Serine/threonine-protein phosphatase

Overview
NameSerine/threonine-protein phosphatase
Smed IDSMED30032458
Length (bp)1277
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein phosphatase (SMED30032458) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase (SMED30032458) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032458

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30032458SMESG000015140.1 Contig43113newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30032458SMESG000015140.1 Contig43113uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testis primordiumSMED30032458SMESG000015140.1 PL06004B1H03_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP3CA (protein phosphatase 3 catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:9314])

HSP 1 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 266/388 (68.56%), Postives = 327/388 (84.28%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKDINARTNQISSLKSPKNIKSPSSQITSNKSVQSQV 1166
            SIE VLYLWALK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++YDACMD+FDCLPL+AL+NQQFLCVHGGLSP+ + L+DIR+LDRFKEPPA+GPMCDILWSDP+EDFG E++ E+FTHNTVRGCSYFYSY A+C FLQ+ NLL ++RAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VLNIC+D+E L  ++D       A RKE+I+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G+LP GVL+ G+++L SAI G + ++ I SF++ K LD +NERMPP++D       ++S+   K + S ++   SN S  S +
Sbjct:  126 SIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDE-LGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSIN--KALTSETNGTDSNGSNSSNI 510          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP3CB (protein phosphatase 3 catalytic subunit beta [Source:HGNC Symbol;Acc:HGNC:9315])

HSP 1 Score: 580.482 bits (1495), Expect = 0.000e+0
Identity = 260/354 (73.45%), Postives = 310/354 (87.57%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKD 1064
            SIE VLYLW LK  +P+TL LLRGNHECRHLTEYFTFKQECKIKY++++Y+ACM++FD LPL+AL+NQQFLCVHGGLSP+ H L+DIRRLDRFKEPPAFGPMCD+LWSDP EDFG E+S E+F+HNTVRGCSYFY+Y A+C FLQN NLL +IRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VL+IC+D+EL+ + +D       A RKEII+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G+LP GVL  GR++L SAI G +  + I SF++ K LD +NERMPP+KD
Sbjct:  135 SIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGSAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSAIRGFSPPHRICSFEEAKGLDRINERMPPRKD 488          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP3CA (protein phosphatase 3 catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:9314])

HSP 1 Score: 578.556 bits (1490), Expect = 0.000e+0
Identity = 266/398 (66.83%), Postives = 327/398 (82.16%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNS----------AITGLTSRNVIGSFDDVKMLDLVNERMPPKKDINARTNQISSLKSPKNIKSPSSQITSNKSVQSQV 1166
            SIE VLYLWALK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++YDACMD+FDCLPL+AL+NQQFLCVHGGLSP+ + L+DIR+LDRFKEPPA+GPMCDILWSDP+EDFG E++ E+FTHNTVRGCSYFYSY A+C FLQ+ NLL ++RAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VLNIC+D+E L  ++D       A RKE+I+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G+LP GVL+ G+++L S          AI G + ++ I SF++ K LD +NERMPP++D       ++S+   K + S ++   SN S  S +
Sbjct:  126 SIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDE-LGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSIN--KALTSETNGTDSNGSNSSNI 520          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP3CA (protein phosphatase 3 catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:9314])

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 266/398 (66.83%), Postives = 327/398 (82.16%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNS----------AITGLTSRNVIGSFDDVKMLDLVNERMPPKKDINARTNQISSLKSPKNIKSPSSQITSNKSVQSQV 1166
            SIE VLYLWALK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++YDACMD+FDCLPL+AL+NQQFLCVHGGLSP+ + L+DIR+LDRFKEPPA+GPMCDILWSDP+EDFG E++ E+FTHNTVRGCSYFYSY A+C FLQ+ NLL ++RAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VLNIC+D+E L  ++D       A RKE+I+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G+LP GVL+ G+++L S          AI G + ++ I SF++ K LD +NERMPP++D       ++S+   K + S ++   SN S  S +
Sbjct:   28 SIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDE-LGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSIN--KALTSETNGTDSNGSNSSNI 422          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP3CB (protein phosphatase 3 catalytic subunit beta [Source:HGNC Symbol;Acc:HGNC:9315])

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 260/364 (71.43%), Postives = 310/364 (85.16%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNS----------AITGLTSRNVIGSFDDVKMLDLVNERMPPKKD 1064
            SIE VLYLW LK  +P+TL LLRGNHECRHLTEYFTFKQECKIKY++++Y+ACM++FD LPL+AL+NQQFLCVHGGLSP+ H L+DIRRLDRFKEPPAFGPMCD+LWSDP EDFG E+S E+F+HNTVRGCSYFY+Y A+C FLQN NLL +IRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VL+IC+D+EL+ + +D       A RKEII+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G+LP GVL  GR++L S          AI G +  + I SF++ K LD +NERMPP+KD
Sbjct:  135 SIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGSAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKD 498          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: tax-6 (Serine/threonine-protein phosphatase 2B catalytic subunit [Source:UniProtKB/Swiss-Prot;Acc:Q0G819])

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 262/381 (68.77%), Postives = 314/381 (82.41%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLN--SAITGLTSRNVIGSFDDVKMLDLVNERMPPKKDINARTNQISSLKSPKNIKSPSSQIT 1139
            SIE VLYLWALK  +PTTL LLRGNHECRHLTEYFTFKQECKIKY++++YD CM+SFD LPL+AL+NQQFLCVHGGLSP+ H LEDIRR+DRFKEPPAFGPMCD+LWSDP+EDFG ER++E F+HN+VRGCSYFYSY+A C+FLQ+ NLL +IRAHEAQD+GYRMYR++QATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ +LNIC+D+EL+ +  D       + RKE+I++KIRAIGKM+R FS+LREESE++L LKGLTP+G LP+G L  G   +   +A +G  S ++I SF++ + LD +NERMPP       T      +SP     PS Q T
Sbjct:  151 SIECVLYLWALKICYPTTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDVCMESFDALPLAALMNQQFLCVHGGLSPEIHTLEDIRRIDRFKEPPAFGPMCDLLWSDPLEDFGNERNSEQFSHNSVRGCSYFYSYAACCDFLQHNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVHILNICSDDELMAECDDTFEGGVGSARKEVIRHKIRAIGKMARAFSVLREESESVLALKGLTPTGALPMGTLQGGSRGVREVAAESGCDSGHLIQSFEEARRLDKINERMPP-------TMATPPAQSPSQSPIPSRQTT 524          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: tax-6 (Serine/threonine-protein phosphatase 2B catalytic subunit [Source:UniProtKB/Swiss-Prot;Acc:Q0G819])

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 262/388 (67.53%), Postives = 312/388 (80.41%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAI---------TGLTSRNVIGSFDDVKMLDLVNERMPPKKDINARTNQISSLKSPKNIKSPSSQIT 1139
            SIE VLYLWALK  +PTTL LLRGNHECRHLTEYFTFKQECKIKY++++YD CM+SFD LPL+AL+NQQFLCVHGGLSP+ H LEDIRR+DRFKEPPAFGPMCD+LWSDP+EDFG ER++E F+HN+VRGCSYFYSY+A C+FLQ+ NLL +IRAHEAQD+GYRMYR++QATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ +LNIC+D+EL+ +  D       + RKE+I++KIRAIGKM+R FS+LR ESE++L LKGL   G LP G L+ GR  LN+A          +G  S ++I SF++ + LD +NERMPP       T      +SP     PS Q T
Sbjct:  151 SIECVLYLWALKICYPTTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDVCMESFDALPLAALMNQQFLCVHGGLSPEIHTLEDIRRIDRFKEPPAFGPMCDLLWSDPLEDFGNERNSEQFSHNSVRGCSYFYSYAACCDFLQHNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVHILNICSDDELMAECDDTFEGGVGSARKEVIRHKIRAIGKMARAFSVLRHESESVLQLKGLNAGGKLPQGALSEGRTGLNAAYRIEQSVAAESGCDSGHLIQSFEEARRLDKINERMPP-------TMATPPAQSPSQSPIPSRQTT 531          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: tax-6 (Serine/threonine-protein phosphatase 2B catalytic subunit [Source:UniProtKB/Swiss-Prot;Acc:Q0G819])

HSP 1 Score: 560.066 bits (1442), Expect = 0.000e+0
Identity = 262/391 (67.01%), Postives = 312/391 (79.80%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKD---AVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAI---------TGLTSRNVIGSFDDVKMLDLVNERMPPKKDINARTNQISSLKSPKNIKSPSSQIT 1139
            SIE VLYLWALK  +PTTL LLRGNHECRHLTEYFTFKQECKIKY++++YD CM+SFD LPL+AL+NQQFLCVHGGLSP+ H LEDIRR+DRFKEPPAFGPMCD+LWSDP+EDFG ER++E F+HN+VRGCSYFYSY+A C+FLQ+ NLL +IRAHEAQD+GYRMYR++QATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ +LNIC+D+EL+ +  D          + RKE+I++KIRAIGKM+R FS+LR ESE++L LKGL   G LP G L+ GR  LN+A          +G  S ++I SF++ + LD +NERMPP       T      +SP     PS Q T
Sbjct:  151 SIECVLYLWALKICYPTTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDVCMESFDALPLAALMNQQFLCVHGGLSPEIHTLEDIRRIDRFKEPPAFGPMCDLLWSDPLEDFGNERNSEQFSHNSVRGCSYFYSYAACCDFLQHNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVHILNICSDDELMAECDDTFEGADGGVGSARKEVIRHKIRAIGKMARAFSVLRHESESVLQLKGLNAGGKLPQGALSEGRTGLNAAYRIEQSVAAESGCDSGHLIQSFEEARRLDKINERMPP-------TMATPPAQSPSQSPIPSRQTT 534          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: gsp-2 (Serine/threonine-protein phosphatase PP1-beta [Source:UniProtKB/Swiss-Prot;Acc:P48727])

HSP 1 Score: 155.606 bits (392), Expect = 1.274e-43
Identity = 74/204 (36.27%), Postives = 116/204 (56.86%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVM 614
            S+E +  L A K ++P    LLRGNHEC  +   + F  ECK +YN K++    D F+CLP++A+I+++  C HGGLSPD  ++E IRR+ R  + P  G +CD+LWSDP +D      N+       RG S+ +    +  FL   +L  + RAH+  + GY  + + Q      L+T+FSAPNY   ++N  +++  +  +M
Sbjct:   99 SLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVTGWGEND-------RGVSFTFGPEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQ------LVTLFSAPNYCGEFDNAGSMMTVDETLM 289          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: gsp-1 (Serine/threonine-protein phosphatase PP1-alpha [Source:UniProtKB/Swiss-Prot;Acc:Q27497])

HSP 1 Score: 155.606 bits (392), Expect = 1.383e-43
Identity = 74/204 (36.27%), Postives = 115/204 (56.37%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVM 614
            S+E +  L A K ++P    LLRGNHEC  +   + F  ECK +++ K++    D F+CLP++ALI+++  C HGGLSPD  N+E IRR+ R  + P  G +CD+LWSDP +D      N+       RG S+ +    +  FL   +L  + RAH+  + GY  + + Q      L+T+FSAPNY   ++N   ++  +  +M
Sbjct:  100 SLETICLLLAYKVKYPENFFLLRGNHECASINRIYGFYDECKRRFSIKLWKTFTDCFNCLPIAALIDEKIFCCHGGLSPDLQNMEQIRRVMRPTDVPDTGLLCDLLWSDPDKDVTGWGEND-------RGVSFTFGPDVVAKFLNRHDLDLICRAHQVVEDGYEFFAKRQ------LVTLFSAPNYCGEFDNAGGMMSVDETLM 290          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: Pp2B-14D (gene:FBgn0011826 transcript:FBtr0305593)

HSP 1 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 259/355 (72.96%), Postives = 315/355 (88.73%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVIS-KKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKD 1064
            SIE VLYLW+LK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++YDACMD+FDCLPL+AL+NQQFLCVHGGLSP+ H LEDIRRLDRFKEPPAFGPMCD+LWSDP+EDFG E++++ +THN+VRGCSYFYSY+A C+FLQN NLL +IRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VLNIC+D+EL+ ++ +  +S  + A RKE+I+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G LP+G L+ G++SL +A+ G +  + I SF + K LD VNERMPP++D
Sbjct:  192 SIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMTEESEEPLSDDEAALRKEVIRNKIRAIGKMARVFSVLREESESVLQLKGLTPTGALPLGALSGGKQSLKNAMQGFSPNHKITSFAEAKGLDAVNERMPPRRD 546          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: Pp2B-14D (gene:FBgn0011826 transcript:FBtr0309793)

HSP 1 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 259/355 (72.96%), Postives = 315/355 (88.73%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVIS-KKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKD 1064
            SIE VLYLW+LK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++YDACMD+FDCLPL+AL+NQQFLCVHGGLSP+ H LEDIRRLDRFKEPPAFGPMCD+LWSDP+EDFG E++++ +THN+VRGCSYFYSY+A C+FLQN NLL +IRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VLNIC+D+EL+ ++ +  +S  + A RKE+I+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G LP+G L+ G++SL +A+ G +  + I SF + K LD VNERMPP++D
Sbjct:  192 SIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMTEESEEPLSDDEAALRKEVIRNKIRAIGKMARVFSVLREESESVLQLKGLTPTGALPLGALSGGKQSLKNAMQGFSPNHKITSFAEAKGLDAVNERMPPRRD 546          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: Pp2B-14D (gene:FBgn0011826 transcript:FBtr0074294)

HSP 1 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 259/355 (72.96%), Postives = 315/355 (88.73%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVIS-KKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKD 1064
            SIE VLYLW+LK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++YDACMD+FDCLPL+AL+NQQFLCVHGGLSP+ H LEDIRRLDRFKEPPAFGPMCD+LWSDP+EDFG E++++ +THN+VRGCSYFYSY+A C+FLQN NLL +IRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VLNIC+D+EL+ ++ +  +S  + A RKE+I+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G LP+G L+ G++SL +A+ G +  + I SF + K LD VNERMPP++D
Sbjct:  192 SIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMTEESEEPLSDDEAALRKEVIRNKIRAIGKMARVFSVLREESESVLQLKGLTPTGALPLGALSGGKQSLKNAMQGFSPNHKITSFAEAKGLDAVNERMPPRRD 546          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: CanA-14F (gene:FBgn0267912 transcript:FBtr0305198)

HSP 1 Score: 583.563 bits (1503), Expect = 0.000e+0
Identity = 259/355 (72.96%), Postives = 315/355 (88.73%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVIS-KKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKD 1064
            SIE VLYLW+LK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++YDACMD+FDCLPL+AL+NQQFLCVHGGLSP+ H LEDIRRLDRFKEPPAFGPMCD+LWSDP+EDFG E++++ +THN+VRGCSYFYSY+A C+FLQN NLL +IRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VLNIC+D+EL+ ++ +  +S  + A RKE+I+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G LP+G L+ G++SL +A+ G +  + I SF + K LD VNERMPP++D
Sbjct:  200 SIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMTEESEEPLSDDEAALRKEVIRNKIRAIGKMARVFSVLREESESVLQLKGLTPTGALPLGALSGGKQSLKNAMQGFSPNHKITSFAEAKGLDAVNERMPPRRD 554          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: CanA-14F (gene:FBgn0267912 transcript:FBtr0074292)

HSP 1 Score: 583.563 bits (1503), Expect = 0.000e+0
Identity = 259/355 (72.96%), Postives = 315/355 (88.73%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVIS-KKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKD 1064
            SIE VLYLW+LK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++YDACMD+FDCLPL+AL+NQQFLCVHGGLSP+ H LEDIRRLDRFKEPPAFGPMCD+LWSDP+EDFG E++++ +THN+VRGCSYFYSY+A C+FLQN NLL +IRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VLNIC+D+EL+ ++ +  +S  + A RKE+I+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G LP+G L+ G++SL +A+ G +  + I SF + K LD VNERMPP++D
Sbjct:  200 SIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMTEESEEPLSDDEAALRKEVIRNKIRAIGKMARVFSVLREESESVLQLKGLTPTGALPLGALSGGKQSLKNAMQGFSPNHKITSFAEAKGLDAVNERMPPRRD 554          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp3ca (protein phosphatase 3, catalytic subunit, alpha isozyme [Source:ZFIN;Acc:ZDB-GENE-091113-24])

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 256/354 (72.32%), Postives = 310/354 (87.57%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKD 1064
            SIE VLYLW+LK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++YD+CMD+FDCLPL+AL+NQQFLCVHGGLSP+   L+DI++LDRFKEPPAFGPMCD+LWSDP+EDFG E+S E F+HNTVRGCSYFYSY A+C+FLQN NLL +IRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VL+IC+D+EL+    +   +   A RKE+I+ KIRAIGKM+++FS+LREESE +L LKGLTP+G+LP GVL  G+++L SAI G + ++ I SF++ K LD +NERMPP+KD
Sbjct:  125 SIECVLYLWSLKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSEQVYDSCMDAFDCLPLAALMNQQFLCVHGGLSPEIQTLDDIKKLDRFKEPPAFGPMCDLLWSDPLEDFGNEKSQEYFSHNTVRGCSYFYSYPAVCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMNDGDEIFDANAAAARKEVIRNKIRAIGKMAKMFSVLREESENVLTLKGLTPTGMLPSGVLAGGKQTLQSAIRGFSPQHKISSFEEAKGLDRINERMPPRKD 478          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp3ccb (protein phosphatase 3, catalytic subunit, gamma isozyme, b [Source:ZFIN;Acc:ZDB-GENE-070112-1102])

HSP 1 Score: 577.015 bits (1486), Expect = 0.000e+0
Identity = 262/380 (68.95%), Postives = 318/380 (83.68%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNS---------AITGLTSRNVIGSFDDVKMLDLVNERMPPKKDI---NARTNQISSLKSP 1106
            SIE VLYLWALK  HPTTL LLRGNHECRHLTEYFTFKQECKIKY +++YDACM++FDCLPL+AL+NQQFLCVHGGLSP+   L+DIR+LDRFKEPPAFGPMCD+LWSDP ED+G E+++E+F HN+VRGCSYFYSY A+C+FL N NLL VIRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VLNIC+D+EL+ +  D       A RKE+I+ KIRAIGKM+R+FS+LREE+E++L LKGLTP+G+LP+GVL+ GR++L S         AI G   ++ I SF++ + LD +NERMPP++D    +   N I++  SP
Sbjct:  129 SIECVLYLWALKINHPTTLFLLRGNHECRHLTEYFTFKQECKIKYTERVYDACMEAFDCLPLAALLNQQFLCVHGGLSPEVTCLDDIRKLDRFKEPPAFGPMCDLLWSDPGEDYGSEKTSEHFCHNSVRGCSYFYSYPAVCDFLTNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMSEGDDTCEGGTPAVRKEVIRNKIRAIGKMARVFSVLREENESVLQLKGLTPTGMLPLGVLSGGRQTLQSATVEAEEARAIQGFNPQHKIQSFEEARGLDRINERMPPRRDTKQPDGTANSINAANSP 508          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp3ccb (protein phosphatase 3, catalytic subunit, gamma isozyme, b [Source:ZFIN;Acc:ZDB-GENE-070112-1102])

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 261/380 (68.68%), Postives = 317/380 (83.42%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNS---------AITGLTSRNVIGSFDDVKMLDLVNERMPPKKDI---NARTNQISSLKSP 1106
            SIE VLYLWALK  HPTTL LLRGNHECRHLTEYFTFKQECKIKY +++YDACM++FDCLPL+AL+NQQFLCVHGGLSP+   L+DIR+LDRFKEPPAFGPMCD+LWSDP ED+G E+++E+F HN+VRGCSYFYSY A+C+FL N NLL VIRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VLNIC+D+EL+ +  D         RKE+I+ KIRAIGKM+R+FS+LREE+E++L LKGLTP+G+LP+GVL+ GR++L S         AI G   ++ I SF++ + LD +NERMPP++D    +   N I++  SP
Sbjct:  123 SIECVLYLWALKINHPTTLFLLRGNHECRHLTEYFTFKQECKIKYTERVYDACMEAFDCLPLAALLNQQFLCVHGGLSPEVTCLDDIRKLDRFKEPPAFGPMCDLLWSDPGEDYGSEKTSEHFCHNSVRGCSYFYSYPAVCDFLTNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMSEGDDT-----CEVRKEVIRNKIRAIGKMARVFSVLREENESVLQLKGLTPTGMLPLGVLSGGRQTLQSATVEAEEARAIQGFNPQHKIQSFEEARGLDRINERMPPRRDTKQPDGTANSINAANSP 497          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp3cb (protein phosphatase 3, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-050417-406])

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 257/371 (69.27%), Postives = 311/371 (83.83%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNS----------------AITGLTSRNVIGSFDDVKMLDLVNERMPPKKDI 1067
            SIE VLYLW+LK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++YDACMD+FDCLPL+AL+NQQFLCVHGGLSP+ H L+DI+RLDRFKEPPAFGPMCD+LWSDP+EDFG E+S + F+HNTVRGCSYFYSY A+C FLQ  NLL VIRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VL+IC+D+EL+    +   +   A RKE+I+ KIRAIGKM+++FS+LREESE +L LKGLTP+G+LP GVL+ G+++L S                AI G + ++ I SF++ K LD +NERMPP++D+
Sbjct:  115 SIECVLYLWSLKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSEQVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHTLDDIKRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKSQDYFSHNTVRGCSYFYSYPAVCEFLQTNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMNDGDEIFDANAAAARKEVIRNKIRAIGKMAKMFSVLREESENVLTLKGLTPTGMLPSGVLSGGKQTLQSATIEAIEAVEEVKDGEAIRGFSPQHKITSFEEAKGLDRINERMPPRRDV 485          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp3cca (protein phosphatase 3, catalytic subunit, gamma isozyme, a [Source:ZFIN;Acc:ZDB-GENE-030829-36])

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 251/354 (70.90%), Postives = 309/354 (87.29%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKD 1064
            SIE VL+LW LK  HP TL LLRGNHECRHLTEYFTFKQECKIKY++++YDACM++FDCLPL+AL+NQQFLCVHGGLSP+ + L+DIR+LDRFKEPPAFGPMCD++W+DP ED+G E++ E+F HN+VRGCSYF+SY+A+C+FL N NLL VIRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VLNIC+D+EL+ +  D       A RKE+I+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G LP+GVL+ G+++L +AI G +    I +F++ + LD +NERMPP+KD
Sbjct:  124 SIECVLFLWTLKINHPNTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMEAFDCLPLAALLNQQFLCVHGGLSPEINCLDDIRKLDRFKEPPAFGPMCDLIWADPGEDYGSEKTAEHFNHNSVRGCSYFFSYAAVCDFLTNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMSEGDDLCEGGAPAVRKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGTLPLGVLSGGKQTLQNAIQGFSPTRKIRNFEEARGLDRINERMPPRKD 477          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: mrps31 (mitochondrial ribosomal protein S31 [Source:Xenbase;Acc:XB-GENE-988773])

HSP 1 Score: 587.415 bits (1513), Expect = 0.000e+0
Identity = 269/385 (69.87%), Postives = 323/385 (83.90%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKDINARTNQISSLKSPKNIKSPSSQITSNKSVQ 1157
            SIE VLYLW LK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++Y+ACM++FDCLPL+AL+NQQFLCVHGGLSP+ H L+DI+RLDRFKEPPAFGPMCD+LWSDP EDFG E+S E+F+HNTVRGCSYFYSY A+C FLQN NLL +IRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VL+IC+D+EL+ + +D       A RKEII+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G+LP GVL  GR++L SAI G + ++ I SF++ K LD +NERMPP+KD    T Q   + S  N  +  +  T N +VQ
Sbjct:  123 SIECVLYLWVLKILYPNTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYEACMEAFDCLPLAALLNQQFLCVHGGLSPEIHTLDDIKRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGTAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSAIRGFSPQHKICSFEEAKGLDRINERMPPRKD----TRQQDGINS-VNTNAKENNGTGNNNVQ 502          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: rai1 (retinoic acid induced 1 [Source:Xenbase;Acc:XB-GENE-987626])

HSP 1 Score: 587.03 bits (1512), Expect = 0.000e+0
Identity = 267/388 (68.81%), Postives = 329/388 (84.79%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKDINARTNQISSLKSPKNIKSPSSQITSNKSVQSQV 1166
            SIE VLYLWALK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++YDACMD+FDCLPL+AL+NQQFLCVHGGLSP+ + L+DIR+LDRFKEPPA+GPMCDILWSDP+ED+G E+S E+FTHNTVRGCSYFYSY A+C FLQ+ NLL ++RAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VL+IC+D+EL+  ++DA      A RKE+I+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G+LP GVL+ G+++L SAI G + ++ I SF++ K LD +NERMPP++D       ++S+   K I S ++   SN S  S +
Sbjct:  126 SIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDYGNEKSQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELVS-EEDACDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSIN--KAISSETNGTDSNGSNSSNI 510          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: rai1 (retinoic acid induced 1 [Source:Xenbase;Acc:XB-GENE-987626])

HSP 1 Score: 586.645 bits (1511), Expect = 0.000e+0
Identity = 267/388 (68.81%), Postives = 329/388 (84.79%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKDINARTNQISSLKSPKNIKSPSSQITSNKSVQSQV 1166
            SIE VLYLWALK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++YDACMD+FDCLPL+AL+NQQFLCVHGGLSP+ + L+DIR+LDRFKEPPA+GPMCDILWSDP+ED+G E+S E+FTHNTVRGCSYFYSY A+C FLQ+ NLL ++RAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VL+IC+D+EL+  ++DA      A RKE+I+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G+LP GVL+ G+++L SAI G + ++ I SF++ K LD +NERMPP++D       ++S+   K I S ++   SN S  S +
Sbjct:  101 SIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDYGNEKSQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELVS-EEDACDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSIN--KAISSETNGTDSNGSNSSNI 485          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: rai1 (retinoic acid induced 1 [Source:Xenbase;Acc:XB-GENE-987626])

HSP 1 Score: 586.645 bits (1511), Expect = 0.000e+0
Identity = 267/388 (68.81%), Postives = 329/388 (84.79%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKDINARTNQISSLKSPKNIKSPSSQITSNKSVQSQV 1166
            SIE VLYLWALK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++YDACMD+FDCLPL+AL+NQQFLCVHGGLSP+ + L+DIR+LDRFKEPPA+GPMCDILWSDP+ED+G E+S E+FTHNTVRGCSYFYSY A+C FLQ+ NLL ++RAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VL+IC+D+EL+  ++DA      A RKE+I+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G+LP GVL+ G+++L SAI G + ++ I SF++ K LD +NERMPP++D       ++S+   K I S ++   SN S  S +
Sbjct:  107 SIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDYGNEKSQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELVS-EEDACDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSIN--KAISSETNGTDSNGSNSSNI 491          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: rai1 (retinoic acid induced 1 [Source:Xenbase;Acc:XB-GENE-987626])

HSP 1 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 267/388 (68.81%), Postives = 329/388 (84.79%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKDINARTNQISSLKSPKNIKSPSSQITSNKSVQSQV 1166
            SIE VLYLWALK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++YDACMD+FDCLPL+AL+NQQFLCVHGGLSP+ + L+DIR+LDRFKEPPA+GPMCDILWSDP+ED+G E+S E+FTHNTVRGCSYFYSY A+C FLQ+ NLL ++RAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VL+IC+D+EL+  ++DA      A RKE+I+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G+LP GVL+ G+++L SAI G + ++ I SF++ K LD +NERMPP++D       ++S+   K I S ++   SN S  S +
Sbjct:  119 SIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDYGNEKSQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELVS-EEDACDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSIN--KAISSETNGTDSNGSNSSNI 503          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp3ca (protein phosphatase 3, catalytic subunit, alpha isoform [Source:MGI Symbol;Acc:MGI:107164])

HSP 1 Score: 585.489 bits (1508), Expect = 0.000e+0
Identity = 266/388 (68.56%), Postives = 328/388 (84.54%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKDINARTNQISSLKSPKNIKSPSSQITSNKSVQSQV 1166
            SIE VLYLWALK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++YDACMD+FDCLPL+AL+NQQFLCVHGGLSP+ + L+DIR+LDRFKEPPA+GPMCDILWSDP+EDFG E++ E+FTHNTVRGCSYFYSY A+C+FLQ+ NLL ++RAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VLNIC+D+E L  ++D       A RKE+I+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G+LP GVL+ G+++L SAI G + ++ I SF++ K LD +NERMPP++D       ++S+   K + S ++   SN S  S +
Sbjct:  126 SIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDE-LGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSIN--KALASETNGTDSNGSNSSNI 510          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp3cb (protein phosphatase 3, catalytic subunit, beta isoform [Source:MGI Symbol;Acc:MGI:107163])

HSP 1 Score: 580.482 bits (1495), Expect = 0.000e+0
Identity = 266/385 (69.09%), Postives = 318/385 (82.60%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKDINARTNQISSLKSPKNIKSPSSQITSNKSVQ 1157
            SIE VLYLW LK  +P+TL LLRGNHECRHLTEYFTFKQECKIKY++++Y+ACM++FD LPL+AL+NQQFLCVHGGLSP+ H L+DIRRLDRFKEPPAFGPMCD+LWSDP EDFG E+S E+F+HNTVRGCSYFY+Y A+C FLQN NLL +IRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VL+IC+D+EL+ + +D       A RKEII+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G+LP GVL  GR++L SAI G +  + I SF++ K LD +NERMPP+KD      Q     S     +  +  T N S Q
Sbjct:  135 SIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGSAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSAIRGFSPPHRICSFEEAKGLDRINERMPPRKD----AVQQDGFNSLNTAHTTENHGTGNHSAQ 515          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp3ca (protein phosphatase 3, catalytic subunit, alpha isoform [Source:MGI Symbol;Acc:MGI:107164])

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 266/398 (66.83%), Postives = 328/398 (82.41%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNS----------AITGLTSRNVIGSFDDVKMLDLVNERMPPKKDINARTNQISSLKSPKNIKSPSSQITSNKSVQSQV 1166
            SIE VLYLWALK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++YDACMD+FDCLPL+AL+NQQFLCVHGGLSP+ + L+DIR+LDRFKEPPA+GPMCDILWSDP+EDFG E++ E+FTHNTVRGCSYFYSY A+C+FLQ+ NLL ++RAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VLNIC+D+E L  ++D       A RKE+I+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G+LP GVL+ G+++L S          AI G + ++ I SF++ K LD +NERMPP++D       ++S+   K + S ++   SN S  S +
Sbjct:  126 SIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDE-LGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSIN--KALASETNGTDSNGSNSSNI 520          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp3cb (protein phosphatase 3, catalytic subunit, beta isoform [Source:MGI Symbol;Acc:MGI:107163])

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 266/395 (67.34%), Postives = 318/395 (80.51%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNS----------AITGLTSRNVIGSFDDVKMLDLVNERMPPKKDINARTNQISSLKSPKNIKSPSSQITSNKSVQ 1157
            SIE VLYLW LK  +P+TL LLRGNHECRHLTEYFTFKQECKIKY++++Y+ACM++FD LPL+AL+NQQFLCVHGGLSP+ H L+DIRRLDRFKEPPAFGPMCD+LWSDP EDFG E+S E+F+HNTVRGCSYFY+Y A+C FLQN NLL +IRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VL+IC+D+EL+ + +D       A RKEII+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G+LP GVL  GR++L S          AI G +  + I SF++ K LD +NERMPP+KD      Q     S     +  +  T N S Q
Sbjct:  135 SIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGSAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKD----AVQQDGFNSLNTAHTTENHGTGNHSAQ 525          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp3cb (protein phosphatase 3, catalytic subunit, beta isoform [Source:MGI Symbol;Acc:MGI:107163])

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 266/395 (67.34%), Postives = 318/395 (80.51%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNS----------AITGLTSRNVIGSFDDVKMLDLVNERMPPKKDINARTNQISSLKSPKNIKSPSSQITSNKSVQ 1157
            SIE VLYLW LK  +P+TL LLRGNHECRHLTEYFTFKQECKIKY++++Y+ACM++FD LPL+AL+NQQFLCVHGGLSP+ H L+DIRRLDRFKEPPAFGPMCD+LWSDP EDFG E+S E+F+HNTVRGCSYFY+Y A+C FLQN NLL +IRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VL+IC+D+EL+ + +D       A RKEII+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G+LP GVL  GR++L S          AI G +  + I SF++ K LD +NERMPP+KD      Q     S     +  +  T N S Q
Sbjct:  135 SIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQ-FDGSAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKD----AVQQDGFNSLNTAHTTENHGTGNHSAQ 524          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|Q27889|PP2B2_DROME (Serine/threonine-protein phosphatase 2B catalytic subunit 2 OS=Drosophila melanogaster OX=7227 GN=Pp2B-14D PE=1 SV=2)

HSP 1 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 259/355 (72.96%), Postives = 315/355 (88.73%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVIS-KKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKD 1064
            SIE VLYLW+LK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++YDACMD+FDCLPL+AL+NQQFLCVHGGLSP+ H LEDIRRLDRFKEPPAFGPMCD+LWSDP+EDFG E++++ +THN+VRGCSYFYSY+A C+FLQN NLL +IRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VLNIC+D+EL+ ++ +  +S  + A RKE+I+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G LP+G L+ G++SL +A+ G +  + I SF + K LD VNERMPP++D
Sbjct:  192 SIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMTEESEEPLSDDEAALRKEVIRNKIRAIGKMARVFSVLREESESVLQLKGLTPTGALPLGALSGGKQSLKNAMQGFSPNHKITSFAEAKGLDAVNERMPPRRD 546          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|Q9VXF1|PP2B3_DROME (Serine/threonine-protein phosphatase 2B catalytic subunit 3 OS=Drosophila melanogaster OX=7227 GN=CanA-14F PE=1 SV=4)

HSP 1 Score: 583.563 bits (1503), Expect = 0.000e+0
Identity = 259/355 (72.96%), Postives = 315/355 (88.73%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVIS-KKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKD 1064
            SIE VLYLW+LK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++YDACMD+FDCLPL+AL+NQQFLCVHGGLSP+ H LEDIRRLDRFKEPPAFGPMCD+LWSDP+EDFG E++++ +THN+VRGCSYFYSY+A C+FLQN NLL +IRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VLNIC+D+EL+ ++ +  +S  + A RKE+I+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G LP+G L+ G++SL +A+ G +  + I SF + K LD VNERMPP++D
Sbjct:  200 SIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMTEESEEPLSDDEAALRKEVIRNKIRAIGKMARVFSVLREESESVLQLKGLTPTGALPLGALSGGKQSLKNAMQGFSPNHKITSFAEAKGLDAVNERMPPRRD 554          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|P63329|PP2BA_RAT (Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Rattus norvegicus OX=10116 GN=Ppp3ca PE=1 SV=1)

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 266/398 (66.83%), Postives = 328/398 (82.41%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNS----------AITGLTSRNVIGSFDDVKMLDLVNERMPPKKDINARTNQISSLKSPKNIKSPSSQITSNKSVQSQV 1166
            SIE VLYLWALK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++YDACMD+FDCLPL+AL+NQQFLCVHGGLSP+ + L+DIR+LDRFKEPPA+GPMCDILWSDP+EDFG E++ E+FTHNTVRGCSYFYSY A+C+FLQ+ NLL ++RAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VLNIC+D+E L  ++D       A RKE+I+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G+LP GVL+ G+++L S          AI G + ++ I SF++ K LD +NERMPP++D       ++S+   K + S ++   SN S  S +
Sbjct:  126 SIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDE-LGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSIN--KALASETNGTDSNGSNSSNI 520          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|P63328|PP2BA_MOUSE (Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Mus musculus OX=10090 GN=Ppp3ca PE=1 SV=1)

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 266/398 (66.83%), Postives = 328/398 (82.41%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNS----------AITGLTSRNVIGSFDDVKMLDLVNERMPPKKDINARTNQISSLKSPKNIKSPSSQITSNKSVQSQV 1166
            SIE VLYLWALK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++YDACMD+FDCLPL+AL+NQQFLCVHGGLSP+ + L+DIR+LDRFKEPPA+GPMCDILWSDP+EDFG E++ E+FTHNTVRGCSYFYSY A+C+FLQ+ NLL ++RAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VLNIC+D+E L  ++D       A RKE+I+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G+LP GVL+ G+++L S          AI G + ++ I SF++ K LD +NERMPP++D       ++S+   K + S ++   SN S  S +
Sbjct:  126 SIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDE-LGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSIN--KALASETNGTDSNGSNSSNI 520          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|Q08209|PP2BA_HUMAN (Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP3CA PE=1 SV=1)

HSP 1 Score: 578.556 bits (1490), Expect = 0.000e+0
Identity = 266/398 (66.83%), Postives = 327/398 (82.16%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNS----------AITGLTSRNVIGSFDDVKMLDLVNERMPPKKDINARTNQISSLKSPKNIKSPSSQITSNKSVQSQV 1166
            SIE VLYLWALK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++YDACMD+FDCLPL+AL+NQQFLCVHGGLSP+ + L+DIR+LDRFKEPPA+GPMCDILWSDP+EDFG E++ E+FTHNTVRGCSYFYSY A+C FLQ+ NLL ++RAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VLNIC+D+E L  ++D       A RKE+I+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G+LP GVL+ G+++L S          AI G + ++ I SF++ K LD +NERMPP++D       ++S+   K + S ++   SN S  S +
Sbjct:  126 SIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDE-LGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSIN--KALTSETNGTDSNGSNSSNI 520          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A3L8DVJ9 (Serine/threonine-protein phosphatase OS=Ooceraea biroi OX=2015173 GN=DMN91_002420 PE=3 SV=1)

HSP 1 Score: 597.43 bits (1539), Expect = 0.000e+0
Identity = 264/355 (74.37%), Postives = 314/355 (88.45%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAH-RKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKD 1064
            SIE VLYLWALK  HPTTL LLRGNHECRHLTEYFTFKQECKIKY++++YDACMD+FDCLPL+AL+NQQFLCVHGGLSP+ HNLEDIR+LDRFKEPPAFGPMCD+LWSDP+EDFG E++ E+F+HN+VRGCSYFYSY+A C+FLQN NLL +IRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VLNIC+D+EL+    DA+     A+ RKE+I+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G LP+G L+ G+ SL +A+ G +  + I SF + K LD +NERMPP+KD
Sbjct:  452 SIECVLYLWALKLCHPTTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHNLEDIRKLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNAEHFSHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMSDGDDALEEGAAANLRKEVIRNKIRAIGKMARVFSVLREESESVLQLKGLTPTGALPLGALSGGKTSLKNALQGFSPNHKITSFAEAKGLDAINERMPPRKD 806          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: V9KC08 (Serine/threonine-protein phosphatase OS=Callorhinchus milii OX=7868 PE=2 SV=1)

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 266/354 (75.14%), Postives = 315/354 (88.98%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKD 1064
            SIE VLYLW LK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++YDACM++FDCLPL+AL+NQQFLCVHGGLSP+ HNLEDI+RLDRFKEPPAFGPMCD+LWSDP EDFG E++ E+F+HNTVRGCSYFYSY AIC FLQN NLL +IRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VLNIC+D+EL+ + +DA  +   A RKEII+ KIRAIGKM+R+FS+LREESE++L+LKGLTP+G+LP GVL  GR++L SAI G + ++ I SF++ K LD +NERMPP+KD
Sbjct:  123 SIECVLYLWVLKILYPNTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMEAFDCLPLAALLNQQFLCVHGGLSPEVHNLEDIKRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKTQEHFSHNTVRGCSYFYSYPAICEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMSEGEDAFDAGTAAARKEIIRNKIRAIGKMARVFSVLREESESVLMLKGLTPTGMLPSGVLAGGRQTLQSAIRGFSPQHKICSFEEAKGLDRINERMPPRKD 476          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A088ADM2 (Serine/threonine-protein phosphatase OS=Apis mellifera OX=7460 GN=LOC411046 PE=3 SV=1)

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 262/355 (73.80%), Postives = 313/355 (88.17%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAH-RKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKD 1064
            SIE VLYLWALK  HPTTL LLRGNHECRHLTEYFTFKQECKIKY++++YDACMD+FDCLPL+AL+NQQFLCVHGGLSP+ HNLEDIR+LDRFKEPPA+GPMCD+LWSDP+EDFG E++ E+F+HN+VRGCSYFYSY+A C+FLQN NLL +IRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VLNIC+D+EL+    D +     A+ RKE+I+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G LP+G L+ G+ SL +A+ G +  + I SF + K LD +NERMPP+KD
Sbjct:  898 SIECVLYLWALKLCHPTTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHNLEDIRKLDRFKEPPAYGPMCDLLWSDPLEDFGNEKNAEHFSHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMSDGDDGLEEGAAANLRKEVIRNKIRAIGKMARVFSVLREESESVLQLKGLTPTGALPLGALSGGKTSLKNALQGFSPNHKITSFAEAKGLDAINERMPPRKD 1252          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A4S2J9X4 (Serine/threonine-protein phosphatase OS=Temnothorax longispinosus OX=300112 GN=DBV15_01193 PE=3 SV=1)

HSP 1 Score: 594.349 bits (1531), Expect = 0.000e+0
Identity = 262/355 (73.80%), Postives = 313/355 (88.17%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAH-RKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKD 1064
            SIE VLYLWALK  HPTTL LLRGNHECRHLTEYFTFKQECKIKY++++YDACMD+FDCLPL+AL+NQQFLCVHGGLSP+ HNLEDIR+LDRFKEPPAFGPMCD+LWSDP+EDFG E++ E+F+HN+VRGCSYFYSY+A C+FLQN NLL +IRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VLNIC+D+EL+    + +     A+ RKE+I+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G LP+G L+ G+ SL +A+ G +  + I SF + K LD +NERMPP+KD
Sbjct:  726 SIECVLYLWALKLCHPTTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHNLEDIRKLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNAEHFSHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMSDGDEGLEEGAAANLRKEVIRNKIRAIGKMARVFSVLREESESVLQLKGLTPTGALPLGALSGGKTSLKNALQGFSPNHKITSFAEAKGLDAINERMPPRKD 1080          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A2H8TF16 (Serine/threonine-protein phosphatase OS=Melanaphis sacchari OX=742174 GN=CanA-14F_0 PE=3 SV=1)

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 268/397 (67.51%), Postives = 330/397 (83.12%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKDINARTNQISSLKSPKNIKSPSSQITSNKSVQSQVTAAFASTSR 1193
            SIE VLYLWALK  HPTTL LLRGNHECRHLTEYFTFKQECKIKY++++YDACM++FDCLPL+AL+NQQFLCVHGGLSP+ HNL+DIRRLDRFKEPPAFGPMCD+LWSDP+EDFG E++ E+F+HN+VRGCSYFYSY+A C+FLQ+ NLL +IRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ +LNIC+D+EL+ + +D +       RKE+I+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G LP+G L+ G+ SL +A+ G +  + I SF + K LD +NERMPP+KD    +NQ S      +  +P + +T +KS     T    S+ +
Sbjct:  124 SIECVLYLWALKLCHPTTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMEAFDCLPLAALMNQQFLCVHGGLSPEIHNLDDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGSEKNAEHFSHNSVRGCSYFYSYAACCDFLQSNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNLLNICSDDELMTEGEDTLEDADANLRKEVIRNKIRAIGKMARVFSVLREESESVLQLKGLTPTGALPLGALSGGKTSLKNALQGFSPNHKITSFAEAKGLDAINERMPPRKD-TPPSNQCSPSNIATSSTTPVTPVTEDKSPSPSTTQKPTSSEQ 519          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp3cb (serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform-like [Source:NCBI gene;Acc:103043949])

HSP 1 Score: 581.252 bits (1497), Expect = 0.000e+0
Identity = 257/355 (72.39%), Postives = 311/355 (87.61%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKDI 1067
            SIE VLYLW+LK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++YDACMD+FDCLPL+AL+NQQFLCVHGGLSP+ H L+DI++LDRFKEPPAFGPMCD+LWSDP+EDFG E+S E F+HNTVRGCSYFYSY A+C FLQ  NLL VIRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VL+IC+D+EL+    +   +   A RKE+I+ KIRAIGKM+++FS+LREESE +L LKGLTP+G+LP GVL+ G+++L SAI G + ++ I SF++ K LD +NERMPP++D+
Sbjct:  125 SIECVLYLWSLKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSEQVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHTLDDIKKLDRFKEPPAFGPMCDLLWSDPLEDFGNEKSQEYFSHNTVRGCSYFYSYPAVCEFLQTNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMNDGDEIYDANAAAARKEVIRNKIRAIGKMAKMFSVLREESENVLTLKGLTPTGMLPSGVLSGGKQTLQSAIRGFSPQHKISSFEEAKGLDRINERMPPRRDV 479          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp3ca (protein phosphatase 3, catalytic subunit, alpha isozyme [Source:ZFIN;Acc:ZDB-GENE-091113-24])

HSP 1 Score: 580.096 bits (1494), Expect = 0.000e+0
Identity = 257/354 (72.60%), Postives = 311/354 (87.85%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKD 1064
            SIE VLYLW+LK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++YD+CM++FDCLPL+AL+NQQFLCVHGGLSP+ H L+DI++LDRFKEPPAFGPMCD+LWSDP+EDFG E+S E F+HNTVRGCSYFYSY A+C FLQN NLL VIRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VL+IC+D+EL+    +   +   A RKE+I+ KIRAIGKM+++FS+LREESE +L LKGLTP+G+LP GVL+ G+++L SAI G + ++ I SF++ K LD +NERMPP+KD
Sbjct:  121 SIECVLYLWSLKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSEQVYDSCMEAFDCLPLAALMNQQFLCVHGGLSPEIHTLDDIKKLDRFKEPPAFGPMCDLLWSDPLEDFGNEKSQEYFSHNTVRGCSYFYSYPAVCEFLQNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMNDGDEIFDANAAAARKEVIRNKIRAIGKMAKMFSVLREESENVLTLKGLTPTGMLPSGVLSGGKQTLQSAIRGFSPQHKISSFEEAKGLDRINERMPPRKD 474          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp3ccb (serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform-like [Source:NCBI gene;Acc:103046193])

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 261/371 (70.35%), Postives = 315/371 (84.91%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKD---INARTNQISSLKSP 1106
            SIE VLYLW LK  HPTTL LLRGNHECRHLTEYFTFKQECKIKY++ +YDACM++FDCLPL+AL+NQQFLCVHGGLSP+   L+DIR+LDRFKEPPAFGPMCD+LWSDP ED+G E++ E+F HN+VRGCSYFYSY A+C+FL N NLL +IRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VLNIC+D+EL+ +  D       A RKE+I+ KIRAIGKM+R+FS+LREE+E++L LKGLTP+G LP+GVL+ GR++L SAI G   ++ I SF++ + LD +NERMPP+KD    +   N I++  SP
Sbjct:  123 SIECVLYLWTLKINHPTTLFLLRGNHECRHLTEYFTFKQECKIKYSECVYDACMEAFDCLPLAALLNQQFLCVHGGLSPEISCLDDIRKLDRFKEPPAFGPMCDLLWSDPGEDYGSEKTQEHFCHNSVRGCSYFYSYPAVCDFLMNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMSEGDDTCEGGAPAVRKEVIRNKIRAIGKMARVFSVLREENESVLQLKGLTPTGTLPLGVLSGGRQTLQSAIQGFNPQHKIQSFEEARGLDRINERMPPRKDGKQPDGLANSINATNSP 493          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: PPP3CA (protein phosphatase 3 catalytic subunit alpha [Source:NCBI gene;Acc:103021658])

HSP 1 Score: 574.318 bits (1479), Expect = 0.000e+0
Identity = 261/365 (71.51%), Postives = 313/365 (85.75%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQK-----------KKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKD 1064
            SIE VLYLWALK  +P TL LLRGNHECRHLTEYFTFKQEC+IKY++++YDACMD+FDCLPL+AL+NQQFLCVHGGLSP+  NL+DIR+LDRFKEPPA+GPMCD+LWSDP+EDFG E++ E+FTHNTVRGCSYFYSY A+C+FLQ+ NLL VIRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VL+IC+++EL              KK A  S     RKE+I+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G+LP GVL+ GRE L +AI G + ++ I SF++ K LD +NERMPP++D
Sbjct:  127 SIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECRIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEITNLDDIRKLDRFKEPPAYGPMCDLLWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSNDELTTDEEIDGQLIYPPKKGATASA----RKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGREKLQNAIKGFSPQHKITSFEEAKGLDRINERMPPRRD 487          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp3cca (serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform-like [Source:NCBI gene;Acc:103039366])

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 252/354 (71.19%), Postives = 311/354 (87.85%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKD 1064
            SIE VL+LW+LK  HPTTL LLRGNHECRHLTEYFTFKQECKIKY++++YDACM++FDCLPL+AL+NQQFLCVHGGLSP+ + L+DIR+LDRFKEPPAFGPMCD++W+DP ED+G E+S+E+F HN+VRGCSYF+SY A+C+FL N NLL VIRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VLNIC+D+EL+ +  D       A RKE+I+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G LP+GVL+ G++++ +AI G +    I +F++ + LD +NERMPP+KD
Sbjct:  124 SIECVLFLWSLKINHPTTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMEAFDCLPLAALLNQQFLCVHGGLSPEINCLDDIRKLDRFKEPPAFGPMCDLIWADPGEDYGSEKSSEHFNHNSVRGCSYFFSYPAVCDFLTNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMSEGDDLCEGGAPAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGTLPLGVLSGGKQTIQNAIQGFSPTRKIRNFEEARGLDRINERMPPRKD 477          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp3cb (protein phosphatase 3, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-050417-406])

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 266/364 (73.08%), Postives = 309/364 (84.89%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNS----------AITGLTSRNVIGSFDDVKMLDLVNERMPPKKD 1064
            SIE VLYLWALK  +PTTL LLRGNHECRHLTEYFTFKQECKIKY + +YDACMD+FDCLPL+AL+NQQFLCVHGGLSP+ HNLEDIR+LDRFKEPPAFGPMCD+LWSDP EDFG E++ E F HNTVRGCSYFYSY A+C+FLQN NLL VIRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VLNIC+D+EL  + ++A  +   A RKE+I+ KIRAIGKM+++FS+LR ESE++L LKGLTP+G+LP GVL  GR++L S          AI G T +  I SF + K LD +NERMPP+KD
Sbjct:  109 SIECVLYLWALKILYPTTLFLLRGNHECRHLTEYFTFKQECKIKYTETVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEVHNLEDIRKLDRFKEPPAFGPMCDLLWSDPSEDFGNEKTQEYFCHNTVRGCSYFYSYPAVCDFLQNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELTTEGEEAFDATATAARKEVIRNKIRAIGKMAKMFSVLRLESESVLTLKGLTPTGMLPSGVLAGGRQTLQSAAFEAVEAHKAIKGFTPQQKITSFAEAKGLDRINERMPPRKD 472          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010086.1 (pep scaffold:Pmarinus_7.0:GL479411:90249:92178:-1 gene:ENSPMAG00000009123.1 transcript:ENSPMAT00000010086.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 148.288 bits (373), Expect = 4.473e-42
Identity = 72/207 (34.78%), Postives = 115/207 (55.56%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGP---MCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVM 614
            S+E +  L A K ++P    LLRGNHEC  +   + F  ECK ++N K++    D F+CLP++A+++++  C HGGLSPD  ++E IRR+ R  + P  G    +CD+LWSDP +D      N+       RG S+ +    +  FL   +L  + RAH+  + GY  + + Q      L+T+FSAPNY   ++N   ++  +  +M
Sbjct:   38 SLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGDAGLLCDLLWSDPDKDVQGWGEND-------RGVSFTFGGDVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQ------LVTLFSAPNYCGEFDNAGGMMSVDETLM 231          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp1cab (protein phosphatase 1, catalytic subunit, alpha isozyme b [Source:ZFIN;Acc:ZDB-GENE-030131-5512])

HSP 1 Score: 148.288 bits (373), Expect = 1.255e-41
Identity = 73/204 (35.78%), Postives = 115/204 (56.37%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVM 614
            S+E +  L A K ++P    LLRGNHE   +   + F  ECK +YN K++    D F+CLP++A+++++  C HGGLSPD  ++E IRR+ R  + P  G +CD+LWSDP +D      N+       RG S+ +    +  FL   +L  + RAH+  + GY  + + Q      L+T+FSAPNY   ++N  A++  +  +M
Sbjct:   82 SLETICLLLAYKIKYPENFFLLRGNHEA-SINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGEND-------RGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQ------LVTLFSAPNYCGEFDNAGAMMSVDETLM 271          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-050327-75])

HSP 1 Score: 142.895 bits (359), Expect = 2.715e-38
Identity = 80/218 (36.70%), Postives = 117/218 (53.67%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGL-SPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVM--NIRQFNFTPHP 647
            S+EV+L L+  K  +P   HL+RGNHE  ++ + + F+ E K KY  +++D   + F  LPL+  IN + L +HGGL S D   L+DIR++DR ++PP  GPMCD+LWSDP    G+  S         RG S  +       F++  NL  +IR+HE  D GY +    +       +T+FSAPNY D   NK + +      +     +F   PHP
Sbjct:  241 SVEVILVLFGFKLLYPDHFHLMRGNHETDNMNQMYGFEGEVKAKYTAQMFDFFSEVFQWLPLAMCINSRVLIMHGGLFSEDGVTLDDIRKIDRNRQPPDSGPMCDLLWSDPQPQPGRSVSK--------RGVSCQFGPDVSRAFMEQNNLELIIRSHEKPD-GYEVAHDGRC------VTVFSAPNYCDQMGNKGSYIHLTAPALKPEFHEFAAVPHP 443          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-030616-609])

HSP 1 Score: 116.316 bits (290), Expect = 1.284e-30
Identity = 54/143 (37.76%), Postives = 83/143 (58.04%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNF 431
            S+E +  L A K ++P    LLRGNHEC  +   + F  ECK ++N K++    D F+CLP++A+++++  C HGGLSPD  ++E IRR+ R  + P  G +CD+LWSDP +D      N+       RG S+ +    +  F
Sbjct:   86 SLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGEND-------RGVSFTFGADVVSKF 221          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: CMP2 (Calcineurin A; one isoform (the other is Cna1p) of the catalytic subunit of calcineurin, a Ca++/calmodulin-regulated protein phosphatase which regulates Crz1p (a stress-response transcription factor), the other calcineurin subunit is CNB1; regulates the function of Aly1p alpha-arrestin; CMP2 has a paralog, CNA1, that arose from the whole genome duplication [Source:SGD;Acc:S000004521])

HSP 1 Score: 399.823 bits (1026), Expect = 2.298e-135
Identity = 199/410 (48.54%), Postives = 266/410 (64.88%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQ------------------------ERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVA--------------------------------HRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKD 1064
            S E ++YL++LK        LLRGNHEC+HLT YFTFK E   KYN  IY+ C +SF+ LPL+AL+N Q+LCVHGG+SP+ ++L+DI  L+RF+E P+ G MCD+LW+DP+E++ +                          S + F  N+VRGCSY ++Y A C+FLQ T LL +IRAHEAQD+GYRMY+  +  GFPSL+T+FSAPNYLD YNNKAAILKYENNVMNIRQFN TPHPYWLP+F+DVFTWSLPFV EKVTE+L+A+LNICT++EL  +    VI + V                                 HR++ ++ KI A+ K+SR++S+LREE+  +  LK    SGVLP G L+NG + L+ A++         +F+  +  DL+NE++PP  D
Sbjct:  180 SFECLIYLYSLKLNFNDHFWLLRGNHECKHLTSYFTFKNEMLHKYNLDIYEKCCESFNNLPLAALMNGQYLCVHGGISPELNSLQDINNLNRFREIPSHGLMCDLLWADPIEEYDEVLDKDLTEEDIVNSKTMVPHHGKMAPSRDMFVPNSVRGCSYAFTYRAACHFLQETGLLSIIRAHEAQDAGYRMYKNTKTLGFPSLLTLFSAPNYLDTYNNKAAILKYENNVMNIRQFNMTPHPYWLPDFMDVFTWSLPFVGEKVTEMLVAILNICTEDEL--ENDTPVIEELVGTDKKLPQAGKSEATPQPATSASPKHASILDDEHRRKALRNKILAVAKVSRMYSVLREETNKVQFLKDHN-SGVLPRGALSNGVKGLDEALS---------TFERARKHDLINEKLPPSLD 577          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: CNA1 (Calcineurin A; one isoform (the other is Cmp2p) of the catalytic subunit of calcineurin, a Ca++/calmodulin-regulated protein phosphatase which regulates Crz1p (a stress-response transcription factor), the other calcineurin subunit is CNB1; regulates the function of Aly1p alpha-arrestin; CNA1 has a paralog, CMP2, that arose from the whole genome duplication [Source:SGD;Acc:S000004425])

HSP 1 Score: 395.971 bits (1016), Expect = 1.261e-134
Identity = 187/385 (48.57%), Postives = 263/385 (68.31%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQER-------SNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEEL---------------------------LQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPP 1055
            S E ++YL++LK  +     +LRGNHEC+HLT YFTFK E   KY+ ++YDAC  SF+ LPL+AL+N Q+ CVHGG+SP+  ++ED+ +++RF+E P+ G MCD+LW+DPVE++   R       S + F  N++RGCS+ +++ A C FL+   LL +IRAHEAQD+GYRMY+ N+ TGFPSLIT+FSAPNYLD Y+NKAA+LKYE NVMNIRQF+ +PHPYWLP+F+DVFTWSLPFV EKVT +L+++LNIC+++EL                            +K   A++  +   R++ ++ KI AI K+SR+FS+LREESE +  LK +  +GVLP G L  G E LN  ++         +F+  +  DL+NE++PP
Sbjct:  155 SFECLIYLYSLKLNNLGRFWMLRGNHECKHLTSYFTFKNEMLHKYDMEVYDACCRSFNVLPLAALMNGQYFCVHGGISPELKSVEDVNKINRFREIPSRGLMCDLLWADPVENYDDARDGSEFDQSEDEFVPNSLRGCSFAFTFKASCKFLKANGLLSIIRAHEAQDAGYRMYKNNKVTGFPSLITMFSAPNYLDTYHNKAAVLKYEENVMNIRQFHMSPHPYWLPDFMDVFTWSLPFVGEKVTSMLVSILNICSEQELDPESEPKAAEETVKARANATKETGTPSDEKASSAILEDET--RRKALRNKILAIAKVSRMFSVLREESEKVEYLKTMN-AGVLPRGALARGTEGLNETLS---------TFEKARKEDLINEKLPP 527          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: GLC7 (Type 1 S/T protein phosphatase (PP1) catalytic subunit; involved in glycogen metabolism, sporulation and mitotic progression; interacts with multiple regulatory subunits; regulates actomyosin ring formation; subunit of CPF; recruited to mating projections by Afr1p interaction; regulates nucleocytoplasmic shuttling of Hxk2p; import into the nucleus is inhibited during spindle assembly checkpoint arrest; involved in dephosphorylating Rps6a/b and Bnr1p [Source:SGD;Acc:S000000935])

HSP 1 Score: 156.762 bits (395), Expect = 6.135e-45
Identity = 73/204 (35.78%), Postives = 120/204 (58.82%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVM 614
            S+E +  L A K ++P    +LRGNHEC  +   + F  ECK +YN K++    D F+CLP++A+I+++  C+HGGLSPD +++E IRR+ R  + P  G +CD+LWSDP +D      N+       RG S+ +    +  FLQ  ++  + RAH+  + GY  + + Q      L+T+FSAPNY   ++N  A++  + +++
Sbjct:   99 SLETICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPDLNSMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSEND-------RGVSFTFGPDVVNRFLQKQDMELICRAHQVVEDGYEFFSKRQ------LVTLFSAPNYCGEFDNAGAMMSVDESLL 289          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPZ1 (Serine/threonine protein phosphatase Z, isoform of Ppz2p; involved in regulation of potassium transport, which affects osmotic stability, cell cycle progression, and halotolerance [Source:SGD;Acc:S000004478])

HSP 1 Score: 146.747 bits (369), Expect = 6.579e-39
Identity = 76/197 (38.58%), Postives = 113/197 (57.36%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAIL 593
            S+E +L L+  K ++P    LLRGNHEC ++T  + F  ECK + N KI+   +D+F+ LPL+A++  +  CVHGGLSP  +++++IR + R  + P FG + D+LWSDP +   +   NE       RG SY Y+  AI  FL       V RAH   + GY  +         SL+T+FSAPNY   ++N  A++
Sbjct:  455 SLETILLLFCYKIKYPENFFLLRGNHECANVTRVYGFYDECKRRCNIKIWKTFIDTFNTLPLAAIVAGKIFCVHGGLSPVLNSMDEIRHVVRPTDVPDFGLINDLLWSDPTDSPNEWEDNE-------RGVSYCYNKVAINKFLNKFGFDLVCRAHMVVEDGYEFFNDR------SLVTVFSAPNYCGEFDNWGAVM 638          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPZ2 (Serine/threonine protein phosphatase Z, isoform of Ppz1p; involved in regulation of potassium transport, which affects osmotic stability, cell cycle progression, and halotolerance [Source:SGD;Acc:S000002844])

HSP 1 Score: 146.362 bits (368), Expect = 9.416e-39
Identity = 75/197 (38.07%), Postives = 112/197 (56.85%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAIL 593
            S+E +L L   K ++P    LLRGNHEC ++T  + F  ECK + N KI+   +D+F+ LPL+A++  +  CVHGGLSP  +++++IR + R  + P FG + D+LWSDP +   +   NE       RG S+ Y+  AI  FL       V RAH   + GY  +         SL+T+FSAPNY   ++N  A++
Sbjct:  490 SLETILLLLCYKIKYPENFFLLRGNHECANVTRVYGFYDECKRRCNIKIWKTFVDTFNTLPLAAIVTGKIFCVHGGLSPVLNSMDEIRHVSRPTDVPDFGLINDLLWSDPTDSSNEWEDNE-------RGVSFCYNKVAINKFLNKFGFDLVCRAHMVVEDGYEFFNDR------SLVTVFSAPNYCGEFDNWGAVM 673          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO36272 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7SJ38])

HSP 1 Score: 551.977 bits (1421), Expect = 0.000e+0
Identity = 253/355 (71.27%), Postives = 308/355 (86.76%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKDI 1067
            SIE VLYLW LK  +  TL LLRGNHECRHLTEYFTFK ECKIKY++ +YDACM+SFDCLPL+AL+NQQFLCVHGGLSP+ H L+D+++LDRFKEPPAFGPMCD+LWSDP+ED+G E+++E+F+HNTVRGCSYFYSY A C FLQN NLL +IRAHEAQD+GYRMYR++QATGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ +L+ICTDEEL    +D   ++ +  RKEII+ KIRAIGKM+R+F++LREESE+IL LKGLTP+G LP+G+L+ G++ + +A+ G    + I  F++ K LD VNERMPP+KD+
Sbjct:  104 SIECVLYLWTLKCLYTNTLFLLRGNHECRHLTEYFTFKTECKIKYSEAVYDACMESFDCLPLAALMNQQFLCVHGGLSPEIHTLDDVKKLDRFKEPPAFGPMCDLLWSDPLEDYGNEKTSEHFSHNTVRGCSYFYSYPATCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNILSICTDEELEDGDEDEEKTEALK-RKEIIRSKIRAIGKMARVFTVLREESESILQLKGLTPTGHLPVGLLSGGKQEVQAALQGHDPTHKISGFEEAKGLDRVNERMPPRKDM 457          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO44648 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RVJ0])

HSP 1 Score: 155.221 bits (391), Expect = 9.039e-44
Identity = 74/204 (36.27%), Postives = 116/204 (56.86%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVM 614
            S+E +  L A K ++P    LLRGNHEC  +   + F  ECK +YN K++    D F+CLP++A+++++  C HGGLSPD  ++E IRR+ R  + P  G +CD+LWSDP +D      N+       RG S+ +    +  FL   +L  + RAH+  + GY  + + Q      L+T+FSAPNY   ++N  A++  +  +M
Sbjct:  100 SLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAILDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGEND-------RGVSFTFGPDIVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQ------LVTLFSAPNYCGEFDNAGAMMSVDETLM 290          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO29759 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7T2Q5])

HSP 1 Score: 139.428 bits (350), Expect = 4.903e-38
Identity = 84/217 (38.71%), Postives = 113/217 (52.07%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKY-NDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRM-YRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHP 647
            S+E V  L  LK + P  + +LRGNHE R +T+ + F  EC  KY N  ++    D FD LPL+AL++ Q  C+HGGLSP    L+ IR LDR +E P  GPMCD+LWSDP +  G   S         RG  Y +       F     L  + RAH+    GY   + RN       ++TIFSAPNY     N+AAI++  ++ +      F P P
Sbjct:   94 SVETVTLLVTLKVRFPHRICILRGNHESRQITQVYGFYDECLRKYGNASVWKYFTDLFDYLPLTALVDNQIFCLHGGLSPSIDTLDHIRALDRIQEVPHEGPMCDLLWSDPDDRGGWGISP--------RGAGYTFGQDISETFNHTNGLTLITRAHQLVMEGYNWCHDRN-------VVTIFSAPNYCYRCGNQAAIMEL-DDALKYSFLQFDPAP 294          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO49936 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RFC7])

HSP 1 Score: 137.502 bits (345), Expect = 2.945e-37
Identity = 75/204 (36.76%), Postives = 112/204 (54.90%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYND-KIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNV 611
            S+E  L L ALK ++P  + L+RGNHE R +T+ + F  EC  KY    ++  C + FD L LSA+I+ +  CVHGGLSP    L+ IR +DR +E P  GPMCD+LWSDP +  G   S         RG  Y +    +  +    ++  + RAH+    GY+ +         +++T++SAPNY     N AAIL+ + ++
Sbjct:   90 SVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLKKYGSITVWRYCAEIFDYLSLSAIIDNRVFCVHGGLSPSISTLDQIRSIDRKQEVPHDGPMCDLLWSDPEDIQGWGVSP--------RGAGYLFGSDVVAQYNAANDIDLICRAHQLVMEGYKWHFNE------TVLTVWSAPNYCYRCGNVAAILELDEHL 279          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO40084 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8D8])

HSP 1 Score: 123.635 bits (309), Expect = 8.727e-34
Identity = 58/163 (35.58%), Postives = 92/163 (56.44%), Query Frame = 3
Query:  126 KIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVM 614
            K +YN K++    D F+CLP++A++ Q   C+HGGLSPD   L++IR L+R  + P  G +CD+LWSDP ED      N+       RG S+ +    +  +L+      V+RAH+  + GYR + + +      L+T+FSAPNY   ++N   ++    N+M
Sbjct:    2 KRRYNIKLWKIFTDCFNCLPIAAIVEQTIFCMHGGLSPDLQGLDEIRNLERPMDVPDKGLVCDLLWSDPDEDITGWGDND-------RGVSWTFGGDVVREYLEKYGFSLVVRAHQVVEDGYRFFEKRK------LVTLFSAPNYCGEFDNAGGVMSVGENLM 151          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ppp3ca (serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform [Source:NCBI gene;Acc:101168142])

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 257/366 (70.22%), Postives = 316/366 (86.34%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKD-INARTNQISSL 1097
            SIE VLYLW+LK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++YD+CMD+FDCLPL+AL+NQQFLCVHGGLSP+   L+DI++LDRFKEPPAFGPMCD+LWSDP+EDFG E++ E F+HNTVRGCSYFYSY A+C FLQ+ NLL +IRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VL+IC+D+EL+  + +   +   A RKE+I+ KIRAIGKM+++FS+LREESE +L LKGLTP+G+LP GVL+ GR++L SAI G + ++ I SF++ K LD +NERMPP+KD +N   N +  +
Sbjct:  125 SIECVLYLWSLKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSEQVYDSCMDAFDCLPLAALMNQQFLCVHGGLSPEIQTLDDIKKLDRFKEPPAFGPMCDLLWSDPLEDFGNEKTQEYFSHNTVRGCSYFYSYPAVCEFLQSNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMNDEDEIFDANAAAQRKEVIRNKIRAIGKMAKMFSVLREESENVLTLKGLTPTGMLPSGVLSGGRQTLQSAIRGFSPQHKITSFEEAKGLDRINERMPPRKDGVNHVGNSMGKM 490          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ENSORLT00000042449.1 (serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform [Source:NCBI gene;Acc:101169815])

HSP 1 Score: 577.015 bits (1486), Expect = 0.000e+0
Identity = 259/365 (70.96%), Postives = 317/365 (86.85%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKDINARTNQISSL 1097
            SIE VLYLWALK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++YDACMD+FDCLPL+AL+NQQFLCVHGGLSP+  NL+DIR+LDRFKEPPA+GPMCD+LWSDP+EDFG E+S E+FTHNTVRGCSYFYSY A+C+FLQ+ NLL +IRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VL+IC+++EL   ++  +     + RKE+I+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G+LP GVL+ G+E L +AI G + ++ I SF++ K LD +NERMPP++D       ++SL
Sbjct:  167 SIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEITNLDDIRKLDRFKEPPAYGPMCDLLWSDPLEDFGNEKSQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSNDELTTDEE--LDGATASARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKEKLQNAIKGFSPQHKITSFEEAKGLDRINERMPPRRDALPSDASLNSL 529          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ENSORLT00000036835.1 (serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform [Source:NCBI gene;Acc:101169815])

HSP 1 Score: 576.63 bits (1485), Expect = 0.000e+0
Identity = 259/365 (70.96%), Postives = 317/365 (86.85%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKDINARTNQISSL 1097
            SIE VLYLWALK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++YDACMD+FDCLPL+AL+NQQFLCVHGGLSP+  NL+DIR+LDRFKEPPA+GPMCD+LWSDP+EDFG E+S E+FTHNTVRGCSYFYSY A+C+FLQ+ NLL +IRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VL+IC+++EL   ++  +     + RKE+I+ KIRAIGKM+R+FS+LREESE++L LKGLTP+G+LP GVL+ G+E L +AI G + ++ I SF++ K LD +NERMPP++D       ++SL
Sbjct:  186 SIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEITNLDDIRKLDRFKEPPAYGPMCDLLWSDPLEDFGNEKSQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSNDELTTDEE--LDGATASARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKEKLQNAIKGFSPQHKITSFEEAKGLDRINERMPPRRDALPSDASLNSL 548          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ppp3ca (serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform [Source:NCBI gene;Acc:101168142])

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 257/366 (70.22%), Postives = 316/366 (86.34%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKD-INARTNQISSL 1097
            SIE VLYLW+LK  +P TL LLRGNHECRHLTEYFTFKQECKIKY++++YD+CMD+FDCLPL+AL+NQQFLCVHGGLSP+   L+DI++LDRFKEPPAFGPMCD+LWSDP+EDFG E++ E F+HNTVRGCSYFYSY A+C FLQ+ NLL +IRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VL+IC+D+EL+  + +   +   A RKE+I+ KIRAIGKM+++FS+LREESE +L LKGLTP+G+LP GVL+ GR++L SAI G + ++ I SF++ K LD +NERMPP+KD +N   N +  +
Sbjct:  129 SIECVLYLWSLKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSEQVYDSCMDAFDCLPLAALMNQQFLCVHGGLSPEIQTLDDIKKLDRFKEPPAFGPMCDLLWSDPLEDFGNEKTQEYFSHNTVRGCSYFYSYPAVCEFLQSNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMNDEDEIFDANAAAQRKEVIRNKIRAIGKMAKMFSVLREESENVLTLKGLTPTGMLPSGVLSGGRQTLQSAIRGFSPQHKITSFEEAKGLDRINERMPPRKDGVNHVGNSMGKM 494          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ppp3cca (serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform [Source:NCBI gene;Acc:101172250])

HSP 1 Score: 575.089 bits (1481), Expect = 0.000e+0
Identity = 252/354 (71.19%), Postives = 312/354 (88.14%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKD 1064
            SIE VLYLW+LK  HPTTL LLRGNHECRHLTEYFTFKQECKIKY++++YDACM++FDCLPL+AL+NQQFLCVHGGLSP+ + L+DIR+LDRFKEPPAFGPMCD++W+DP ED+G E+++E+F HN+VRGCSYF+SY+A+C+FL N NLL VIRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VLNIC+D+EL+ +  D       A RKE+I+ KIRA+GKM+R+FS+LREESE++L LKGLTP+G LP+GVL+ G+++L +AI G +    I +F++ + LD +NERMPP+KD
Sbjct:  128 SIECVLYLWSLKINHPTTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMEAFDCLPLAALLNQQFLCVHGGLSPEINCLDDIRKLDRFKEPPAFGPMCDLIWADPGEDYGSEKTSEHFNHNSVRGCSYFFSYAAVCDFLVNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMSEGDDLYEGGTSAMRKEVIRNKIRAVGKMARVFSVLREESESVLTLKGLTPTGTLPVGVLSGGKQTLENAIQGFSPTRKIRNFEEARGLDRINERMPPRKD 481          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000015140.1 (SMESG000015140.1)

HSP 1 Score: 832.787 bits (2150), Expect = 0.000e+0
Identity = 398/398 (100.00%), Postives = 398/398 (100.00%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKDINARTNQISSLKSPKNIKSPSSQITSNKSVQSQVTAAFASTSRK 1196
            SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKDINARTNQISSLKSPKNIKSPSSQITSNKSVQSQVTAAFASTSRK
Sbjct:  127 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKDINARTNQISSLKSPKNIKSPSSQITSNKSVQSQVTAAFASTSRK 524          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000012014.1 (SMESG000012014.1)

HSP 1 Score: 600.127 bits (1546), Expect = 0.000e+0
Identity = 265/353 (75.07%), Postives = 322/353 (91.22%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKK 1061
            SIEVVLYLW+LK  +P TLHLLRGNHECRHLTEYFTFKQECKIKY++K+Y+ACM++FDCLPL+ALIN QFLCVHGG+SP+FH+L+DIRRLDRFKEPPAFGPMCD+LWSDP+EDFGQER++ENF HN+VRGCSYFY+Y A+C FLQ  NLLCVIRAHEAQD+GYRMYRRNQATGFPSLITIFSAPNYLD YNNKAAILKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VLNICTD+EL+ ++ D   +  +A R+++IK KIRAIGKM+R+F++LREESE++L LKGLTP+G+LP+G+LT G++S++ A+TG++  + I SF++ K+LD VNERMPP++
Sbjct:  123 SIEVVLYLWSLKLLYPNTLHLLRGNHECRHLTEYFTFKQECKIKYSEKVYEACMEAFDCLPLAALINGQFLCVHGGISPEFHSLDDIRRLDRFKEPPAFGPMCDLLWSDPIEDFGQERTSENFLHNSVRGCSYFYTYQAVCKFLQANNLLCVIRAHEAQDAGYRMYRRNQATGFPSLITIFSAPNYLDAYNNKAAILKYENNVMNIRQFNSSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICTDDELVTEEDDPAEAAAIAARRDVIKNKIRAIGKMARVFTVLREESESLLELKGLTPNGMLPMGLLTGGKDSIHGAMTGVSPHHPIQSFEEAKVLDQVNERMPPRR 475          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000012014.1 (SMESG000012014.1)

HSP 1 Score: 600.127 bits (1546), Expect = 0.000e+0
Identity = 265/353 (75.07%), Postives = 322/353 (91.22%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKK 1061
            SIEVVLYLW+LK  +P TLHLLRGNHECRHLTEYFTFKQECKIKY++K+Y+ACM++FDCLPL+ALIN QFLCVHGG+SP+FH+L+DIRRLDRFKEPPAFGPMCD+LWSDP+EDFGQER++ENF HN+VRGCSYFY+Y A+C FLQ  NLLCVIRAHEAQD+GYRMYRRNQATGFPSLITIFSAPNYLD YNNKAAILKYENNVMNIRQFN +PHPYWLPNF+DVFTWSLPFV EKVTE+L+ VLNICTD+EL+ ++ D   +  +A R+++IK KIRAIGKM+R+F++LREESE++L LKGLTP+G+LP+G+LT G++S++ A+TG++  + I SF++ K+LD VNERMPP++
Sbjct:  123 SIEVVLYLWSLKLLYPNTLHLLRGNHECRHLTEYFTFKQECKIKYSEKVYEACMEAFDCLPLAALINGQFLCVHGGISPEFHSLDDIRRLDRFKEPPAFGPMCDLLWSDPIEDFGQERTSENFLHNSVRGCSYFYTYQAVCKFLQANNLLCVIRAHEAQDAGYRMYRRNQATGFPSLITIFSAPNYLDAYNNKAAILKYENNVMNIRQFNSSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICTDDELVTEEDDPAEAAAIAARRDVIKNKIRAIGKMARVFTVLREESESLLELKGLTPNGMLPMGLLTGGKDSIHGAMTGVSPHHPIQSFEEAKVLDQVNERMPPRR 475          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000064848.1 (SMESG000064848.1)

HSP 1 Score: 589.726 bits (1519), Expect = 0.000e+0
Identity = 266/389 (68.38%), Postives = 331/389 (85.09%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKD-INARTNQISSLKSPKNIKSPSSQITSNKSVQSQV 1166
            SIEVVLYLWA+K  +PTT  LLRGNHECRHLTEYFTFKQECKIKY ++IYDACM +FDCLPL+AL+NQQFLCVHGGLSP+ H ++DIR++DRF+EPPA+GPMCD+LWSDP+EDFG ERS E+++HN+VRGCSYF+SY+A C+FLQN NLL +IRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFN +PHPYWLPNF+DVFTWS+PFV EKVTE+L+ VLNIC+D+ELL +  D      VA RKE+I+ KIRAIGKM+R+F++LREESE++L LKGLTP+GVLP+G L+ G+ESL++A++G++  +VI SF++ K +D VNER+PP++D I A +N+ S  +          Q T+N SV   +
Sbjct:  122 SIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYR---------HQQTNNNSVDQDI 501          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000064848.1 (SMESG000064848.1)

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 266/395 (67.34%), Postives = 332/395 (84.05%), Query Frame = 3
Query:    3 SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIYDACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFGPMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLLCVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDEELLQKKKDAVISK------KVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLKGLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMPPKKD-INARTNQISSLKSPKNIKSPSSQITSNKSVQSQV 1166
            SIEVVLYLWA+K  +PTT  LLRGNHECRHLTEYFTFKQECKIKY ++IYDACM +FDCLPL+AL+NQQFLCVHGGLSP+ H ++DIR++DRF+EPPA+GPMCD+LWSDP+EDFG ERS E+++HN+VRGCSYF+SY+A C+FLQN NLL +IRAHEAQD+GYRMYR++Q TGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFN +PHPYWLPNF+DVFTWS+PFV EKVTE+L+ VLNIC+D+ELL +  D    +       VA RKE+I+ KIRAIGKM+R+F++LREESE++L LKGLTP+GVLP+G L+ G+ESL++A++G++  +VI SF++ K +D VNER+PP++D I A +N+ S  +          Q T+N SV   +
Sbjct:  122 SIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEDQSKNPGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYR---------HQQTNNNSVDQDI 507          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP3CA0.000e+068.56protein phosphatase 3 catalytic subunit alpha [Sou... [more]
PPP3CB0.000e+073.45protein phosphatase 3 catalytic subunit beta [Sour... [more]
PPP3CA0.000e+066.83protein phosphatase 3 catalytic subunit alpha [Sou... [more]
PPP3CA0.000e+066.83protein phosphatase 3 catalytic subunit alpha [Sou... [more]
PPP3CB0.000e+071.43protein phosphatase 3 catalytic subunit beta [Sour... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tax-60.000e+068.77Serine/threonine-protein phosphatase 2B catalytic ... [more]
tax-60.000e+067.53Serine/threonine-protein phosphatase 2B catalytic ... [more]
tax-60.000e+067.01Serine/threonine-protein phosphatase 2B catalytic ... [more]
gsp-21.274e-4336.27Serine/threonine-protein phosphatase PP1-beta [So... [more]
gsp-11.383e-4336.27Serine/threonine-protein phosphatase PP1-alpha [S... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pp2B-14D0.000e+072.96gene:FBgn0011826 transcript:FBtr0305593[more]
Pp2B-14D0.000e+072.96gene:FBgn0011826 transcript:FBtr0309793[more]
Pp2B-14D0.000e+072.96gene:FBgn0011826 transcript:FBtr0074294[more]
CanA-14F0.000e+072.96gene:FBgn0267912 transcript:FBtr0305198[more]
CanA-14F0.000e+072.96gene:FBgn0267912 transcript:FBtr0074292[more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp3ca0.000e+072.32protein phosphatase 3, catalytic subunit, alpha is... [more]
ppp3ccb0.000e+068.95protein phosphatase 3, catalytic subunit, gamma is... [more]
ppp3ccb0.000e+068.68protein phosphatase 3, catalytic subunit, gamma is... [more]
ppp3cb0.000e+069.27protein phosphatase 3, catalytic subunit, beta iso... [more]
ppp3cca0.000e+070.90protein phosphatase 3, catalytic subunit, gamma is... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mrps310.000e+069.87mitochondrial ribosomal protein S31 [Source:Xenbas... [more]
rai10.000e+068.81retinoic acid induced 1 [Source:Xenbase;Acc:XB-GEN... [more]
rai10.000e+068.81retinoic acid induced 1 [Source:Xenbase;Acc:XB-GEN... [more]
rai10.000e+068.81retinoic acid induced 1 [Source:Xenbase;Acc:XB-GEN... [more]
rai10.000e+068.81retinoic acid induced 1 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppp3ca0.000e+068.56protein phosphatase 3, catalytic subunit, alpha is... [more]
Ppp3cb0.000e+069.09protein phosphatase 3, catalytic subunit, beta iso... [more]
Ppp3ca0.000e+066.83protein phosphatase 3, catalytic subunit, alpha is... [more]
Ppp3cb0.000e+067.34protein phosphatase 3, catalytic subunit, beta iso... [more]
Ppp3cb0.000e+067.34protein phosphatase 3, catalytic subunit, beta iso... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q27889|PP2B2_DROME0.000e+072.96Serine/threonine-protein phosphatase 2B catalytic ... [more]
sp|Q9VXF1|PP2B3_DROME0.000e+072.96Serine/threonine-protein phosphatase 2B catalytic ... [more]
sp|P63329|PP2BA_RAT0.000e+066.83Serine/threonine-protein phosphatase 2B catalytic ... [more]
sp|P63328|PP2BA_MOUSE0.000e+066.83Serine/threonine-protein phosphatase 2B catalytic ... [more]
sp|Q08209|PP2BA_HUMAN0.000e+066.83Serine/threonine-protein phosphatase 2B catalytic ... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3L8DVJ90.000e+074.37Serine/threonine-protein phosphatase OS=Ooceraea b... [more]
V9KC080.000e+075.14Serine/threonine-protein phosphatase OS=Callorhinc... [more]
A0A088ADM20.000e+073.80Serine/threonine-protein phosphatase OS=Apis melli... [more]
A0A4S2J9X40.000e+073.80Serine/threonine-protein phosphatase OS=Temnothora... [more]
A0A2H8TF160.000e+067.51Serine/threonine-protein phosphatase OS=Melanaphis... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp3cb0.000e+072.39serine/threonine-protein phosphatase 2B catalytic ... [more]
ppp3ca0.000e+072.60protein phosphatase 3, catalytic subunit, alpha is... [more]
ppp3ccb0.000e+070.35serine/threonine-protein phosphatase 2B catalytic ... [more]
PPP3CA0.000e+071.51protein phosphatase 3 catalytic subunit alpha [Sou... [more]
ppp3cca0.000e+071.19serine/threonine-protein phosphatase 2B catalytic ... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp3cb0.000e+073.08protein phosphatase 3, catalytic subunit, beta iso... [more]
ENSPMAT00000010086.14.473e-4234.78pep scaffold:Pmarinus_7.0:GL479411:90249:92178:-1 ... [more]
ppp1cab1.255e-4135.78protein phosphatase 1, catalytic subunit, alpha is... [more]
ppp5c2.715e-3836.70protein phosphatase 5, catalytic subunit [Source:Z... [more]
ppp1cb1.284e-3037.76protein phosphatase 1, catalytic subunit, beta iso... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CMP22.298e-13548.54Calcineurin A; one isoform (the other is Cna1p) of... [more]
CNA11.261e-13448.57Calcineurin A; one isoform (the other is Cmp2p) of... [more]
GLC76.135e-4535.78Type 1 S/T protein phosphatase (PP1) catalytic sub... [more]
PPZ16.579e-3938.58Serine/threonine protein phosphatase Z, isoform of... [more]
PPZ29.416e-3938.07Serine/threonine protein phosphatase Z, isoform of... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO362720.000e+071.27Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO446489.039e-4436.27Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO297594.903e-3838.71Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO499362.945e-3736.76Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO400848.727e-3435.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp3ca0.000e+070.22serine/threonine-protein phosphatase 2B catalytic ... [more]
ENSORLT00000042449.10.000e+070.96serine/threonine-protein phosphatase 2B catalytic ... [more]
ENSORLT00000036835.10.000e+070.96serine/threonine-protein phosphatase 2B catalytic ... [more]
ppp3ca0.000e+070.22serine/threonine-protein phosphatase 2B catalytic ... [more]
ppp3cca0.000e+071.19serine/threonine-protein phosphatase 2B catalytic ... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015140.10.000e+0100.00SMESG000015140.1[more]
SMESG000012014.10.000e+075.07SMESG000012014.1[more]
SMESG000012014.10.000e+075.07SMESG000012014.1[more]
SMESG000064848.10.000e+068.38SMESG000064848.1[more]
SMESG000064848.10.000e+067.34SMESG000064848.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032458 ID=SMED30032458|Name=Serine/threonine-protein phosphatase|organism=Schmidtea mediterranea sexual|type=transcript|length=1277bp
ATAGCATAGAGGTAGTATTGTATTTGTGGGCCCTTAAGAGCCAGCATCCA
ACCACGTTACACCTACTCCGAGGAAACCACGAATGCCGACATTTGACAGA
ATATTTTACCTTTAAACAAGAGTGCAAAATTAAATACAATGACAAAATTT
ATGATGCATGTATGGATTCATTTGATTGTTTACCATTATCTGCGTTAATA
AATCAGCAATTTCTCTGTGTACACGGGGGACTTTCTCCCGATTTTCACAA
TTTGGAAGACATCAGAAGACTAGATCGATTTAAAGAACCACCAGCATTTG
GTCCAATGTGTGATATTTTGTGGTCGGATCCTGTAGAGGATTTTGGACAA
GAGAGGAGCAACGAAAACTTTACACACAATACAGTCAGAGGTTGTTCTTA
TTTTTACAGTTATTCAGCCATTTGTAATTTTCTGCAAAATACAAATTTGT
TATGTGTTATTAGAGCTCATGAAGCCCAAGATTCTGGTTATAGAATGTAT
AGGAGAAATCAGGCAACTGGATTCCCATCTCTAATAACTATATTTAGTGC
TCCTAATTATCTTGATGTATACAATAATAAAGCTGCTATCTTAAAGTATG
AAAATAACGTAATGAATATTCGTCAGTTTAATTTCACTCCTCATCCATAT
TGGTTGCCAAATTTCATCGATGTGTTTACGTGGTCCTTGCCATTTGTTGC
CGAAAAAGTAACAGAAATTCTTATAGCAGTACTCAATATTTGTACTGACG
AAGAGCTATTGCAAAAGAAAAAAGATGCAGTAATCTCTAAGAAAGTTGCT
CATAGAAAAGAAATCATAAAATATAAAATCAGAGCCATCGGCAAAATGTC
GAGAATATTTTCAATATTAAGAGAAGAAAGTGAGGCTATTCTGCTCTTAA
AAGGTTTGACTCCGAGTGGAGTTTTACCTATTGGAGTTCTGACAAACGGT
AGAGAATCTTTAAACTCAGCCATTACTGGCCTGACTTCCCGTAATGTGAT
TGGATCATTTGATGATGTGAAAATGCTTGACTTGGTTAATGAGAGAATGC
CACCGAAAAAAGATATAAATGCACGAACCAATCAAATTTCATCACTAAAG
TCTCCCAAAAATATCAAAAGTCCATCATCACAAATCACCTCAAATAAATC
AGTCCAATCCCAAGTTACTGCCGCTTTTGCTTCAACATCAAGAAAATGAT
AACATCATTTACTGCTTCTACTTTTTCAGTAAATTTGTGAATTGCTTTAT
TTTCTAGATTTTTATTTATTCCTTTAC
back to top

protein sequence of SMED30032458-orf-1

>SMED30032458-orf-1 ID=SMED30032458-orf-1|Name=SMED30032458-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=399bp
SIEVVLYLWALKSQHPTTLHLLRGNHECRHLTEYFTFKQECKIKYNDKIY
DACMDSFDCLPLSALINQQFLCVHGGLSPDFHNLEDIRRLDRFKEPPAFG
PMCDILWSDPVEDFGQERSNENFTHNTVRGCSYFYSYSAICNFLQNTNLL
CVIRAHEAQDSGYRMYRRNQATGFPSLITIFSAPNYLDVYNNKAAILKYE
NNVMNIRQFNFTPHPYWLPNFIDVFTWSLPFVAEKVTEILIAVLNICTDE
ELLQKKKDAVISKKVAHRKEIIKYKIRAIGKMSRIFSILREESEAILLLK
GLTPSGVLPIGVLTNGRESLNSAITGLTSRNVIGSFDDVKMLDLVNERMP
PKKDINARTNQISSLKSPKNIKSPSSQITSNKSVQSQVTAAFASTSRK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR006186Ser/Thr-sp_prot-phosphatase
IPR004843Calcineurin-like_PHP_ApaH
IPR029052Metallo-depent_PP-like
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0004721phosphoprotein phosphatase activity
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatasePRINTSPR00114STPHPHTASEcoord: 18..42
score: 54.4
coord: 81..108
score: 51.41
coord: 145..165
score: 34.88
coord: 52..78
score: 55.02
coord: 173..189
score: 57.46
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphataseSMARTSM00156pp2a_7coord: 1..219
e-value: 1.1E-64
score: 230.9
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatasePROSITEPS00125SER_THR_PHOSPHATASEcoord: 19..24
IPR029052Metallo-dependent phosphatase-likeGENE3DG3DSA:3.60.21.10coord: 2..251
e-value: 7.8E-140
score: 468.7
IPR004843Calcineurin-like phosphoesterase domain, ApaH typePFAMPF00149Metallophoscoord: 3..156
e-value: 1.2E-22
score: 81.5
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 219..242
e-value: 7.8E-140
score: 468.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 353..381
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 349..381
NoneNo IPR availablePANTHERPTHR45673:SF2SERINE/THREONINE-PROTEIN PHOSPHATASE 2B CATALYTIC SUBUNIT GAMMA ISOFORMcoord: 2..370
NoneNo IPR availablePANTHERPTHR45673FAMILY NOT NAMEDcoord: 2..370
NoneNo IPR availableSUPERFAMILYSSF56300Metallo-dependent phosphatasescoord: 1..336