGTTCCTTCCAGG
ATCAAATCTGGAGCCATCGAACGTTCAAACAGCATTCAAAATTCCGGTAG
AAAGAATAATATTCGAGTTATAAAACCGAGAGGAGAATTATATCCTCTTT
CTCCCAGACGAGACGAATCTGTGACTGGCGATCAATCGTTGATTTCATTG
AATAAAGTTGTTGAGGACTTGAAATACGAAGTGCATCGCCTGCAGATAGA
AAATGAGGAATTATTGAAAAAAGCTTATCGAAGAGAGGATGAAAAATTAA
GTCCAGAGCATTACAAATCAAATCTAAAAGACAATTTAGACATGATAAGA
GTGACTCGAGACATTAAAGAAAAAGAAATTCAAGTGAATGTACTGCATGG
AAAATACGAAGATCTTAAAACAAAGCAACAATATTTAGAAAGAAATAATC
GTGAGATGTCCGACGAAATCGAGCGATTAACGAGTCGTTTGCGGTCAACT
GACGATTTTGCTGGAAACGCGGAAGGACAAATACGAAACGTGACAGTGCT
TAGAAAACGAATTAATGATCTGGAAGCCACCAACAACGACTTTAAAAAAG
AGATTTATTTGTTAAAAGAATCAAATGATAAGCTGACAAATGATGCTTTT
AATACCGAAAGAGAACGTGATTGGAGGGAAAAAGAAATGAATTACCGAGC
AAAAATAGCCCAATTAGAATTAACTCTCAAGAGGGATGTCAGTGAAAAAG
GAGGAGTTCTCAATAAGCTTGAATCGGAACGCGATAGGGTAGACAATGCA
GAAAAAGAAATGTCGAATTTAAGATTGCGGAACTATGAATTGCAAGCTCA
AATTGAAGAGTTGTCTGATAAACTGAAATTTTTCTCTAAGGAGGCATCAT
TAAATCCCCAGGAAATAGAGGAGGCCTTAATGATTATTCAACATAAAAGA
AATATGGTACATGCTCAAAGTACTCCTGAATTAGATTTCATTCAAAAAAT
AGATAAAAACAAAGACCAAGATTTAACACGTAAATTACTCGAATGTGAAA
TGAATCACGCAGAAACGATTCAGGAATTAGAGAAAACTAGAAGTCTCTTA
CGGACCCAATACAAAATATCCAATGACTATCGCCAGGAGTCTGAGAAAAT
ATCACAGAGATTAGATGAAATCAAAAAAGATTATGAAGAAAGGTTAACCG
AATACGCAAGATTGCTGGATATTAGAGCGGCTCGCATTCATAAATTAGAA
GCTCAATTAAAAGATATCGCATATGGCACGAGAAACACTCAAATTGAAAC
GATTTTGGAACCTGACTTGGAACCTCTTGCTCCGGAGATCCTTGAGCGCG
GGGAAAATATTCTTGAGATTCATATCGGTCGAGTGTGTCTTACACAACAA
GCTGTAGAAAATATTAAAGACAAAGATCCATTCTTATTTGGAACTTGGGA
CTTCTATGATTTCGAAACTCAAGCGACGGGCGTACTGAGAGGAACGAGTT
CTGAATTCGATATAAAAGCTGAATATTTGGTGAAAATTGATGATTTCTTC
TTGAATTATCTTTACAAGAATACATTTCCATTTGAATTACACCAAGCTAC
TGGTGCTGAGTATGTGACTTTGGCAGCATGCCAAATGAGCTGCAAAGATA
TATTTGAAAAGTCATCGTCACAAGAAGGAAGTAAGTTTTCCAAATCCAAT
GGATTAAAATACCACTGTCGAGCAAAATTGGTTGGATTGAGAGAAAATTC
CAAGGACATAAATTTTGGTGTTTTAGAATATTGGATTCGCTTGAAGCACC
CGATGGATCAGGTGATTAGACAATATCGAGAAAAATTGAAAGCAGAAGGT
TATATAATGGGAAATGAAATGTCTGTTGTAGAAGCACGTCGACCAATCGA
CAGCATGAATGAGTTAATTATAAGAATTATAAGATGTAAAGGTTTAAAAT
CCCGACAAAAACATCTTCAACCATCACCATATATTGCGTACAAATTCTAC
GATCACAGTCATCACACAAGCGTCACAATACCGTCAAGCAACAGTCCGGA
ATTTCATGATTTAAGAAGAATCCCGGTTCAAATGAATTCAGACCTGCATC
AGTACCTCAAATTGCAGAATCTACAGATATACGTATTAGACGAGTTGGAT
CCAGACGAATCTGTATATCTGGGAGTAGCAACGATTCCCTTGATTCAGTT
GTGTCACAACAAAAATATTTCCGGTTCATTTGAGCTCCATGATAACCAAC
ATGCTTCCAATGGTACTTTGGAAGTTGAGTTGACATGGCAGCACAGTTAT
ATGTATCAGGATAACTCTTTTACAAAACCAATAAATTCAGTTGCTCTGCT
TCCAGGAGAAGAAGGAATTAAAAACGAAAATCAGCCATCACGCCACACAG
CACCAGTCAAAGAAGAAACCAAAGATCAGCCAGATGCAGCTGATTATTCT
AAACAAATTCCAAATGCTACACCAAAAGAAATAAGAACTCCCAAAAAGAA
AGAAAGGCAAAAAAAGCCGAATCAAGAAGTAATGGACAGTGGATTAATGA
GTCCTCCGGCCGTTCAAATTGTCAAAGGAATTTTGAAAAACAGGGAAAAC
ATTCAACCAGAAAAATCTTTATCAGAAAGTTTGAAAGATAAAGATGTTTT
AGAAGCATTAATTATGCCTGATTTACAGATAAAGGATGACAGTCCGATCG
AGTCAACAAAATCTGCTTTGGAAGAAGACATAAAGCCCACAAGTAGCTTA
GAAAGAAGTCGAGAAATTAAAGAAAAACTTGAAGCAGCCGCTAAAAAATT
AGAAAAATCTACCATTGATGACACAGTACTTACTAAACCTAATACAGAAG
AAAGCAAACCAATTTCAAGCAACAAAGTCTCTCAGCCTAATACATATGAA
TCTGAAAAGAAAAAGAAGAAACAACCAAAGAAAACTCCATCCAAATCTAC
TCTGGTAAATGATCCAGCCTCTGGAACAAACAACATATTATCCGAAAATG
ATGACGTTATTGTTGACAAAAAAGTGAAAAAAAAATCTCCAATAAAGCCA
GAACTAAATCCAGATGAGATAGTTGTAGAAATTAGCAGTGTAGAAATTGC
AGATTCCGCCGATTTATTGACAGATAACAATATCAAATTTATATATGTAG
AATATCGTCTACCTGGAATAAGTCTGGAATCTACTGAGACCATTTCCTTG
CAGAAACCGTCTGTTAATCAGGAAATCAAGAAAATGAATTACAACTTTAA
AAAAACATTTGACGTGAGTTTCAACAAAAACTACATGATTCGTCAGCATA
TTGCTACCATGCTGACAGAGGAACCAAACAAATACATTGTATTCACTCTA
GTCCAGGAGCCAACTGCCGATAGTGAAGCTGATTGTGAGGACATTGGAAC
CGCAAAGGTCAATGTTAAGACGCTTTTAAAAGAAAGCAGAAACCTGGAAA
ATGAGAGAATCCCAATTTACAGTTACAAGAATAAATCTGTAATAATTGGT
TACATCATTGTTACGATTCAGATTTTGGGCGTACTCAGGGCAATCGAGAA
GGAGTTAAAGACTTAATTTAATGGACCTCGGATGATTCAGTATATATTGT
GTTGTCGGAATGATTTGATTATTTCCCTTGTGTTGAAATCTATTCTCCTT
CATTGGTGTTTATTAATTAGCACCTCTTCTATTAATATTTACTTTTACAG
AT
back to top

protein sequence of SMED30032498-orf-1

>SMED30032498-orf-1 ID=SMED30032498-orf-1|Name=SMED30032498-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1321bp
MNLQYQAPNTPNSARYKSQDLYSDSNTDLNAVIPKMDLAQERKTISQWTK
DYLEDKYLRLQDDHETLKKHARLQELKIKKLGTKLLKITSDAKKNGDITP
KTDDFEEFRRKCSILESQNGLLKDKVKLLQSQLLAQGKKASVYDNVPSRI
KSGAIERSNSIQNSGRKNNIRVIKPRGELYPLSPRRDESVTGDQSLISLN
KVVEDLKYEVHRLQIENEELLKKAYRREDEKLSPEHYKSNLKDNLDMIRV
TRDIKEKEIQVNVLHGKYEDLKTKQQYLERNNREMSDEIERLTSRLRSTD
DFAGNAEGQIRNVTVLRKRINDLEATNNDFKKEIYLLKESNDKLTNDAFN
TERERDWREKEMNYRAKIAQLELTLKRDVSEKGGVLNKLESERDRVDNAE
KEMSNLRLRNYELQAQIEELSDKLKFFSKEASLNPQEIEEALMIIQHKRN
MVHAQSTPELDFIQKIDKNKDQDLTRKLLECEMNHAETIQELEKTRSLLR
TQYKISNDYRQESEKISQRLDEIKKDYEERLTEYARLLDIRAARIHKLEA
QLKDIAYGTRNTQIETILEPDLEPLAPEILERGENILEIHIGRVCLTQQA
VENIKDKDPFLFGTWDFYDFETQATGVLRGTSSEFDIKAEYLVKIDDFFL
NYLYKNTFPFELHQATGAEYVTLAACQMSCKDIFEKSSSQEGSKFSKSNG
LKYHCRAKLVGLRENSKDINFGVLEYWIRLKHPMDQVIRQYREKLKAEGY
IMGNEMSVVEARRPIDSMNELIIRIIRCKGLKSRQKHLQPSPYIAYKFYD
HSHHTSVTIPSSNSPEFHDLRRIPVQMNSDLHQYLKLQNLQIYVLDELDP
DESVYLGVATIPLIQLCHNKNISGSFELHDNQHASNGTLEVELTWQHSYM
YQDNSFTKPINSVALLPGEEGIKNENQPSRHTAPVKEETKDQPDAADYSK
QIPNATPKEIRTPKKKERQKKPNQEVMDSGLMSPPAVQIVKGILKNRENI
QPEKSLSESLKDKDVLEALIMPDLQIKDDSPIESTKSALEEDIKPTSSLE
RSREIKEKLEAAAKKLEKSTIDDTVLTKPNTEESKPISSNKVSQPNTYES
EKKKKKQPKKTPSKSTLVNDPASGTNNILSENDDVIVDKKVKKKSPIKPE
LNPDEIVVEISSVEIADSADLLTDNNIKFIYVEYRLPGISLESTETISLQ
KPSVNQEIKKMNYNFKKTFDVSFNKNYMIRQHIATMLTEEPNKYIVFTLV
QEPTADSEADCEDIGTAKVNVKTLLKESRNLENERIPIYSYKNKSVIIGY
IIVTIQILGVLRAIEKELKT*
back to top
Aliases
The feature 'NPHP8' has the following synonyms
Synonym
RPGRIP1L-like
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR041091RPGRIP1_C
IPR031139RPGRIP1_fam
IPR000008C2_dom
IPR021656C2-C2_1
IPR001024PLAT/LH2_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 203..228
NoneNo IPR availableCOILSCoilCoilcoord: 382..430
NoneNo IPR availableCOILSCoilCoilcoord: 1049..1069
NoneNo IPR availableCOILSCoilCoilcoord: 506..530
NoneNo IPR availableCOILSCoilCoilcoord: 1264..1284
NoneNo IPR availableCOILSCoilCoilcoord: 254..295
NoneNo IPR availableCOILSCoilCoilcoord: 313..333
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1073..1096
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1031..1052
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1073..1125
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 924..945
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 959..974
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 923..984
NoneNo IPR availableCDDcd00030C2coord: 771..878
e-value: 1.34546E-7
score: 48.9875
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 579..731
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 763..896
NoneNo IPR availableTMHMMTMhelixcoord: 1295..1314
IPR000008C2 domainSMARTSM00239C2_3ccoord: 770..875
e-value: 1.8E-4
score: 30.9
IPR000008C2 domainPFAMPF00168C2coord: 770..878
e-value: 4.8E-7
score: 30.0
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 768..905
e-value: 3.4E-12
score: 48.5
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 584..732
e-value: 5.1E-47
score: 161.0
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 1122..1320
e-value: 3.2E-52
score: 178.8
IPR021656RPGR-interacting protein 1, first C2 domainPFAMPF11618C2-C2_1coord: 580..733
e-value: 2.0E-40
score: 138.1
IPR041091RPGRIP1, C-terminalPFAMPF18111RPGR1_Ccoord: 1153..1317
e-value: 3.1E-35
score: 121.5
IPR031139RPGRIP1 familyPANTHERPTHR14240RPGR-INTERACTING PROTEIN 1 RELATEDcoord: 39..1318