UDP-2,3-diacylglucosamine hydrolase

Overview
NameUDP-2,3-diacylglucosamine hydrolase
Smed IDSMED30032470
Length (bp)792
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Anatomical Expression

PAGE et. al., 2020




SMED30032470

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30032470 Contig5990uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30032470 Contig5990newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of UDP-2,3-diacylglucosamine hydrolase vs. UniProt/SwissProt
Match: sp|Q7NT75|LPXH_CHRVO (UDP-2,3-diacylglucosamine hydrolase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=lpxH PE=3 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 2.120e-52
Identity = 96/220 (43.64%), Postives = 128/220 (58.18%), Query Frame = 1
Query:   55 VDFISDIHLRSNDPTTYAAWCDFLK--KSKADAVVLLGDIFEVWVGDDLVSFEGEEGAFAKDCLAALSERAKQTPVYVMHGNRDFLMRACFARDAQVQMLHDPCVLVTHAGRFLLSHGDDLCVDDKAYMAFRAQARNPLWQEAVLAKPLAERMAQALKMREAS--REQQSNSLQYAEVDADMALSWLQEKNCSTLIHGHTHRPNVHELAQGARRYVLSDW 702
            + FISD+HL  + P     + D L   + +  A+ +LGD+FE WVGDD      ++  +    LAA+ + A QTP+YVM GNRDFL+ A F   +  ++L DP ++  H  R LLSHGD LC DD AY  FRA +RNP WQ+A+LAKPLAER A A   R  S   +QQ+     ++V  +     L      TLIHGHTHRP  H L   + R+V+ DW
Sbjct:    3 IHFISDLHLADDTPALNQLFLDTLAAWRGRIAALYILGDLFEYWVGDD------DDSPYLAAPLAAMRDFAAQTPLYVMRGNRDFLLGAGFEARSGARLLDDPTLIEAHGQRILLSHGDALCTDDAAYQQFRAMSRNPQWQQAMLAKPLAERHAIARHARAQSEMNKQQTGLTDISDVTENAVRELLAAHGWPTLIHGHTHRP-AHHLHDASSRWVIQDW 215          
BLAST of UDP-2,3-diacylglucosamine hydrolase vs. UniProt/SwissProt
Match: sp|B2FQP4|LPXH_STRMK (UDP-2,3-diacylglucosamine hydrolase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=lpxH PE=3 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 2.198e-48
Identity = 103/248 (41.53%), Postives = 136/248 (54.84%), Query Frame = 1
Query:   61 FISDIHLRSNDPTTYAAWCDFLKKS--KADAVVLLGDIFEVWVGDDLVSFEGEEGAFAKDCLAALSERAKQTPVYVMHGNRDFLMRACFARDAQVQMLHDPCVLVTHAGRFLLSHGDDLCVDDKAYMAFRAQARNPLWQEAVLAKPLAERMAQALKMREASREQQSNSLQY-------------AEVDADMALSWLQEKNCSTLIHGHTHRPNVHELAQGAR---RYVLSDWDFEQNPPRADVLRLNC 750
            FISD+HL  + P     +  FL++    ADA+ +LGD+FE W+GDD  S   +  A   D L  LS+     PVY + GNRDFL+   +AR A +++L DPC++  +    LL HGD LC DD  Y  FRAQ R+P +Q   L++PLA R+A A K REAS+ +QS   Q              +EVDA  A          T+IHGHTHRP +H L  G R   R VL DW +EQ      VLR++ 
Sbjct:    5 FISDLHLDPSRPEITDLFLRFLREQAPGADALYILGDLFEAWIGDDTPSPAADAVA---DALKVLSDSG--VPVYFIRGNRDFLLGEDYARRAGLRILPDPCMIDLYGRPVLLQHGDLLCTDDIPYQQFRAQTRDPAFQAQFLSQPLAARIAFAQKAREASQARQSEMKQGDRAQFETVTDVAPSEVDATFA-----RHGVDTMIHGHTHRPAIHSLQAGGRACTRIVLGDW-YEQG----SVLRVDA 237          
BLAST of UDP-2,3-diacylglucosamine hydrolase vs. UniProt/SwissProt
Match: sp|C1D6W3|LPXH_LARHH (UDP-2,3-diacylglucosamine hydrolase OS=Laribacter hongkongensis (strain HLHK9) OX=557598 GN=lpxH PE=3 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 9.420e-48
Identity = 93/221 (42.08%), Postives = 124/221 (56.11%), Query Frame = 1
Query:   61 FISDIHLRSNDPTTYAAWCDFLKKS--KADAVVLLGDIFEVWVGDDLVSFEGEEGAFAKDCLAALSERAKQTPVYVMHGNRDFLMRACFARDAQVQMLHDPCVLVTHAGRFLLSHGDDLCVDDKAYMAFRAQARNPLWQEAVLAKPLAERMAQALKMREASREQQSNSLQYA-EVDADMALSWLQEKNCSTLIHGHTHRPNVHE--LAQG--ARRYVLSDW 702
             ++D+HL ++ P    A+   L  +  + DA+ LLGDIFEVW+GDD      +   F +  ++AL   A  TPVYVMHGNRDFL+   FAR++   +L DP ++  H  R+LLSHGD LC DD AY  FR   R P  Q  +   PLA R     ++R+ SR  +++   Y  +   +    WL E   STLIHGHTHRP  H   L  G  A R+VL DW
Sbjct:    5 ILADLHLSADTPAFNDAFLRLLNAAAGQIDALYLLGDIFEVWLGDD------DPAPFPRSIISALHRFATSTPVYVMHGNRDFLLGPRFARESGATLLADPTLVELHGHRYLLSHGDLLCTDDIAYQRFRRTIRQPWRQWLLRHLPLALRQRIGQRLRQQSRTAKNDKPLYIMDASTEEVGRWLLEHAGSTLIHGHTHRPGHHRHVLTNGTLAERWVLPDW 219          
BLAST of UDP-2,3-diacylglucosamine hydrolase vs. UniProt/SwissProt
Match: sp|B4SLL1|LPXH_STRM5 (UDP-2,3-diacylglucosamine hydrolase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=lpxH PE=3 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 1.937e-47
Identity = 103/257 (40.08%), Postives = 136/257 (52.92%), Query Frame = 1
Query:   61 FISDIHLRSNDPTTYAAWCDFLKK--SKADAVVLLGDIFEVWVGDDLVSFEGEEGAFAKDCLAALSERAKQTPVYVMHGNRDFLMRACFARDAQVQMLHDPCVLVTHAGRFLLSHGDDLCVDDKAYMAFRAQARNPLWQEAVLAKPLAERMAQALKMREASREQQSNSLQY-------------AEVDADMALSWLQEKNCSTLIHGHTHRPNVHELAQGAR---RYVLSDWDFEQNPPRADVLRLNCQTGEMVRLS 777
            FISD+HL  + P     +  FL++    ADA+ +LGD+FE W+GDD  S   +  A   D L  L++     P Y + GNRDFL+   +AR A +++L DPCV+  +    LL HGD LC DD  Y  FRAQ R+P +Q   L++PLA R+A A K RE S+ +QS   Q              AEVDA             T+IHGHTHRP +H L  G R   R VL DW +EQ      VLR++     +  LS
Sbjct:    5 FISDLHLDPSRPEITDLFLRFLREQAPTADALYILGDLFEAWIGDDTPSPAADAVA---DALKVLTDSG--VPAYFIRGNRDFLLGEDYARRAGLRILPDPCVIELYGRPVLLQHGDLLCTDDIPYQQFRAQTRDPAFQAQFLSQPLAARIAFAQKARETSQARQSEMKQGDRATFENVTDVAPAEVDATFV-----RHGVDTMIHGHTHRPAIHALQAGGRACTRIVLGDW-YEQG----SVLRVDANGWTLDTLS 246          
BLAST of UDP-2,3-diacylglucosamine hydrolase vs. UniProt/SwissProt
Match: sp|Q1QVV3|LPXH_CHRSD (UDP-2,3-diacylglucosamine hydrolase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) OX=290398 GN=lpxH PE=3 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 5.674e-47
Identity = 94/226 (41.59%), Postives = 125/226 (55.31%), Query Frame = 1
Query:   61 FISDIHLRSNDPTTYAAWCDFLKKS--KADAVVLLGDIFEVWVGDDLVSFEGEEGAFAKDCLAALSERAK-QTPVYVMHGNRDFLMRACFARDAQVQMLHDPCVLVTHAGRFLLSHGDDLCVDDKAYMAFRAQARNPLWQEAVLAKPLAER--MAQALKMREASREQQSN----SLQYAEVDADMALSWLQEKNCSTLIHGHTHRPNVHEL---AQGARRYVLSDW 702
             ISD+HL +  P     + D+L++    AD + LLGDIFE W+GDD +      G   +  + AL   +   T +Y MHGNRDFL+   FA  A   +L DPC+        LL HGD LC  D+ YM FRA AR+P WQ  +LA P+ +R  +A++L+M+ +    Q       +  AEV+A M     +E   STLIHGHTHRP VHE     Q A+R VL DW
Sbjct:    5 LISDLHLHTGQPDITRGFLDYLERDARHADTLYLLGDIFEAWIGDDYL------GDLERQVIEALRRLSDAGTQLYFMHGNRDFLVGEDFAAAAGATLLDDPCLATLGRQTVLLMHGDSLCTGDEEYMKFRAMARDPEWQAQILALPIEQRLELAKSLRMQSSDANTQKADAIMDVTPAEVEAIM-----REHGVSTLIHGHTHRPAVHEFTLDGQPAQRIVLGDW 219          
BLAST of UDP-2,3-diacylglucosamine hydrolase vs. TrEMBL
Match: A0A353Y6D4 (UDP-2,3-diacylglucosamine hydrolase OS=Curvibacter sp. OX=1888168 GN=lpxH PE=3 SV=1)

HSP 1 Score: 258.455 bits (659), Expect = 8.693e-83
Identity = 127/249 (51.00%), Postives = 172/249 (69.08%), Query Frame = 1
Query:   22 AEIAAKPQWQLVDFISDIHLRSNDPTTYAAWCDFLKKSKADAVVLLGDIFEVWVGDDLVSFEGEEGAFAKDCLAALSERAKQTPVYVMHGNRDFLMRACFARDAQVQMLHDPCVLVTHAGRFLLSHGDDLCVDDKAYMAFRAQARNPLWQEAVLAKPLAERMAQALKMREASREQQSNSLQYAEVDADMALSWLQEKNCSTLIHGHTHRPNVHELAQGARRYVLSDWDFEQNPPRADVLRLNCQTGEMV 768
            AE+ A   W++VDFISD+HL++++P T  AW D+L  ++ADAV LLGDIFEVWVGDD ++ + E+  F ++C+ AL    ++  +++MHGNRDFL+ A  AR A+  +L DP VLV    R+LLSHGD LC+DD+ YM FRAQ R P WQ++ LA+PLA+R   A  +R+ S E++ +   YA+VD  +A  WLQ+   + LIHGHTH+P  H L +  RR VLSDWD    PPRA+VLRL  QTG  V
Sbjct:    8 AELQAPAHWRVVDFISDLHLQASEPQTVQAWKDYLTHTQADAVFLLGDIFEVWVGDDGLAGDDEDARFERECIDALRAAGERRALHIMHGNRDFLLGAEAARRARCTLLDDPTVLVFGNRRWLLSHGDALCLDDRDYMDFRAQVRTPSWQQSFLAQPLAQRRQIARGLRQQSEERKRSGADYADVDTPLARQWLQQAQATELIHGHTHQPADHALGEDLRRRVLSDWDLLARPPRAEVLRLQ-QTGNEV 255          
BLAST of UDP-2,3-diacylglucosamine hydrolase vs. TrEMBL
Match: A0A4R1ZKG3 (UDP-2,3-diacylglucosamine hydrolase OS=Variovorax sp. BK151 OX=2512132 GN=lpxH PE=3 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 2.233e-80
Identity = 125/259 (48.26%), Postives = 165/259 (63.71%), Query Frame = 1
Query:    1 MNASFFTAEIAAKPQWQLVDFISDIHLRSNDPTTYAAWCDFLKKSKADAVVLLGDIFEVWVGDDLVSFEGEEGAFAKDCLAALSERAKQTPVYVMHGNRDFLMRACFARDAQVQMLHDPCVLVTHAGRFLLSHGDDLCVDDKAYMAFRAQARNPLWQEAVLAKPLAERMAQALKMREASREQQSN-SLQYAEVDADMALSWLQEKNCSTLIHGHTHRPNVHELAQGARRYVLSDWDFEQNPPRADVLRLNCQTGEMVRL 774
            M A+   AE+ A P W+ VD ISD+HL++ +P T+ AW  +L+ + ADA+ +LGD+FEVWVGDD  +  GE   F   C   L   A++ PV+ MHGNRDFL+   FA    + +L DP VLV H  R+LLSHGD LC++D  Y+ FRAQ R P WQ A LA+PL ER A A  MR  S +++ N S+ +A+VD   A  WL++ N   L+HGHTHRP  H+L  G RR VLSDWD   +PPRA +L L+    + V L
Sbjct:    3 MAANPAFAELVAPPGWRTVDLISDLHLQAGEPATFEAWRGYLQTTPADALFILGDLFEVWVGDDSAAQPGEPATFEAQCAELLRRTAQRLPVFFMHGNRDFLVGPAFATQCNITLLDDPTVLVLHGQRWLLSHGDILCLEDTEYLKFRAQVRTPGWQAAFLARPLEERRALARSMRVQSEDRKRNPSMIWADVDTPAARDWLRQANAHALVHGHTHRPADHDLGDGLRRIVLSDWDAAAHPPRAQLLCLSPAGAQRVDL 261          
BLAST of UDP-2,3-diacylglucosamine hydrolase vs. TrEMBL
Match: A0A1I7GU32 (UDP-2,3-diacylglucosamine hydrolase OS=Acidovorax caeni OX=343013 GN=lpxH PE=3 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 3.000e-80
Identity = 128/252 (50.79%), Postives = 161/252 (63.89%), Query Frame = 1
Query:   25 EIAAKPQWQLVDFISDIHLRSNDPTTYAAWCDFLKKSKADAVVLLGDIFEVWVGDDLVSFEGEEGAFAKDCLAALSERAKQTPVYVMHGNRDFLMRACFARDAQVQMLHDPCVLVTHAGRFLLSHGDDLCVDDKAYMAFRAQARNPLWQEAVLAKPLAERMAQALKMREASREQQSNSLQYAEVDADMALSWLQEKNCSTLIHGHTHRPNVHELAQGARRYVLSDWDFEQNPPRADVLRLNCQTGEMVRLSP 780
            E+ A P W+ VDF+SD+HL      T  A   +L  + ADA+ LLGD+FEVWVGDD ++   E G+F   C A L++ A+Q  +Y +HGNRDFL+   FAR + V +L DP VL     R+LLSHGD LC+DD  Y  FRA AR+P WQ A LA PLA+R AQA  MR  S   +  S  YA+VD   AL+WLQ  +   LIHGHTHRP  H LA G  R+VLSDWD +  PPRA+VLRL  +  E + L+P
Sbjct:   10 ELTAAPAWRTVDFLSDLHLDPGHEATVQALAGYLAHTPADAIFLLGDLFEVWVGDDALA---EPGSFESRCCALLAQAARQHALYFLHGNRDFLIGEGFARASGVALLPDPTVLAFAGQRWLLSHGDALCLDDVEYQRFRALARSPAWQHAFLAAPLAQRRAQARSMRAQSEAHKHASSWYADVDHPAALAWLQAASAQALIHGHTHRPATHVLAPGQLRHVLSDWDLDATPPRAEVLRLTAKGLERLPLAP 258          
BLAST of UDP-2,3-diacylglucosamine hydrolase vs. TrEMBL
Match: A0A286B079 (UDP-2,3-diacylglucosamine hydrolase OS=Variovorax sp. YR752 OX=1884383 GN=lpxH PE=3 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 1.086e-79
Identity = 125/258 (48.45%), Postives = 165/258 (63.95%), Query Frame = 1
Query:    4 NASFFTAEIAAKPQWQLVDFISDIHLRSNDPTTYAAWCDFLKKSKADAVVLLGDIFEVWVGDDLVSFEGEEGAFAKDCLAALSERAKQTPVYVMHGNRDFLMRACFARDAQVQMLHDPCVLVTHAGRFLLSHGDDLCVDDKAYMAFRAQARNPLWQEAVLAKPLAERMAQALKMREASREQQSN-SLQYAEVDADMALSWLQEKNCSTLIHGHTHRPNVHELAQGARRYVLSDWDFEQNPPRADVLRLNCQTGEMVRL 774
            N +F   E+ A P W+ VD ISD+HL++ +P T+ AW  +L+ + ADA+++LGD+FEVWVGDD  +  G    F   C   L   A++ PV+ MHGNRDFL+   FA    + +L DP VLV H  R+LLSHGD LC++D  Y+ FRAQ R P WQ A LA+PL ER A A  MR  S +++ N S  +A+VD   A  WLQ+ N STL+HGHTHRP  H++  G RR VLSDWD   +PPRA +L L+    + V L
Sbjct:    6 NPAF--TELVAPPAWRTVDLISDLHLQAGEPATFEAWQGYLQTTPADALIILGDLFEVWVGDDSATLPG----FEAQCADLLRRTAQRLPVFFMHGNRDFLVGPAFATQCGLTLLDDPTVLVMHGQRWLLSHGDILCLEDTEYLKFRAQVRTPEWQAAFLARPLEERRALARSMRVQSEDRKRNPSTVWADVDTAAAREWLQQANASTLVHGHTHRPADHDMGNGLRRVVLSDWDAAAHPPRAQLLCLSTAGAQRVDL 257          
BLAST of UDP-2,3-diacylglucosamine hydrolase vs. TrEMBL
Match: A0A1E4LV77 (UDP-2,3-diacylglucosamine hydrolase OS=Comamonadaceae bacterium SCN 68-20 OX=1660161 GN=lpxH PE=3 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 1.224e-79
Identity = 125/252 (49.60%), Postives = 164/252 (65.08%), Query Frame = 1
Query:   25 EIAAKPQWQLVDFISDIHLRSNDPTTYAAWCDFLKKSKADAVVLLGDIFEVWVGDDLVSFEGEEGAFAKDCLAALSERAKQTPVYVMHGNRDFLMRACFARDAQVQMLHDPCVLVTHAGRFLLSHGDDLCVDDKAYMAFRAQARNPLWQEAVLAKPLAERMAQALKMREASREQQSNSLQYAEVDADMALSWLQEKNCSTLIHGHTHRPNVHELAQGARRYVLSDWDFEQNPPRADVLRLNCQTGEMVRLSP 780
            E++A P W+ VDF+SD+HL      T  A   +L ++ ADA+ LLGD+FEVWVGDD ++   + G+F   C A L++ A+Q  +Y +HGNRDFL+   FAR +   +L DP VL     R+LLSHGD LC+DD  Y  FR  AR+P WQ++ LA PLA+R AQA  MR  S  ++ +S  YA+VD   AL+WLQ  N   LIHGHTHRP  H LA G  R+VLSDWD +  PPRA+VLRL  +  E + L+P
Sbjct:   10 ELSAAPAWRTVDFLSDLHLDPGHEATVQALAGYLARTHADAIFLLGDLFEVWVGDDALA---DPGSFESRCCALLAQAARQHALYFLHGNRDFLIGEGFARASGAALLPDPTVLAFAGQRWLLSHGDALCLDDAEYQRFRVLARSPAWQQSFLAVPLAQRRAQARGMRAQSEARKHSSAWYADVDHPAALAWLQAANARALIHGHTHRPATHVLAPGLLRHVLSDWDLDATPPRAEVLRLTAEGLERLPLAP 258          
The following BLAST results are available for this feature:
BLAST of UDP-2,3-diacylglucosamine hydrolase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UDP-2,3-diacylglucosamine hydrolase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UDP-2,3-diacylglucosamine hydrolase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UDP-2,3-diacylglucosamine hydrolase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UDP-2,3-diacylglucosamine hydrolase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UDP-2,3-diacylglucosamine hydrolase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UDP-2,3-diacylglucosamine hydrolase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7NT75|LPXH_CHRVO2.120e-5243.64UDP-2,3-diacylglucosamine hydrolase OS=Chromobacte... [more]
sp|B2FQP4|LPXH_STRMK2.198e-4841.53UDP-2,3-diacylglucosamine hydrolase OS=Stenotropho... [more]
sp|C1D6W3|LPXH_LARHH9.420e-4842.08UDP-2,3-diacylglucosamine hydrolase OS=Laribacter ... [more]
sp|B4SLL1|LPXH_STRM51.937e-4740.08UDP-2,3-diacylglucosamine hydrolase OS=Stenotropho... [more]
sp|Q1QVV3|LPXH_CHRSD5.674e-4741.59UDP-2,3-diacylglucosamine hydrolase OS=Chromohalob... [more]
back to top
BLAST of UDP-2,3-diacylglucosamine hydrolase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A353Y6D48.693e-8351.00UDP-2,3-diacylglucosamine hydrolase OS=Curvibacter... [more]
A0A4R1ZKG32.233e-8048.26UDP-2,3-diacylglucosamine hydrolase OS=Variovorax ... [more]
A0A1I7GU323.000e-8050.79UDP-2,3-diacylglucosamine hydrolase OS=Acidovorax ... [more]
A0A286B0791.086e-7948.45UDP-2,3-diacylglucosamine hydrolase OS=Variovorax ... [more]
A0A1E4LV771.224e-7949.60UDP-2,3-diacylglucosamine hydrolase OS=Comamonadac... [more]
back to top
BLAST of UDP-2,3-diacylglucosamine hydrolase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UDP-2,3-diacylglucosamine hydrolase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UDP-2,3-diacylglucosamine hydrolase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UDP-2,3-diacylglucosamine hydrolase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UDP-2,3-diacylglucosamine hydrolase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UDP-2,3-diacylglucosamine hydrolase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032470 ID=SMED30032470|Name=UDP-2,3-diacylglucosamine hydrolase|organism=Schmidtea mediterranea sexual|type=transcript|length=792bp
ATGAATGCTTCTTTTTTTACTGCTGAAATCGCCGCTAAGCCACAGTGGCA
GTTGGTTGACTTTATTTCTGACATTCATTTGCGTTCAAATGATCCTACCA
CTTATGCTGCTTGGTGCGATTTTTTAAAGAAAAGCAAGGCCGATGCTGTG
GTGTTGCTGGGTGATATTTTTGAGGTGTGGGTGGGTGACGATTTGGTGTC
GTTTGAAGGCGAGGAAGGGGCGTTTGCCAAAGATTGTTTGGCTGCATTAT
CAGAGCGGGCTAAGCAAACGCCAGTTTATGTGATGCACGGTAATCGCGAT
TTTTTAATGCGCGCTTGTTTTGCTCGTGATGCCCAGGTACAAATGCTGCA
TGATCCTTGTGTTTTGGTGACGCATGCTGGGCGGTTTTTGCTATCGCATG
GTGATGATCTCTGTGTGGACGACAAAGCGTACATGGCATTTCGAGCGCAA
GCACGCAACCCCTTGTGGCAAGAGGCGGTGTTGGCTAAACCGTTGGCTGA
ACGCATGGCTCAAGCCTTGAAAATGAGAGAAGCCAGCCGCGAGCAGCAGT
CAAACAGCTTGCAGTATGCGGAAGTTGATGCTGATATGGCGCTGTCTTGG
CTTCAAGAAAAAAATTGCAGCACCCTCATTCATGGGCACACGCATCGCCC
GAATGTGCATGAATTGGCACAAGGCGCTAGGCGCTACGTGCTCAGCGATT
GGGATTTTGAACAAAACCCACCTCGTGCGGATGTGCTGCGACTCAATTGT
CAAACGGGTGAAATGGTGCGTTTGTCACCGCATCAAGCCTAA
back to top

protein sequence of SMED30032470-orf-1

>SMED30032470-orf-1 ID=SMED30032470-orf-1|Name=SMED30032470-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=264bp
MNASFFTAEIAAKPQWQLVDFISDIHLRSNDPTTYAAWCDFLKKSKADAV
VLLGDIFEVWVGDDLVSFEGEEGAFAKDCLAALSERAKQTPVYVMHGNRD
FLMRACFARDAQVQMLHDPCVLVTHAGRFLLSHGDDLCVDDKAYMAFRAQ
ARNPLWQEAVLAKPLAERMAQALKMREASREQQSNSLQYAEVDADMALSW
LQEKNCSTLIHGHTHRPNVHELAQGARRYVLSDWDFEQNPPRADVLRLNC
QTGEMVRLSPHQA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0019897extrinsic component of plasma membrane
GO:0005737cytoplasm
Vocabulary: molecular function
TermDefinition
GO:0008758UDP-2,3-diacylglucosamine hydrolase activity
GO:0030145manganese ion binding
GO:0046872metal ion binding
GO:0016787hydrolase activity
GO:0016462pyrophosphatase activity
GO:0016818hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
Vocabulary: INTERPRO
TermDefinition
IPR029052Metallo-depent_PP-like
IPR004843Calcineurin-like_PHP_ApaH
Vocabulary: biological process
TermDefinition
GO:0006629lipid metabolic process
GO:0009245lipid A biosynthetic process