Aldehyde dehydrogenase,putative

Overview
NameAldehyde dehydrogenase,putative
Smed IDSMED30032456
Length (bp)1686
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Aldehyde dehydrogenase,putative (SMED30032456) t-SNE clustered cells

Violin plots show distribution of expression levels for Aldehyde dehydrogenase,putative (SMED30032456) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Aldehyde dehydrogenase,putative (SMED30032456) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Aldehyde dehydrogenase,putative (SMED30032456) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032456

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 23

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gamma neoblastSMED30032456SMESG000001708.1 dd_Smed_v6_400_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
goblet cellSMED30032456SMESG000001708.1 dd_Smed_v6_400_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30032456SMESG000001708.1 SmedASXL_014963SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30032456SMESG000001708.1 dd_Smed_v4_400_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30032456SMESG000001708.1 dd_Smed_v4_400_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30032456SMESG000001708.1 dd_Smed_v4_400_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032456SMESG000001708.1 dd_Smed_v4_400_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032456SMESG000001708.1 dd_Smed_v4_400_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30032456SMESG000001708.1 dd_Smed_v4_400_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30032456SMESG000001708.1 dd_Smed_v4_400_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032456SMESG000001708.1 dd_Smed_v4_400_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032456SMESG000001708.1 Contig45871uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032456SMESG000001708.1 Contig45871newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032456SMESG000023001.1 SMESG000001724.1 SMESG000001723.1 SMESG000001708.1 SMESG000036236.1 Contig16751uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032456SMESG000023001.1 SMESG000001724.1 SMESG000001723.1 SMESG000001708.1 SMESG000036236.1 Contig16751newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032456SMESG000001723.1 SMESG000001708.1 Contig18634uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032456SMESG000001723.1 SMESG000001708.1 Contig18634newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032456SMESG000020187.1 SMESG000001724.1 SMESG000001723.1 SMESG000001708.1 SMESG000001725.1 Contig5202uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032456SMESG000020187.1 SMESG000001724.1 SMESG000001723.1 SMESG000001708.1 SMESG000001725.1 Contig5202newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032456SMESG000052420.1 Contig5202uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032456SMESG000052420.1 Contig5202newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
intestinal phagocyteSMED30032456SMESG000001708.1 dd_Smed_v6_400_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30032456SMESG000001708.1 dd_Smed_v6_400_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Human
Match: ALDH2 (aldehyde dehydrogenase 2 family member [Source:HGNC Symbol;Acc:HGNC:404])

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 295/487 (60.57%), Postives = 367/487 (75.36%), Query Frame = 3
Query:  135 PEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAK-GDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            PEV   +IFINNEW D+    TFPT+NP+  EVI QV EG  +D++KAVKAA++AF+ GS WR +DAS RG LLN+LADLIE +  Y++ LE LDNGK YVI+   DL+  +K LRYYAG+ADK HG T   DGDF SYTR EPVGV G IIPWN+P ++  +KL P +A G  +V+K AEQTPL+ALY+ +L+ +AGFP GVVNIVPG+GPTAGAA+ SH DV K+ FTGSTE+G +I    G+++LKRVTLELGGKSP II +DA ++D A   AH A   N GQCC AG+RTFV+  +YD  VE+    A+ R+VG+PFD KT QGPQVD+ QF KI+  I +GKQEGAKL+ GG    D G+FIQPTVFGDV+D M IAKEEIFGPV  + KF T+EEV+ RAN++ YGL A VFT D++KA  +SQ+L+AG+VW+NCYDV    +PFGG+K SG GRELG YGL+ Y EVK VT+ +PQKNS
Sbjct:   32 PEVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDA-DMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS 517          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Human
Match: ALDH1A2 (aldehyde dehydrogenase 1 family member A2 [Source:HGNC Symbol;Acc:HGNC:15472])

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 283/486 (58.23%), Postives = 367/486 (75.51%), Query Frame = 3
Query:  138 EVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIA-KGDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            E+K+TKIFINNEW +SE G  FP  NP   E + +VQE    DI+KAV+AA+ AF  GS WR +DAS+RG LL+KLADL+E +   ++ +E+L+ GK ++ A   DL+  +K  RYYAG+ADKIHG T   DGD+ ++TR EP+GV G IIPWN+P ++  +K+AP +  G T+VIKPAEQTPLSALY+G L+ +AGFP GV+NI+PGYGPTAGAA+ SH  + KI FTGSTEVG +I +  G ++LKRVTLELGGKSP IIFADA +LD A   AH+    N GQCC AG+R FVE S+Y+  V +  + A++R+VG PFD  T QGPQ+DK+Q+NKI++LI+SG  EGAKL  GG  +G  GFFI+PTVF +V D+MRIAKEEIFGPVQ + +F T++EVIERAN++ +GL A VFT+DINKA+ +S +++AG+VWINCY+     +PFGGFK SG GRE+G +GL  Y EVK VT+ IPQKNS
Sbjct:   34 EIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADA-DLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS 518          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Human
Match: ALDH1B1 (aldehyde dehydrogenase 1 family member B1 [Source:HGNC Symbol;Acc:HGNC:407])

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 283/487 (58.11%), Postives = 368/487 (75.56%), Query Frame = 3
Query:  135 PEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKG-DLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            P++ + ++FINNEW D+    TFPT+NPT  EVI  V EG   D+++AVKAA+ AF+ GS WR +DAS+RG LLN+LADL+E +  Y++ LE LDNGK +  +   DL+  +K+ RY+AG+ADK HG T   DG    +TR EPVGV G IIPWN+P ++  +KLAP +A G T+V+K AEQTPLSALYL  L+ +AGFP GVVNI+ GYGPTAGAA+  H DV K+ FTGSTEVGH+I K  G+++LKRVTLELGGKSP I+ ADA +++ A    HEA   N GQCC AG+RTFVE S+Y+  +E+  + A++R VG+PF+  T QGPQVDKEQF +++  I+ G++EGAKL+ GG R G+ GFFI+PTVFG V+D+MRIAKEEIFGPVQ +FKF  +EEV+ERAN+T YGL A VFT D++KA+  +Q+L+AG+VW+N Y++    TPFGGFK+SG GRELG  GL+ Y EVK VTI +PQKNS
Sbjct:   32 PDIPYNQLFINNEWQDAVSKKTFPTVNPTTGEVIGHVAEGDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNRLADLVERDRVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKWHGKTIPMDGQHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHVDVDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADA-DMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKNS 517          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Human
Match: ALDH1A2 (aldehyde dehydrogenase 1 family member A2 [Source:HGNC Symbol;Acc:HGNC:15472])

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 283/490 (57.76%), Postives = 365/490 (74.49%), Query Frame = 3
Query:  126 MSAPEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIA-KGDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            M     K TKIFINNEW +SE G  FP  NP   E + +VQE    DI+KAV+AA+ AF  GS WR +DAS+RG LL+KLADL+E +   ++ +E+L+ GK ++ A   DL+  +K  RYYAG+ADKIHG T   DGD+ ++TR EP+GV G IIPWN+P ++  +K+AP +  G T+VIKPAEQTPLSALY+G L+ +AGFP GV+NI+PGYGPTAGAA+ SH  + KI FTGSTEVG +I +  G ++LKRVTLELGGKSP IIFADA +LD A   AH+    N GQCC AG+R FVE S+Y+  V +  + A++R+VG PFD  T QGPQ+DK+Q+NKI++LI+SG  EGAKL  GG  +G  GFFI+PTVF +V D+MRIAKEEIFGPVQ + +F T++EVIERAN++ +GL A VFT+DINKA+ +S +++AG+VWINCY+     +PFGGFK SG GRE+G +GL  Y EVK VT+ IPQKNS
Sbjct:    1 MKGRNWKTTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADA-DLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS 489          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Human
Match: ALDH1A2 (aldehyde dehydrogenase 1 family member A2 [Source:HGNC Symbol;Acc:HGNC:15472])

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 280/485 (57.73%), Postives = 363/485 (74.85%), Query Frame = 3
Query:  141 VKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIA-KGDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            +K   IFINNEW +SE G  FP  NP   E + +VQE    DI+KAV+AA+ AF  GS WR +DAS+RG LL+KLADL+E +   ++ +E+L+ GK ++ A   DL+  +K  RYYAG+ADKIHG T   DGD+ ++TR EP+GV G IIPWN+P ++  +K+AP +  G T+VIKPAEQTPLSALY+G L+ +AGFP GV+NI+PGYGPTAGAA+ SH  + KI FTGSTEVG +I +  G ++LKRVTLELGGKSP IIFADA +LD A   AH+    N GQCC AG+R FVE S+Y+  V +  + A++R+VG PFD  T QGPQ+DK+Q+NKI++LI+SG  EGAKL  GG  +G  GFFI+PTVF +V D+MRIAKEEIFGPVQ + +F T++EVIERAN++ +GL A VFT+DINKA+ +S +++AG+VWINCY+     +PFGGFK SG GRE+G +GL  Y EVK VT+ IPQKNS
Sbjct:   14 IKLKLIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADA-DLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS 497          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Celegans
Match: alh-1 (ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;Acc:Q20780])

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 283/490 (57.76%), Postives = 371/490 (75.71%), Query Frame = 3
Query:  126 MSAPEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIA-KGDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            +S  + ++T IFINNE+  ++ G TF TINP N +V+ QV EG   D+N AVKAA++AF+ GSEWR +DAS+RG+LLN+LADL+E +   ++ LE+LDNGK Y +A   DL  S+K LRYYAG+ADK HG T   +GD+ +YTR EPVGV G IIPWN+P ++  +KL P +A G T+V+K AEQTPLSAL++  L  +AGFP GVVNI+PGYG TAG A++SH DV K+ FTGSTEVG ++MK    +++K+VTLELGGKSP IIFADA +L+++   A+     N GQCC AG+RTFVE  +YD  V + ++LAEK ++GDPFD KT QGPQVD +Q   I+  I +GK++GA+LVTGG + GD G F++PT+F +VKD M IA+EEIFGPV ++ +F+T+EE++E+AN+T YGL AGV T DI+KA+ ++ +  AGSVW+NCYDV     PFGGFKQSGIGRELG YGLE Y EVK VTI +PQKNS
Sbjct:   22 LSNMKPQYTGIFINNEFVPAKSGKTFETINPANGKVLAQVAEGDKTDVNIAVKAAQNAFRIGSEWRRMDASQRGVLLNRLADLMERDRVILASLESLDNGKPYAVAYNADLPLSIKTLRYYAGWADKNHGKTIPIEGDYFTYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALAMGNTVVMKVAEQTPLSALHVAALTKEAGFPDGVVNIIPGYGHTAGQAISSHMDVDKVAFTGSTEVGRLVMKAAAESNVKKVTLELGGKSPNIIFADA-DLNDSVHQANHGLFFNQGQCCCAGSRTFVEGKIYDDFVARSKELAEKAVIGDPFDLKTTQGPQVDGKQVETILKYIAAGKKDGAQLVTGGAKHGDQGHFVKPTIFANVKDQMTIAQEEIFGPVMTIIRFDTMEELVEKANNTIYGLAAGVMTKDIDKALHIANATRAGSVWVNCYDVFDAAAPFGGFKQSGIGRELGEYGLEAYTEVKTVTIKVPQKNS 510          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Celegans
Match: alh-1 (ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;Acc:Q20780])

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 283/490 (57.76%), Postives = 371/490 (75.71%), Query Frame = 3
Query:  126 MSAPEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIA-KGDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            +S  + ++T IFINNE+  ++ G TF TINP N +V+ QV EG   D+N AVKAA++AF+ GSEWR +DAS+RG+LLN+LADL+E +   ++ LE+LDNGK Y +A   DL  S+K LRYYAG+ADK HG T   +GD+ +YTR EPVGV G IIPWN+P ++  +KL P +A G T+V+K AEQTPLSAL++  L  +AGFP GVVNI+PGYG TAG A++SH DV K+ FTGSTEVG ++MK    +++K+VTLELGGKSP IIFADA +L+++   A+     N GQCC AG+RTFVE  +YD  V + ++LAEK ++GDPFD KT QGPQVD +Q   I+  I +GK++GA+LVTGG + GD G F++PT+F +VKD M IA+EEIFGPV ++ +F+T+EE++E+AN+T YGL AGV T DI+KA+ ++ +  AGSVW+NCYDV     PFGGFKQSGIGRELG YGLE Y EVK VTI +PQKNS
Sbjct:   22 LSNMKPQYTGIFINNEFVPAKSGKTFETINPANGKVLAQVAEGDKTDVNIAVKAAQNAFRIGSEWRRMDASQRGVLLNRLADLMERDRVILASLESLDNGKPYAVAYNADLPLSIKTLRYYAGWADKNHGKTIPIEGDYFTYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALAMGNTVVMKVAEQTPLSALHVAALTKEAGFPDGVVNIIPGYGHTAGQAISSHMDVDKVAFTGSTEVGRLVMKAAAESNVKKVTLELGGKSPNIIFADA-DLNDSVHQANHGLFFNQGQCCCAGSRTFVEGKIYDDFVARSKELAEKAVIGDPFDLKTTQGPQVDGKQVETILKYIAAGKKDGAQLVTGGAKHGDQGHFVKPTIFANVKDQMTIAQEEIFGPVMTIIRFDTMEELVEKANNTIYGLAAGVMTKDIDKALHIANATRAGSVWVNCYDVFDAAAPFGGFKQSGIGRELGEYGLEAYTEVKTVTIKVPQKNS 510          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Celegans
Match: alh-2 (ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;Acc:Q9TXM0])

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 280/484 (57.85%), Postives = 362/484 (74.79%), Query Frame = 3
Query:  144 KFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKG-DLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            K+T +FINNE+ D++ G TF  +NP N +++ +V EG   D++ AV+AAK AFK GSEWR +DAS RG+LLN+LADL+E +   ++ LE+LDNGK Y  A   DL  S+K  RYYAGYADK HG T    GD+ +YTR EPVGV G IIPWN+P ++  +KLAP +A G T+V+K A +TPLSAL++  L+ +A FP+GVVNI+PG G  AG A+ SH DV K+ FTGSTEVG  IMK    +++K+VTLELGGKSP I+FADA +L+EA   +H A   N GQCC AG+RTFVE  +YD  V K ++L EK ++GDPFDE T QGPQ+D+ Q   IM  IESGK+EGA+LVTGG + GD G+F++PT+F +V D M+IA+EEIFGPV  V +F+++EE+IE+AN+T YGL AGV T+D+NKA+ ++ ++ AGSVW+NCYDV     PFGGFKQSGIGRELG YGL  Y EVK VTI +PQKNS
Sbjct:   32 KYTSLFINNEFVDAKSGKTFEFVNPANGKLLAKVAEGNRDDVDIAVEAAKKAFKIGSEWRRMDASHRGVLLNRLADLMERDRVILASLESLDNGKPYKEAYNIDLPISIKTFRYYAGYADKNHGKTIPVGGDYFTYTRHEPVGVCGQIIPWNFPLLMQAWKLAPALAMGNTVVMKVAVKTPLSALHVASLIKEAQFPEGVVNIIPGRGTDAGEAIASHMDVDKVAFTGSTEVGKTIMKAAAESNVKKVTLELGGKSPNIVFADA-DLEEAVRQSHHALFFNQGQCCSAGSRTFVEGKIYDEFVAKAKELVEKTVIGDPFDENTTQGPQIDESQVETIMKYIESGKKEGAQLVTGGVKHGDQGYFVKPTIFANVNDQMKIAQEEIFGPVMIVIRFDSMEELIEKANNTIYGLAAGVVTNDLNKALQVANTIRAGSVWVNCYDVFDPAAPFGGFKQSGIGRELGEYGLAAYTEVKTVTIKVPQKNS 514          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Celegans
Match: alh-1 (ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;Acc:Q20780])

HSP 1 Score: 523.087 bits (1346), Expect = 0.000e+0
Identity = 248/423 (58.63%), Postives = 323/423 (76.36%), Query Frame = 3
Query:  327 LDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIA-KGDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            +DAS+RG+LLN+LADL+E +   ++ LE+LDNGK Y +A   DL  S+K LRYYAG+ADK HG T   +GD+ +YTR EPVGV G IIPWN+P ++  +KL P +A G T+V+K AEQTPLSAL++  L  +AGFP GVVNI+PGYG TAG A++SH DV K+ FTGSTEVG ++MK    +++K+VTLELGGKSP IIFADA +L+++   A+     N GQCC AG+RTFVE  +YD  V + ++LAEK ++GDPFD KT QGPQVD +Q   I+  I +GK++GA+LVTGG + GD G F++PT+F +VKD M IA+EEIFGPV ++ +F+T+EE++E+AN+T YGL AGV T DI+KA+ ++ +  AGSVW+NCYDV     PFGGFKQSGIGRELG YGLE Y EVK VTI +PQKNS
Sbjct:    1 MDASQRGVLLNRLADLMERDRVILASLESLDNGKPYAVAYNADLPLSIKTLRYYAGWADKNHGKTIPIEGDYFTYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALAMGNTVVMKVAEQTPLSALHVAALTKEAGFPDGVVNIIPGYGHTAGQAISSHMDVDKVAFTGSTEVGRLVMKAAAESNVKKVTLELGGKSPNIIFADA-DLNDSVHQANHGLFFNQGQCCCAGSRTFVEGKIYDDFVARSKELAEKAVIGDPFDLKTTQGPQVDGKQVETILKYIAAGKKDGAQLVTGGAKHGDQGHFVKPTIFANVKDQMTIAQEEIFGPVMTIIRFDTMEELVEKANNTIYGLAAGVMTKDIDKALHIANATRAGSVWVNCYDVFDAAAPFGGFKQSGIGRELGEYGLEAYTEVKTVTIKVPQKNS 422          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Celegans
Match: alh-1 (ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;Acc:Q20780])

HSP 1 Score: 523.087 bits (1346), Expect = 0.000e+0
Identity = 248/423 (58.63%), Postives = 323/423 (76.36%), Query Frame = 3
Query:  327 LDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIA-KGDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            +DAS+RG+LLN+LADL+E +   ++ LE+LDNGK Y +A   DL  S+K LRYYAG+ADK HG T   +GD+ +YTR EPVGV G IIPWN+P ++  +KL P +A G T+V+K AEQTPLSAL++  L  +AGFP GVVNI+PGYG TAG A++SH DV K+ FTGSTEVG ++MK    +++K+VTLELGGKSP IIFADA +L+++   A+     N GQCC AG+RTFVE  +YD  V + ++LAEK ++GDPFD KT QGPQVD +Q   I+  I +GK++GA+LVTGG + GD G F++PT+F +VKD M IA+EEIFGPV ++ +F+T+EE++E+AN+T YGL AGV T DI+KA+ ++ +  AGSVW+NCYDV     PFGGFKQSGIGRELG YGLE Y EVK VTI +PQKNS
Sbjct:    1 MDASQRGVLLNRLADLMERDRVILASLESLDNGKPYAVAYNADLPLSIKTLRYYAGWADKNHGKTIPIEGDYFTYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALAMGNTVVMKVAEQTPLSALHVAALTKEAGFPDGVVNIIPGYGHTAGQAISSHMDVDKVAFTGSTEVGRLVMKAAAESNVKKVTLELGGKSPNIIFADA-DLNDSVHQANHGLFFNQGQCCCAGSRTFVEGKIYDDFVARSKELAEKAVIGDPFDLKTTQGPQVDGKQVETILKYIAAGKKDGAQLVTGGAKHGDQGHFVKPTIFANVKDQMTIAQEEIFGPVMTIIRFDTMEELVEKANNTIYGLAAGVMTKDIDKALHIANATRAGSVWVNCYDVFDAAAPFGGFKQSGIGRELGEYGLEAYTEVKTVTIKVPQKNS 422          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Fly
Match: CG31075 (gene:FBgn0051075 transcript:FBtr0085080)

HSP 1 Score: 548.125 bits (1411), Expect = 0.000e+0
Identity = 266/478 (55.65%), Postives = 354/478 (74.06%), Query Frame = 3
Query:  144 KFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKGDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAI 1577
            K+TK+FINNE+ DS  G TF T NP   + IVQV EG   DI+ AVKAAK AF   SEWR L   +R  L+NKL  L++ +  +++ LE  DNGK Y  A  D+ +S+  L+YYAG+ DK  G+T  P G F+S TR EPVGVVG IIPWNYP ++  +K  P +A GCT+++KPAEQTPL+AL++  L  +AGFP GV+N+V G+GPTAGAA+++HPD+ K+ FTGS E+G I+M+    ++LKRV+LELGGKSP+++F DA ++D A  T HEA  +NHGQ C AG+RT+V   +YD  V K    A+ R VG+PF++   QGPQ+D +   K++  IESGK+EGAKL  GG R+G+VGFF++PTVF DVKD+MRIA+EEIFGPVQS+FKF+++EE+I+RAN+  YGL AGV T+DINKA+  + +++AGSVWINCYD  L +TPFGG+K SGIGRELG  GL+ YLE K +T+ +
Sbjct:    9 KYTKLFINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAVKAAKKAFHRDSEWRKLSPLQRTNLMNKLCALMDRDKAFLASLETQDNGKPYAEALFDVTYSILTLQYYAGWTDKFFGDTI-PAGGFVSMTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTIIMKPAEQTPLTALHMAALAKEAGFPAGVINVVNGFGPTAGAAISAHPDIAKVAFTGSVEIGRIVMQAAATSNLKRVSLELGGKSPVVVFDDA-DIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVAKAAAKAKARKVGNPFEQNVQQGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKRIGNVGFFVEPTVFSDVKDDMRIAQEEIFGPVQSIFKFSSLEEMIDRANNVQYGLAAGVITNDINKALKFANNVDAGSVWINCYDAVLPSTPFGGYKHSGIGRELGKDGLDNYLETKTITMKL 484          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Fly
Match: CG31075 (gene:FBgn0051075 transcript:FBtr0307506)

HSP 1 Score: 544.273 bits (1401), Expect = 0.000e+0
Identity = 264/480 (55.00%), Postives = 353/480 (73.54%), Query Frame = 3
Query:  138 EVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKGDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAI 1577
            E  + ++FINNE+ DS  G TF T NP   + IVQV EG   DI+ AVKAAK AF   SEWR L   +R  L+NKL  L++ +  +++ LE  DNGK Y  A  D+ +S+  L+YYAG+ DK  G+T  P G F+S TR EPVGVVG IIPWNYP ++  +K  P +A GCT+++KPAEQTPL+AL++  L  +AGFP GV+N+V G+GPTAGAA+++HPD+ K+ FTGS E+G I+M+    ++LKRV+LELGGKSP+++F DA ++D A  T HEA  +NHGQ C AG+RT+V   +YD  V K    A+ R VG+PF++   QGPQ+D +   K++  IESGK+EGAKL  GG R+G+VGFF++PTVF DVKD+MRIA+EEIFGPVQS+FKF+++EE+I+RAN+  YGL AGV T+DINKA+  + +++AGSVWINCYD  L +TPFGG+K SGIGRELG  GL+ YLE K +T+ +
Sbjct:   30 EPNYCQLFINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAVKAAKKAFHRDSEWRKLSPLQRTNLMNKLCALMDRDKAFLASLETQDNGKPYAEALFDVTYSILTLQYYAGWTDKFFGDTI-PAGGFVSMTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTIIMKPAEQTPLTALHMAALAKEAGFPAGVINVVNGFGPTAGAAISAHPDIAKVAFTGSVEIGRIVMQAAATSNLKRVSLELGGKSPVVVFDDA-DIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVAKAAAKAKARKVGNPFEQNVQQGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKRIGNVGFFVEPTVFSDVKDDMRIAQEEIFGPVQSIFKFSSLEEMIDRANNVQYGLAAGVITNDINKALKFANNVDAGSVWINCYDAVLPSTPFGGYKHSGIGRELGKDGLDNYLETKTITMKL 507          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Fly
Match: Aldh (gene:FBgn0012036 transcript:FBtr0332597)

HSP 1 Score: 541.191 bits (1393), Expect = 0.000e+0
Identity = 275/490 (56.12%), Postives = 359/490 (73.27%), Query Frame = 3
Query:  129 SAPEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKG-DLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRV-GDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            + P++ +T +FINNEW  S+ G  F TINPT  EVI ++Q    +DI+ AV+AA++AFK GS WR +DAS+RG LL +LADL+E +  Y++ LE LDNGK Y ++   DL  ++K LRY+AG+ADK HG T   DGDF +YTR EPVGV G IIPWN+P ++  +KL P +A G T+V+KPAEQT L+ALY+  LV +AGFP+GVVN+VPG+G TAGAAL +H DV K+ FTGST+VG +I    GNT+LKRVTLELGGKSP II +D  ++D A  TAH     N GQCC AG+RTFVE  +YD  VE+  + A+KR VG+PFD  T QGPQV++EQ  KI+ +I++GK++GAKLV GG+R  G  G+F+QPTVF DV+D+M IA+EEIFGPVQ + +F  ++EVIERAN++ YGL A VFT D++KA  +   L AG+VW+N Y+V     PFGG+K SG GRE G Y L  Y EVK+V + + QKNS
Sbjct:   33 TTPDILYTGVFINNEWHKSKSGKIFETINPTTAEVIAEIQCADKEDIDIAVQAARNAFKLGSPWRRMDASERGRLLYRLADLMERDQVYLASLETLDNGKPYSMSYNVDLPTAIKNLRYFAGWADKNHGKTIPMDGDFFTYTRHEPVGVCGQIIPWNFPILMMAWKLGPALATGNTIVLKPAEQTSLTALYIAQLVKEAGFPEGVVNVVPGFG-TAGAALANHCDVDKVAFTGSTDVGKLIQLASGNTNLKRVTLELGGKSPNIILSDT-DMDYAVETAHFGLFFNMGQCCCAGSRTFVEDKIYDEFVERSAERAKKRTVGNPFDLNTEQGPQVNEEQMEKILGMIKTGKKQGAKLVAGGSRPEGLPGYFVQPTVFADVQDDMTIAREEIFGPVQQLIRFKKLDEVIERANNSEYGLAAAVFTKDLDKANYIVGGLRAGTVWVNTYNVLAAQAPFGGYKMSGHGRENGEYALSNYTEVKSVIVKVAQKNS 520          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Fly
Match: Aldh (gene:FBgn0012036 transcript:FBtr0079806)

HSP 1 Score: 541.191 bits (1393), Expect = 0.000e+0
Identity = 275/490 (56.12%), Postives = 359/490 (73.27%), Query Frame = 3
Query:  129 SAPEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKG-DLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRV-GDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            + P++ +T +FINNEW  S+ G  F TINPT  EVI ++Q    +DI+ AV+AA++AFK GS WR +DAS+RG LL +LADL+E +  Y++ LE LDNGK Y ++   DL  ++K LRY+AG+ADK HG T   DGDF +YTR EPVGV G IIPWN+P ++  +KL P +A G T+V+KPAEQT L+ALY+  LV +AGFP+GVVN+VPG+G TAGAAL +H DV K+ FTGST+VG +I    GNT+LKRVTLELGGKSP II +D  ++D A  TAH     N GQCC AG+RTFVE  +YD  VE+  + A+KR VG+PFD  T QGPQV++EQ  KI+ +I++GK++GAKLV GG+R  G  G+F+QPTVF DV+D+M IA+EEIFGPVQ + +F  ++EVIERAN++ YGL A VFT D++KA  +   L AG+VW+N Y+V     PFGG+K SG GRE G Y L  Y EVK+V + + QKNS
Sbjct:   33 TTPDILYTGVFINNEWHKSKSGKIFETINPTTAEVIAEIQCADKEDIDIAVQAARNAFKLGSPWRRMDASERGRLLYRLADLMERDQVYLASLETLDNGKPYSMSYNVDLPTAIKNLRYFAGWADKNHGKTIPMDGDFFTYTRHEPVGVCGQIIPWNFPILMMAWKLGPALATGNTIVLKPAEQTSLTALYIAQLVKEAGFPEGVVNVVPGFG-TAGAALANHCDVDKVAFTGSTDVGKLIQLASGNTNLKRVTLELGGKSPNIILSDT-DMDYAVETAHFGLFFNMGQCCCAGSRTFVEDKIYDEFVERSAERAKKRTVGNPFDLNTEQGPQVNEEQMEKILGMIKTGKKQGAKLVAGGSRPEGLPGYFVQPTVFADVQDDMTIAREEIFGPVQQLIRFKKLDEVIERANNSEYGLAAAVFTKDLDKANYIVGGLRAGTVWVNTYNVLAAQAPFGGYKMSGHGRENGEYALSNYTEVKSVIVKVAQKNS 520          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Fly
Match: CG8665 (gene:FBgn0032945 transcript:FBtr0081517)

HSP 1 Score: 413.69 bits (1062), Expect = 2.436e-134
Identity = 220/493 (44.62%), Postives = 319/493 (64.71%), Query Frame = 3
Query:  120 IKMSAPEVKF-TKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIA-KGDLEFSVKILRYYAGYADKIHGNTTSPD----GDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDV-GFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFN--TVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTI 1571
            +K +  E++  T++FIN E+ D+E   T   +NPTNEEV+ +V      D++KAV+AA SAF     WR +   +RG L+  LADL+E N + ++ +E++D+G  Y +A K  +  S++  RY+AG+ DKI GNT   +     + L++TR EP+GV G I PWNYP M+  +K+A  +AAG T +IKPA+  PL+AL   +L ++AGFP GV+N++PG G  AG A+  H  VRK+ FTGST +G  IMK+  +++LK+ +LELGGKSPLIIFAD  ++D+A      +   N G+ C+A  R FVE  ++D  + ++ K      +GDP D  T  GPQ  K  F+K+++    G  EGAKLV GG RV ++ G+F  PTVF +V D+M IA+EE FGP+  + KFN   ++ +++RAN T YGL +GVFT DI KA+  +  +EAG+V++N Y+   V  PFGGFKQSG G++LG   L  YL+ K VT+
Sbjct:  422 LKANKREIRVPTQLFINGEFVDAEAQRTLEIVNPTNEEVLCKVACASATDVDKAVRAAHSAFY--GSWRQITPRQRGQLMLNLADLMERNKEELATIESVDSGAVYTLALKTHVGMSIEAWRYFAGWCDKIQGNTIPVNPARPNNVLTFTRKEPIGVCGLITPWNYPLMMLSWKMAACIAAGNTCLIKPAQTCPLTALKFAELTVRAGFPPGVINVLPGKGSDAGQAVADHELVRKLGFTGSTPIGKHIMKSCADSNLKKCSLELGGKSPLIIFADC-DMDKAVKHGMSSVFFNKGENCIAAGRLFVEDRIHDEFIRRVLKDLRTMTIGDPLDRSTAHGPQNHKAHFDKLLEFCRRGVDEGAKLVYGGCRVPNLKGYFFTPTVFTNVTDDMFIAQEESFGPIMIISKFNGSDIDSLMQRANRTEYGLASGVFTKDIGKALNFADRIEAGTVFVNVYNKTDVAAPFGGFKQSGYGKDLGQEALNEYLKTKCVTV 911          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Zebrafish
Match: aldh2.1 (aldehyde dehydrogenase 2 family member, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1262])

HSP 1 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 292/487 (59.96%), Postives = 361/487 (74.13%), Query Frame = 3
Query:  135 PEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKG-DLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            P+V + KIFINNEW D+    TFPTINP   EVI  V EG   D++KAVKAA+ AFK GS WR +DAS+RG+LL++LAD IE +A Y++ LE LDNGK Y ++   DL   VK LRYYAG+ADK  G T   DG++  YTR EP+GV G IIPWN+P ++   KL P +A G T+V+K AEQTPL+ALY+  L+ + GFP GVVNI+PG+GPTAGAA+ SH DV K+ FTGST+VGH+I +    ++LK V+LELGGKSP II +DA N++EA   AH A   N GQCC AGTRTFV+ S+YD  VE+  + A+ RIVGDPFD  T QGPQVD++QF K++  I SGK+EGAKL+ GG    + G+FIQPTVFGDVKD+M IA+EEIFGPV  + KF ++EEVIERAND+ YGL   VFT DI+KA  +S  L AG+VWINCY+V  V  PFGG+K SGIGRELG YGL+ Y EVK VTI +PQKNS
Sbjct:   31 PDVHYNKIFINNEWHDAVSKKTFPTINPATAEVICHVAEGDKADVDKAVKAARDAFKLGSPWRRMDASQRGLLLSRLADCIERDAAYLAELETLDNGKPYTLSFCVDLPMVVKCLRYYAGWADKWEGKTIPIDGNYFCYTRHEPIGVCGQIIPWNFPLLMQALKLGPALATGNTVVMKVAEQTPLTALYIASLIKEVGFPAGVVNIIPGFGPTAGAAIASHMDVDKVAFTGSTDVGHLIQQASSASNLKNVSLELGGKSPNIILSDA-NMEEAVEQAHSALFFNQGQCCCAGTRTFVQESIYDEFVERSVERAKNRIVGDPFDLNTEQGPQVDEDQFKKVLGYISSGKREGAKLMCGGAPAAERGYFIQPTVFGDVKDDMTIAREEIFGPVMQILKFKSLEEVIERANDSKYGLAGAVFTQDIDKANYISHGLRAGTVWINCYNVFGVQAPFGGYKASGIGRELGEYGLDIYTEVKTVTIKVPQKNS 516          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Zebrafish
Match: aldh2.2 (aldehyde dehydrogenase 2 family member, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-030326-5])

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 287/487 (58.93%), Postives = 362/487 (74.33%), Query Frame = 3
Query:  135 PEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKG-DLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            P+V + KIFINNEW D+    TFPTINP   E+I  V EG   D++KAVKAA+ AFK GS WR +DAS+RG+LL++LAD IE +A Y++ LE LDNGK Y ++   D+   VK +RYYAG+ADK  G T   DG++  YTR EP+GV G IIPWN+P ++  +KL P +A G T+V+K AEQTPL+ALY+  L+ + GFP GVVNI+PG GPTAGAA+ SH DV K+ FTGST+VGH+I +    ++LK+VTLELGGKSP II +DA N++EA   +H A   N GQCC AGTRTFV+ S+YD  VE+  + A+ RIVGDPFD  T QGPQV+++QF K++  I SGK+EGAKL+ GG    + G+FIQPTVFGDVKD+M IA+EEIFGPV  + KF ++EEVIERAND+ YGL   VFT DI+KA  +S  L AG+VWINCY+V  V  PFGG+K SGIGRE+G YGLE Y EVK VTI +P+KNS
Sbjct:   31 PDVHYNKIFINNEWHDAVSKKTFPTINPATGEIICHVAEGDKADVDKAVKAARDAFKLGSPWRRMDASQRGLLLSRLADCIERDAAYLAELETLDNGKPYAVSFSVDVPMVVKCMRYYAGWADKWEGKTIPIDGNYFCYTRHEPIGVCGQIIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTPLTALYIASLIKEVGFPAGVVNIIPGMGPTAGAAIASHMDVDKVAFTGSTDVGHLIQRASSASNLKKVTLELGGKSPNIILSDA-NMEEAVEQSHIALFFNQGQCCCAGTRTFVQESIYDEFVERSVERAKNRIVGDPFDLNTEQGPQVNEDQFKKVLGYISSGKREGAKLMCGGAPAAERGYFIQPTVFGDVKDDMTIAREEIFGPVMQILKFKSLEEVIERANDSKYGLAGAVFTQDIDKANYISHGLRAGTVWINCYNVFGVQAPFGGYKASGIGREMGEYGLENYTEVKTVTIKVPEKNS 516          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Zebrafish
Match: aldh2.2 (aldehyde dehydrogenase 2 family member, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-030326-5])

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 287/487 (58.93%), Postives = 362/487 (74.33%), Query Frame = 3
Query:  135 PEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKG-DLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            P+V + KIFINNEW D+    TFPTINP   E+I  V EG   D++KAVKAA+ AFK GS WR +DAS+RG+LL++LAD IE +A Y++ LE LDNGK Y ++   D+   VK +RYYAG+ADK  G T   DG++  YTR EP+GV G IIPWN+P ++  +KL P +A G T+V+K AEQTPL+ALY+  L+ + GFP GVVNI+PG GPTAGAA+ SH DV K+ FTGST+VGH+I +    ++LK+VTLELGGKSP II +DA N++EA   +H A   N GQCC AGTRTFV+ S+YD  VE+  + A+ RIVGDPFD  T QGPQV+++QF K++  I SGK+EGAKL+ GG    + G+FIQPTVFGDVKD+M IA+EEIFGPV  + KF ++EEVIERAND+ YGL   VFT DI+KA  +S  L AG+VWINCY+V  V  PFGG+K SGIGRE+G YGLE Y EVK VTI +P+KNS
Sbjct:   31 PDVHYNKIFINNEWHDAVSKKTFPTINPATGEIICHVAEGDKADVDKAVKAARDAFKLGSPWRRMDASQRGLLLSRLADCIERDAAYLAELETLDNGKPYAVSFSVDVPMVVKCMRYYAGWADKWEGKTIPIDGNYFCYTRHEPIGVCGQIIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTPLTALYIASLIKEVGFPAGVVNIIPGMGPTAGAAIASHMDVDKVAFTGSTDVGHLIQRASSASNLKKVTLELGGKSPNIILSDA-NMEEAVEQSHIALFFNQGQCCCAGTRTFVQESIYDEFVERSVERAKNRIVGDPFDLNTEQGPQVNEDQFKKVLGYISSGKREGAKLMCGGAPAAERGYFIQPTVFGDVKDDMTIAREEIFGPVMQILKFKSLEEVIERANDSKYGLAGAVFTQDIDKANYISHGLRAGTVWINCYNVFGVQAPFGGYKASGIGREMGEYGLENYTEVKTVTIKVPEKNS 516          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Zebrafish
Match: aldh1a2 (aldehyde dehydrogenase 1 family, member A2 [Source:ZFIN;Acc:ZDB-GENE-011010-3])

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 276/487 (56.67%), Postives = 357/487 (73.31%), Query Frame = 3
Query:  135 PEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKG-DLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            PE+K+TKIFINNEW DS  G  F T NP   E I  VQE    D++KAV+AA+SAF  GS WR +DAS+RG LL KLADL+E ++ Y++ LE+LD+GK ++     DL+  +K  RYYAG+ADKIHG+T   DG+F + TR EP+GV G IIPWN+P ++  +KL P ++ G T+V+KPAEQTPL+ LYLG L+ +AGFP GVVNI+PGYGPTAGAA++SH  + K+ FTGSTEVG +I +  G ++LKRVTLELGGKSP IIFADA + + A   AH+    N+GQCC AG+R FVE  +YD  V +  + A++R VG+PFD  T  GPQV +EQ  ++++LI+SG  EGAKL  GG      GFF++PTVF +VKD+MRIAKEEIFGPVQ + KF T+EEVIERAN+T YGL A VFT DI+KA+ +S +++AG+VWINCY+      PFGGFK SG GRELG  GL+ Y E+K +T+ +  K S
Sbjct:   33 PEIKYTKIFINNEWHDSVSGKVFHTYNPATGEKICDVQESDKADVDKAVQAARSAFSLGSVWRKMDASERGKLLFKLADLVERDSAYLATLESLDSGKPFLPCFFVDLQGIIKTFRYYAGWADKIHGSTIPIDGEFFTLTRHEPIGVCGQIIPWNFPLVMTAWKLGPALSCGNTVVLKPAEQTPLTCLYLGALIKEAGFPPGVVNILPGYGPTAGAAISSHMGIDKVAFTGSTEVGKLIQEAAGKSNLKRVTLELGGKSPNIIFADA-DFELALEQAHQGVFFNNGQCCTAGSRIFVEEPIYDEFVRRSVERAQRRKVGNPFDPTTEHGPQVSEEQQRRVLELIQSGITEGAKLECGGKAPPTKGFFVEPTVFSNVKDHMRIAKEEIFGPVQQIMKFKTIEEVIERANNTEYGLAAAVFTRDISKAMTISAAVQAGTVWINCYNALSCQCPFGGFKMSGNGRELGEIGLKEYTELKTITMKMSGKTS 518          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Zebrafish
Match: aldh1a2 (aldehyde dehydrogenase 1 family, member A2 [Source:ZFIN;Acc:ZDB-GENE-011010-3])

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 276/487 (56.67%), Postives = 357/487 (73.31%), Query Frame = 3
Query:  135 PEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKG-DLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            PE+K+TKIFINNEW DS  G  F T NP   E I  VQE    D++KAV+AA+SAF  GS WR +DAS+RG LL KLADL+E ++ Y++ LE+LD+GK ++     DL+  +K  RYYAG+ADKIHG+T   DG+F + TR EP+GV G IIPWN+P ++  +KL P ++ G T+V+KPAEQTPL+ LYLG L+ +AGFP GVVNI+PGYGPTAGAA++SH  + K+ FTGSTEVG +I +  G ++LKRVTLELGGKSP IIFADA + + A   AH+    N+GQCC AG+R FVE  +YD  V +  + A++R VG+PFD  T  GPQV +EQ  ++++LI+SG  EGAKL  GG      GFF++PTVF +VKD+MRIAKEEIFGPVQ + KF T+EEVIERAN+T YGL A VFT DI+KA+ +S +++AG+VWINCY+      PFGGFK SG GRELG  GL+ Y E+K +T+ +  K S
Sbjct:   33 PEIKYTKIFINNEWHDSVSGKVFHTYNPATGEKICDVQESDKADVDKAVQAARSAFSLGSVWRKMDASERGKLLFKLADLVERDSAYLATLESLDSGKPFLPCFFVDLQGIIKTFRYYAGWADKIHGSTIPIDGEFFTLTRHEPIGVCGQIIPWNFPLVMTAWKLGPALSCGNTVVLKPAEQTPLTCLYLGALIKEAGFPPGVVNILPGYGPTAGAAISSHMGIDKVAFTGSTEVGKLIQEAAGKSNLKRVTLELGGKSPNIIFADA-DFELALEQAHQGVFFNNGQCCTAGSRIFVEEPIYDEFVRRSVERAQRRKVGNPFDPTTEHGPQVSEEQQRRVLELIQSGITEGAKLECGGKAPPTKGFFVEPTVFSNVKDHMRIAKEEIFGPVQQIMKFKTIEEVIERANNTEYGLAAAVFTRDISKAMTISAAVQAGTVWINCYNALSCQCPFGGFKMSGNGRELGEIGLKEYTELKTITMKMSGKTS 518          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Xenopus
Match: mamdc4 (MAM domain containing 4 [Source:Xenbase;Acc:XB-GENE-958730])

HSP 1 Score: 581.637 bits (1498), Expect = 0.000e+0
Identity = 287/486 (59.05%), Postives = 366/486 (75.31%), Query Frame = 3
Query:  138 EVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKG-DLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            EVK TKIFINNEW  SE G TFP  NP   E I +VQE    D++KAV+AA+ AF  GS WR +DAS+RG LL+KLADL+E     ++ LE+L++GK ++ +   DL+ ++K  RYYAG+ADKIHG T   DGD+L++TR EP+GV G IIPWN+P ++  +K+AP +  G T+VIKPAEQTPL+ALY+G L+ +AGFP GVVNI+PGYGP+AG A+ SH  + K+ FTGSTEVG +I +  G ++LKRVTLELGGKSP IIFADA +LD A   AH+    N GQCC AG+RTFVE S+Y+  V +  + A++RIVG PFD  T QGPQ DK+Q+NKI++LI+SG  EGAKL  GG  +G  GFFI+PTVF +V+D MRIA+EEIFGPVQ + +F TVEEVIERAN++ YGL A VFT+DINKA+ +S +++AG+VWINCY+     +PFGG+K SG GRE+G YGL  Y E K VTI IPQKNS
Sbjct:   34 EVKHTKIFINNEWQTSESGRTFPVYNPATGEQICEVQEAEKADVDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERERTTLATLESLNSGKPFLQSYYVDLQGAIKTFRYYAGWADKIHGLTIPADGDYLTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLTALYMGALIKEAGFPPGVVNILPGYGPSAGTAIASHIGIDKVAFTGSTEVGMLIQEAAGKSNLKRVTLELGGKSPNIIFADA-DLDYAVEQAHQGVFFNQGQCCTAGSRTFVEDSIYEEFVRRSVERAKRRIVGSPFDPTTEQGPQTDKKQYNKILELIQSGIAEGAKLECGGKGLGRKGFFIEPTVFSNVRDEMRIAREEIFGPVQQILRFKTVEEVIERANNSDYGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGYKMSGNGREMGEYGLREYTEAKTVTIKIPQKNS 518          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Xenopus
Match: ALDH1B1 (aldehyde dehydrogenase 1 family member B1 [Source:NCBI gene;Acc:100498540])

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 288/490 (58.78%), Postives = 369/490 (75.31%), Query Frame = 3
Query:  126 MSAPEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKG-DLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            +S PEV +TK+FINNEW D+  G  FPT++P   EVI  V E    DI+ AVKAA+ AFK GS WR++DAS+RG LL++LADLIE +  Y++ LE +DNGK +  +   DL   VK+ RYYAG+ADK+HG T   DG++  YTR EPVGV G IIPWN+P ++  +KL P +A G T+V+K AEQTPLSALY+  L+ +AG+P GVVNI+ G+GPTAGAAL  H DV KI FTGSTEVG +I K  G+T+LKRVTLELGGKSP I+ ADA +L++A    HEA   N GQCC AG+RTFVE +VYD  +E+  + A+ R VG+PFD  T  GPQ++KEQF+KI+  I+SGK EGAKL+ GG R GD GFFI+PTVF +V+DNM+IA+EEIFGPVQ VFKF +++EVIERAN+T YGL AG+FT D++KA++++Q+L AG+VW+N Y++    TPFGGFK+SG GRELG  GL+ Y EVK VT+ I  K S
Sbjct:   29 LSNPEVFYTKLFINNEWRDAVSGRRFPTVDPCTGEVITHVAEADKADIDAAVKAAREAFKQGSPWRSMDASQRGQLLHRLADLIERDKIYLASLETMDNGKPFADSFAIDLSTVVKVYRYYAGFADKVHGKTIPLDGNYFCYTRHEPVGVCGQIIPWNFPLVMQGWKLGPALATGNTVVMKVAEQTPLSALYIASLIKEAGYPPGVVNILTGFGPTAGAALAQHMDVDKIAFTGSTEVGRLIQKAAGSTNLKRVTLELGGKSPCIVMADA-DLEQAVEQCHEALFFNMGQCCAAGSRTFVEENVYDEFLERTVEKAKLRKVGNPFDLDTKHGPQINKEQFDKILGYIKSGKTEGAKLMCGGERYGDKGFFIKPTVFANVQDNMKIAREEIFGPVQPVFKFKSIKEVIERANNTSYGLAAGIFTRDLDKAMLLTQALRAGTVWVNTYNIVTCQTPFGGFKESGNGRELGEDGLKAYTEVKTVTMKISHKKS 517          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Xenopus
Match: mamdc4 (MAM domain containing 4 [Source:Xenbase;Acc:XB-GENE-958730])

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 287/496 (57.86%), Postives = 371/496 (74.80%), Query Frame = 3
Query:  114 NYIKMSAPEV--KFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKG-DLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            +++ MSA ++   FT IFINNEW  SE G TFP  NP   E I +VQE    D++KAV+AA+ AF  GS WR +DAS+RG LL+KLADL+E     ++ LE+L++GK ++ +   DL+ ++K  RYYAG+ADKIHG T   DGD+L++TR EP+GV G IIPWN+P ++  +K+AP +  G T+VIKPAEQTPL+ALY+G L+ +AGFP GVVNI+PGYGP+AG A+ SH  + K+ FTGSTEVG +I +  G ++LKRVTLELGGKSP IIFADA +LD A   AH+    N GQCC AG+RTFVE S+Y+  V +  + A++RIVG PFD  T QGPQ DK+Q+NKI++LI+SG  EGAKL  GG  +G  GFFI+PTVF +V+D MRIA+EEIFGPVQ + +F TVEEVIERAN++ YGL A VFT+DINKA+ +S +++AG+VWINCY+     +PFGG+K SG GRE+G YGL  Y E K VTI IPQKNS
Sbjct:    7 SHVTMSAMKIHLSFTFIFINNEWQTSESGRTFPVYNPATGEQICEVQEAEKADVDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERERTTLATLESLNSGKPFLQSYYVDLQGAIKTFRYYAGWADKIHGLTIPADGDYLTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLTALYMGALIKEAGFPPGVVNILPGYGPSAGTAIASHIGIDKVAFTGSTEVGMLIQEAAGKSNLKRVTLELGGKSPNIIFADA-DLDYAVEQAHQGVFFNQGQCCTAGSRTFVEDSIYEEFVRRSVERAKRRIVGSPFDPTTEQGPQTDKKQYNKILELIQSGIAEGAKLECGGKGLGRKGFFIEPTVFSNVRDEMRIAREEIFGPVQQILRFKTVEEVIERANNSDYGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGYKMSGNGREMGEYGLREYTEAKTVTIKIPQKNS 501          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Xenopus
Match: mamdc4 (MAM domain containing 4 [Source:Xenbase;Acc:XB-GENE-958730])

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 283/481 (58.84%), Postives = 362/481 (75.26%), Query Frame = 3
Query:  153 KIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKG-DLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            KIFINNEW  SE G TFP  NP   E I +VQE    D++KAV+AA+ AF  GS WR +DAS+RG LL+KLADL+E     ++ LE+L++GK ++ +   DL+ ++K  RYYAG+ADKIHG T   DGD+L++TR EP+GV G IIPWN+P ++  +K+AP +  G T+VIKPAEQTPL+ALY+G L+ +AGFP GVVNI+PGYGP+AG A+ SH  + K+ FTGSTEVG +I +  G ++LKRVTLELGGKSP IIFADA +LD A   AH+    N GQCC AG+RTFVE S+Y+  V +  + A++RIVG PFD  T QGPQ DK+Q+NKI++LI+SG  EGAKL  GG  +G  GFFI+PTVF +V+D MRIA+EEIFGPVQ + +F TVEEVIERAN++ YGL A VFT+DINKA+ +S +++AG+VWINCY+     +PFGG+K SG GRE+G YGL  Y E K VTI IPQKNS
Sbjct:   15 KIFINNEWQTSESGRTFPVYNPATGEQICEVQEAEKADVDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERERTTLATLESLNSGKPFLQSYYVDLQGAIKTFRYYAGWADKIHGLTIPADGDYLTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLTALYMGALIKEAGFPPGVVNILPGYGPSAGTAIASHIGIDKVAFTGSTEVGMLIQEAAGKSNLKRVTLELGGKSPNIIFADA-DLDYAVEQAHQGVFFNQGQCCTAGSRTFVEDSIYEEFVRRSVERAKRRIVGSPFDPTTEQGPQTDKKQYNKILELIQSGIAEGAKLECGGKGLGRKGFFIEPTVFSNVRDEMRIAREEIFGPVQQILRFKTVEEVIERANNSDYGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGYKMSGNGREMGEYGLREYTEAKTVTIKIPQKNS 494          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Xenopus
Match: mamdc4 (MAM domain containing 4 [Source:Xenbase;Acc:XB-GENE-958730])

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 282/481 (58.63%), Postives = 362/481 (75.26%), Query Frame = 3
Query:  153 KIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKG-DLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            +IFINNEW  SE G TFP  NP   E I +VQE    D++KAV+AA+ AF  GS WR +DAS+RG LL+KLADL+E     ++ LE+L++GK ++ +   DL+ ++K  RYYAG+ADKIHG T   DGD+L++TR EP+GV G IIPWN+P ++  +K+AP +  G T+VIKPAEQTPL+ALY+G L+ +AGFP GVVNI+PGYGP+AG A+ SH  + K+ FTGSTEVG +I +  G ++LKRVTLELGGKSP IIFADA +LD A   AH+    N GQCC AG+RTFVE S+Y+  V +  + A++RIVG PFD  T QGPQ DK+Q+NKI++LI+SG  EGAKL  GG  +G  GFFI+PTVF +V+D MRIA+EEIFGPVQ + +F TVEEVIERAN++ YGL A VFT+DINKA+ +S +++AG+VWINCY+     +PFGG+K SG GRE+G YGL  Y E K VTI IPQKNS
Sbjct:   46 QIFINNEWQTSESGRTFPVYNPATGEQICEVQEAEKADVDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERERTTLATLESLNSGKPFLQSYYVDLQGAIKTFRYYAGWADKIHGLTIPADGDYLTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLTALYMGALIKEAGFPPGVVNILPGYGPSAGTAIASHIGIDKVAFTGSTEVGMLIQEAAGKSNLKRVTLELGGKSPNIIFADA-DLDYAVEQAHQGVFFNQGQCCTAGSRTFVEDSIYEEFVRRSVERAKRRIVGSPFDPTTEQGPQTDKKQYNKILELIQSGIAEGAKLECGGKGLGRKGFFIEPTVFSNVRDEMRIAREEIFGPVQQILRFKTVEEVIERANNSDYGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGYKMSGNGREMGEYGLREYTEAKTVTIKIPQKNS 525          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Mouse
Match: Aldh2 (aldehyde dehydrogenase 2, mitochondrial [Source:MGI Symbol;Acc:MGI:99600])

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 298/487 (61.19%), Postives = 368/487 (75.56%), Query Frame = 3
Query:  135 PEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAK-GDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            PEV   +IFINNEW D+    TFPT+NP+  EVI QV EG  +D++KAVKAA++AF+ GS WR +DAS RG LL +LADLIE +  Y++ LE LDNGK YVI+   DL+  +K LRYYAG+ADK HG T   DGDF SYTR EPVGV G IIPWN+P ++  +KL P +A G  +V+K AEQTPL+ALY+ +L+ +AGFP GVVNIVPG+GPTAGAA+ SH  V K+ FTGSTEVGH+I    G+++LKRVTLELGGKSP II +DA ++D A   AH A   N GQCC AG+RTFV+ +VYD  VE+    A+ R+VG+PFD +T QGPQVD+ QF KI+  I+SG+QEGAKL+ GG    D G+FIQPTVFGDVKD M IAKEEIFGPV  + KF T+EEV+ RAND+ YGL A VFT D++KA  +SQ+L+AG+VWINCYDV    +PFGG+K SG GRELG YGL+ Y EVK VT+ +PQKNS
Sbjct:   34 PEVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGNKEDVDKAVKAARAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEGVDKVAFTGSTEVGHLIQVAAGSSNLKRVTLELGGKSPNIIMSDA-DMDWAVEQAHFALFFNQGQCCCAGSRTFVQENVYDEFVERSVARAKSRVVGNPFDSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANDSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS 519          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Mouse
Match: Aldh1a2 (aldehyde dehydrogenase family 1, subfamily A2 [Source:MGI Symbol;Acc:MGI:107928])

HSP 1 Score: 581.252 bits (1497), Expect = 0.000e+0
Identity = 286/486 (58.85%), Postives = 370/486 (76.13%), Query Frame = 3
Query:  138 EVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIA-KGDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            E+K+TKIFINNEW +SE G  FP  NP   E + +VQE    DI+KAV+AA+ AF  GS WR +DAS+RG LL+KLADL+E +   ++ +E+L+ GK ++ A   DL+  +K LRYYAG+ADKIHG T   DGD+ ++TR EP+GV G IIPWN+P ++  +K+AP +  G T+VIKPAEQTPLSALY+G L+ +AGFP GVVNI+PGYGPTAGAA+ SH  + KI FTGSTEVG +I +  G ++LKRVTLELGGKSP IIFADA +LD A   AH+    N GQCC AG+R FVE S+Y+  V++  + A++RIVG PFD  T QGPQ+DK+Q+NK+++LI+SG  EGAKL  GG  +G  GFFI+PTVF +V D+MRIAKEEIFGPVQ + +F T++EVIERAN++ +GL A VFT+DINKA+M+S +++AG+VWINCY+     +PFGGFK SG GRE+G +GL  Y EVK VT+ IPQKNS
Sbjct:   34 EIKYTKIFINNEWQNSESGRVFPVCNPATGEQVCEVQEADKVDIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRATLATMESLNGGKPFLQAFYIDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFTWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADA-DLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVKRSVERAKRRIVGSPFDPTTEQGPQIDKKQYNKVLELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS 518          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Mouse
Match: Aldh1b1 (aldehyde dehydrogenase 1 family, member B1 [Source:MGI Symbol;Acc:MGI:1919785])

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 290/490 (59.18%), Postives = 367/490 (74.90%), Query Frame = 3
Query:  135 PEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGK----SYVIAKGDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            PE+ + K+FINNEW D+    TFPT+NPT  EVI  V EG   D++ AVKAA+ AF+ GS WR +DAS+RG LLN+LADL+E +  Y++ LE LDNGK    SYV+   DL+  +K+ RY+AG+ADK HG T   DG+   +TR EPVGV G IIPWN+P ++  +KLAP +A G T+V+K AEQTPLSALYL  L+ +AGFP GVVNI+ GYGPTAGAA+  H DV K+ FTGSTEVGH+I K  G ++LKRVTLELGGKSP I+ ADA +++ A    HEA   N GQCC AG+RTFVE S+Y   +E+  + A++R VG+PF+  T QGPQVDKEQF +I+  I  G++EGAKL+ GG R+G+ GFFI+PTVFGDV+D MRIAKEEIFGPVQ +FKF  +EEVI+RAN+T YGL A VFT D++KAI  +Q+L+AG+VW+N Y++    TPFGGFK+SG GRELG  GL  Y EVK VTI +P+KNS
Sbjct:   34 PEICYNKLFINNEWHDAVSKKTFPTVNPTTGEVIGHVAEGDRADVDLAVKAAREAFRLGSPWRRMDASERGRLLNRLADLVERDRVYLASLETLDNGKPFQESYVL---DLDEVIKVYRYFAGWADKWHGKTIPMDGEHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHMDVDKVAFTGSTEVGHLIQKAAGESNLKRVTLELGGKSPSIVLADA-DMEHAVDQCHEALFFNMGQCCCAGSRTFVEESIYREFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERILGYIRLGQKEGAKLLCGGERLGERGFFIKPTVFGDVQDGMRIAKEEIFGPVQPLFKFKKIEEVIQRANNTRYGLAAAVFTRDLDKAIYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLRAYTEVKTVTIKVPEKNS 519          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Mouse
Match: Aldh1a1 (aldehyde dehydrogenase family 1, subfamily A1 [Source:MGI Symbol;Acc:MGI:1353450])

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 282/486 (58.02%), Postives = 363/486 (74.69%), Query Frame = 3
Query:  138 EVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAK-GDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            +++ TKIFINNEW +S  G  FP +NP  EEVI  V+EG   D++KAVKAA+ AF+ GS WRT+DAS+RG LLNKLADL+E +   ++ +EAL+ GK +  A   DL   +K L+Y AG+ADKIHG T   DGD  +YTR EP+GV G IIPWN+P ++ ++K+ P ++ G T+V+KPAEQTPL+AL+L  L+ +AGFP GVVNIVPGYGPTAGAA++SH DV K+ FTGST+VG +I +  G ++LKRVTLELGGKSP I+FADA +LD A   AH     + GQCCVA +R FVE SVYD  V++  + A+K ++G+P      QGPQ+DKEQ +KI+DLIESGK+EGAKL  GG R G+ GFF+QPTVF +V D MRIAKEEIFGPVQ + KF +V++VI+RAN+T YGL AG+FT D++KAI +S +L+AG VW+NCY +     PFGGFK SG GRELG +GL  Y E+K V + I QKNS
Sbjct:   17 KIQHTKIFINNEWHNSVSGKKFPVLNPATEEVICHVEEGDKADVDKAVKAARQAFQIGSPWRTMDASERGRLLNKLADLMERDRLLLATMEALNGGKVFANAYLSDLGGCIKALKYCAGWADKIHGQTIPSDGDIFTYTRREPIGVCGQIIPWNFPMLMFIWKIGPALSCGNTVVVKPAEQTPLTALHLASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVDKVAFTGSTQVGKLIKEAAGKSNLKRVTLELGGKSPCIVFADA-DLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVKRSVERAKKYVLGNPLTPGINQGPQIDKEQHDKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSVDDVIKRANNTTYGLAAGLFTKDLDKAITVSSALQAGVVWVNCYMMLSAQCPFGGFKMSGNGRELGEHGLYEYTELKTVAMKISQKNS 501          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Mouse
Match: Aldh1a1 (aldehyde dehydrogenase family 1, subfamily A1 [Source:MGI Symbol;Acc:MGI:1353450])

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 282/486 (58.02%), Postives = 363/486 (74.69%), Query Frame = 3
Query:  138 EVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAK-GDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            +++ TKIFINNEW +S  G  FP +NP  EEVI  V+EG   D++KAVKAA+ AF+ GS WRT+DAS+RG LLNKLADL+E +   ++ +EAL+ GK +  A   DL   +K L+Y AG+ADKIHG T   DGD  +YTR EP+GV G IIPWN+P ++ ++K+ P ++ G T+V+KPAEQTPL+AL+L  L+ +AGFP GVVNIVPGYGPTAGAA++SH DV K+ FTGST+VG +I +  G ++LKRVTLELGGKSP I+FADA +LD A   AH     + GQCCVA +R FVE SVYD  V++  + A+K ++G+P      QGPQ+DKEQ +KI+DLIESGK+EGAKL  GG R G+ GFF+QPTVF +V D MRIAKEEIFGPVQ + KF +V++VI+RAN+T YGL AG+FT D++KAI +S +L+AG VW+NCY +     PFGGFK SG GRELG +GL  Y E+K V + I QKNS
Sbjct:   17 KIQHTKIFINNEWHNSVSGKKFPVLNPATEEVICHVEEGDKADVDKAVKAARQAFQIGSPWRTMDASERGRLLNKLADLMERDRLLLATMEALNGGKVFANAYLSDLGGCIKALKYCAGWADKIHGQTIPSDGDIFTYTRREPIGVCGQIIPWNFPMLMFIWKIGPALSCGNTVVVKPAEQTPLTALHLASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVDKVAFTGSTQVGKLIKEAAGKSNLKRVTLELGGKSPCIVFADA-DLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVKRSVERAKKYVLGNPLTPGINQGPQIDKEQHDKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSVDDVIKRANNTTYGLAAGLFTKDLDKAITVSSALQAGVVWVNCYMMLSAQCPFGGFKMSGNGRELGEHGLYEYTELKTVAMKISQKNS 501          
BLAST of Aldehyde dehydrogenase,putative vs. UniProt/SwissProt
Match: sp|P81178|ALDH2_MESAU (Aldehyde dehydrogenase, mitochondrial OS=Mesocricetus auratus OX=10036 GN=ALDH2 PE=1 SV=1)

HSP 1 Score: 600.512 bits (1547), Expect = 0.000e+0
Identity = 300/487 (61.60%), Postives = 369/487 (75.77%), Query Frame = 3
Query:  135 PEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAK-GDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            PEV   +IFINNEW D+    TFPT+NP+  EVI QV EG  +D++KAVKAA++AF+ GS WR +DAS RG LLN+LADLIE +  Y++ LE LDNGK YVI+   DL+  +K LRYYAG+ADK HG T   DGDF SYTR EPVGV G IIPWN+P ++  +KL P +A G  +V+K AEQTPL+ALY+ +L+ +AGFP GVVNIVPG+GPTAGAA+ SH DV K+ FTGSTEVGH+I    G+++LKRVTLELGGKSP II +DA ++D A   AH A   N GQCC AG+RTFV+  VYD  VE+    A+ R+VG+PFD +T QGPQVD+ QF KI+  I+SG+QEGAKL+ GG    D G+FIQPTVFGDVKD M IAKEEIFGPV  + KF T+EEV+ RAN++ YGL A VFT D++KA  +SQ+L+AG+VWINCYDV    +PFGG+K SG GRELG YGL+ Y EVK VTI +PQKNS
Sbjct:   15 PEVFCNQIFINNEWHDAVSKKTFPTVNPSTGEVICQVAEGSKEDVDKAVKAARAAFQLGSPWRRMDASDRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGSSNLKRVTLELGGKSPNIIMSDA-DMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYDEFVERSVARAKSRVVGNPFDSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTIKVPQKNS 500          
BLAST of Aldehyde dehydrogenase,putative vs. UniProt/SwissProt
Match: sp|P11884|ALDH2_RAT (Aldehyde dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Aldh2 PE=1 SV=1)

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 298/487 (61.19%), Postives = 368/487 (75.56%), Query Frame = 3
Query:  135 PEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAK-GDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            PEV   +IFINNEW D+    TFPT+NP+  EVI QV EG  +D++KAVKAA++AF+ GS WR +DAS RG LL +LADLIE +  Y++ LE LDNGK YVI+   DL+  +K LRYYAG+ADK HG T   DGDF SYTR EPVGV G IIPWN+P ++  +KL P +A G  +V+K AEQTPL+ALY+ +L+ +AGFP GVVNIVPG+GPTAGAA+ SH DV K+ FTGSTEVGH+I    G+++LKRVTLELGGKSP II +DA ++D A   AH A   N GQCC AG+RTFV+  VYD  VE+    A+ R+VG+PFD +T QGPQVD+ QF KI+  I+SG+QEGAKL+ GG    D G+FIQPTVFGDVKD M IAKEEIFGPV  + KF T+EEV+ RAN++ YGL A VFT D++KA  +SQ+L+AG+VWINCYDV    +PFGG+K SG GRELG YGL+ Y EVK VT+ +PQKNS
Sbjct:   34 PEVFCNQIFINNEWHDAVSKKTFPTVNPSTGEVICQVAEGNKEDVDKAVKAAQAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGSSNLKRVTLELGGKSPNIIMSDA-DMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYDEFVERSVARAKSRVVGNPFDSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS 519          
BLAST of Aldehyde dehydrogenase,putative vs. UniProt/SwissProt
Match: sp|P47738|ALDH2_MOUSE (Aldehyde dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Aldh2 PE=1 SV=1)

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 298/487 (61.19%), Postives = 368/487 (75.56%), Query Frame = 3
Query:  135 PEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAK-GDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            PEV   +IFINNEW D+    TFPT+NP+  EVI QV EG  +D++KAVKAA++AF+ GS WR +DAS RG LL +LADLIE +  Y++ LE LDNGK YVI+   DL+  +K LRYYAG+ADK HG T   DGDF SYTR EPVGV G IIPWN+P ++  +KL P +A G  +V+K AEQTPL+ALY+ +L+ +AGFP GVVNIVPG+GPTAGAA+ SH  V K+ FTGSTEVGH+I    G+++LKRVTLELGGKSP II +DA ++D A   AH A   N GQCC AG+RTFV+ +VYD  VE+    A+ R+VG+PFD +T QGPQVD+ QF KI+  I+SG+QEGAKL+ GG    D G+FIQPTVFGDVKD M IAKEEIFGPV  + KF T+EEV+ RAND+ YGL A VFT D++KA  +SQ+L+AG+VWINCYDV    +PFGG+K SG GRELG YGL+ Y EVK VT+ +PQKNS
Sbjct:   34 PEVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGNKEDVDKAVKAARAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEGVDKVAFTGSTEVGHLIQVAAGSSNLKRVTLELGGKSPNIIMSDA-DMDWAVEQAHFALFFNQGQCCCAGSRTFVQENVYDEFVERSVARAKSRVVGNPFDSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANDSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS 519          
BLAST of Aldehyde dehydrogenase,putative vs. UniProt/SwissProt
Match: sp|P05091|ALDH2_HUMAN (Aldehyde dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH2 PE=1 SV=2)

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 295/487 (60.57%), Postives = 367/487 (75.36%), Query Frame = 3
Query:  135 PEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAK-GDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            PEV   +IFINNEW D+    TFPT+NP+  EVI QV EG  +D++KAVKAA++AF+ GS WR +DAS RG LLN+LADLIE +  Y++ LE LDNGK YVI+   DL+  +K LRYYAG+ADK HG T   DGDF SYTR EPVGV G IIPWN+P ++  +KL P +A G  +V+K AEQTPL+ALY+ +L+ +AGFP GVVNIVPG+GPTAGAA+ SH DV K+ FTGSTE+G +I    G+++LKRVTLELGGKSP II +DA ++D A   AH A   N GQCC AG+RTFV+  +YD  VE+    A+ R+VG+PFD KT QGPQVD+ QF KI+  I +GKQEGAKL+ GG    D G+FIQPTVFGDV+D M IAKEEIFGPV  + KF T+EEV+ RAN++ YGL A VFT D++KA  +SQ+L+AG+VW+NCYDV    +PFGG+K SG GRELG YGL+ Y EVK VT+ +PQKNS
Sbjct:   32 PEVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDA-DMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS 517          
BLAST of Aldehyde dehydrogenase,putative vs. UniProt/SwissProt
Match: sp|Q5RF00|ALDH2_PONAB (Aldehyde dehydrogenase, mitochondrial OS=Pongo abelii OX=9601 GN=ALDH2 PE=2 SV=1)

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 294/487 (60.37%), Postives = 367/487 (75.36%), Query Frame = 3
Query:  135 PEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAK-GDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            PEV   +IFINNEW D+    TFPT+NP+  EVI QV EG  +D++KAVKAA++AF+ GS WR +DAS RG LLN+LADLIE +  Y++ LE LDNGK YVI+   DL+  +K LRYYAG+ADK HG T   DGDF SYTR EPVGV G IIPWN+P ++  +KL P +A G  +V+K AEQTPL+ALY+ +L+ +AGFP GVVNIVPG+GPTAGAA+ SH DV K+ FTGSTE+G +I    G+++LKRVTLELGGKSP II +DA ++D A   AH A   N GQCC AG+RTFV+  +YD  VE+    A+ R+VG+PFD KT QGPQVD+ QF KI+  I +GKQEGAKL+ GG    D G+FIQPTVFGDV+D M IAKEEIFGPV  + KF T+EEV+ RAN++ YGL A VFT D++KA  +SQ+L+AG+VW+NCY+V    +PFGG+K SG GRELG YGL+ Y EVK VT+ +PQKNS
Sbjct:   32 PEVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDA-DMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYNVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS 517          
BLAST of Aldehyde dehydrogenase,putative vs. TrEMBL
Match: A0A4S2MI02 (Aldedh domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001133 PE=3 SV=1)

HSP 1 Score: 647.506 bits (1669), Expect = 0.000e+0
Identity = 321/488 (65.78%), Postives = 390/488 (79.92%), Query Frame = 3
Query:  129 SAPEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKGDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            + PEV+FT++FINNE+ +S  G TFPTINP  EEVI  VQEG  +D+ KAV AAK+AF+  + WRT+DASKRG+LL KLA LI  +A+YIS+LEALDNGK+   A GD +F+V +LRY+AGYADKIHG     DG+ +S+TR EP GVV  I+PWNYPF LAV KLAP +AAGCT+V+KPAEQTPLS ++LG LV +AG P GVVNI+PGYG TAGAAL+ HPDVR I+FTGSTEVG +IMK    T++K V LELGGKSPLIIFADA +LD+AA  AHEA M NHGQCCVAGTR FVEA +Y+ +V KL++LAE R VGDPF   T+QGPQ+D+ QFNKIM  IESGK++GA+LVTGG R+G+ G+FIQPTVF DV D M IAKEEIFGPVQS+ KF T++EVIERAN   YGLGAGV+TSD++KA+ ++Q+ EAGS WINCY+V     PFGG+K SGIGRELG YGLE YL+ K +++ I  KNS
Sbjct:    3 AGPEVRFTQLFINNEFVNSVSGKTFPTINPATEEVICHVQEGDVEDVKKAVAAAKAAFRRDTPWRTMDASKRGLLLCKLASLIARDAEYISKLEALDNGKAVSSALGDTQFAVDVLRYFAGYADKIHGKNLPVDGNMISFTRREPAGVVAGIVPWNYPFFLAVLKLAPALAAGCTIVLKPAEQTPLSGIFLGSLVREAGLPPGVVNIIPGYGETAGAALSQHPDVRVISFTGSTEVGQLIMKA-AATNIKHVKLELGGKSPLIIFADA-DLDKAALVAHEATMVNHGQCCVAGTRIFVEAPIYEKMVHKLKELAEARKVGDPFAPDTVQGPQIDEVQFNKIMSYIESGKKQGARLVTGGCRLGNKGYFIQPTVFADVTDEMSIAKEEIFGPVQSILKFETIDEVIERANSGIYGLGAGVYTSDMDKAMRVAQTCEAGSFWINCYNVLYPQAPFGGYKMSGIGRELGKYGLECYLQTKVISMPISLKNS 488          
BLAST of Aldehyde dehydrogenase,putative vs. TrEMBL
Match: G4LWI3 (Aldehyde dehydrogenase,putative OS=Schistosoma mansoni OX=6183 GN=Smp_050390 PE=3 SV=1)

HSP 1 Score: 634.024 bits (1634), Expect = 0.000e+0
Identity = 314/486 (64.61%), Postives = 381/486 (78.40%), Query Frame = 3
Query:  135 PEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKGDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            PEVK+T++FI NE+ DSE   TFPTINPT EEVI  VQE    D+NKAV+AAK+AFK GS WRT+DAS+RG+LL KLADLIE NA+YI+RLEA+DNGK+   A GD+ F+ +  RYYAGYADKIHG     DG+ +++TR EPVGVV  I PWNYPF L+V K  P + AGCT+V+KPAEQTPLSALYL  L+ +AGFP GV N++ GYG T G ALT HPDVR I+FTGSTEVG +IMK    T++K V LELGGKSPLII ADA ++++A+  AHEA M NHGQCCVAGTR FV+A +YD +VEKL+KLAE+R VGDPF   TIQGPQ+D  QF+KIM  IE GK++GA+LVTGG R+G+ G+FIQPTVF DV D M IAKEEIFGPVQ + KFNT+EEVIERAN THYGLGAGVFTSD++KA+ ++Q +EAGS WIN Y+     TPFGG+K SG+GRE G   L+ YL+ K +++ I  KNS
Sbjct:    8 PEVKYTQLFIGNEFVDSESKKTFPTINPTTEEVICHVQEADQNDVNKAVEAAKAAFKTGSTWRTMDASERGVLLYKLADLIEMNAEYIARLEAMDNGKTVESALGDVFFAAQTTRYYAGYADKIHGKQLPVDGNMITFTRREPVGVVACITPWNYPFFLSVLKGTPCLCAGCTVVLKPAEQTPLSALYLAALIKEAGFPPGVFNVICGYGETTGEALTHHPDVRAISFTGSTEVGQLIMKAAA-TNIKHVKLELGGKSPLIILADA-DIEKASEVAHEATMVNHGQCCVAGTRIFVQAPIYDQMVEKLKKLAEQRKVGDPFVSDTIQGPQIDNVQFDKIMSYIEKGKKQGARLVTGGCRIGEKGYFIQPTVFADVSDEMCIAKEEIFGPVQCILKFNTLEEVIERANATHYGLGAGVFTSDMDKAMRIAQCVEAGSFWINSYNFVSPQTPFGGYKMSGMGREFGKEALDGYLQTKVISMPISVKNS 491          
BLAST of Aldehyde dehydrogenase,putative vs. TrEMBL
Match: A0A095A4B6 (Aldehyde dehydrogenase X, mitochondrial OS=Schistosoma haematobium OX=6185 GN=MS3_08925 PE=3 SV=1)

HSP 1 Score: 630.558 bits (1625), Expect = 0.000e+0
Identity = 309/486 (63.58%), Postives = 383/486 (78.81%), Query Frame = 3
Query:  135 PEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKGDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            PEVK+T++FI NE+ DS+   TFPTINPT E+VI  VQE    D+NKAV++AK+AFK GS WRT+DAS+RG+LL+KLADLI+ NA+YI+RLEA+DNGK+  +A  D+ F+ +  RYYAGYADKIHG     DG+ +++TR EP+GVV  I PWNYPF+L+V K  P + AGCT+V+KPAEQTPLSALYL  L  +AGFP GV N++ GYG T G ALT HPDVR I+FTGSTEVG +IMK    T++K V LELGGKSPLII ADA ++++AA  AHEA M NHGQCCVAGTR FV+A +YD +VEKL++LAE+R VGDPF   TIQGPQ+D  QF+KIM  IE GK++GA+LVTGG R+G  G+FIQPTVF DV D M IAKEEIFGPVQ + KFNT+EEVIERAN THYGLGAGVFTSD++KA+ ++Q +EAGS WIN Y++    TPFGG+K SG+GRELG   L+ YL+ K +++ I  KNS
Sbjct:   29 PEVKYTQLFIGNEFVDSKSKKTFPTINPTTEDVICHVQEADQNDVNKAVESAKAAFKTGSTWRTMDASERGVLLHKLADLIKMNAEYIARLEAMDNGKTVDLALDDVLFAAQTTRYYAGYADKIHGKQLPVDGNMITFTRREPLGVVACITPWNYPFLLSVLKCTPCLCAGCTVVLKPAEQTPLSALYLAALTKEAGFPPGVFNVICGYGETTGEALTHHPDVRAISFTGSTEVGQLIMKAAA-TNIKHVKLELGGKSPLIILADA-DIEKAAEVAHEATMVNHGQCCVAGTRVFVQAPIYDQMVEKLKRLAEQRKVGDPFVSGTIQGPQIDNVQFDKIMSYIEKGKKQGARLVTGGCRIGKKGYFIQPTVFADVSDEMCIAKEEIFGPVQCILKFNTLEEVIERANATHYGLGAGVFTSDMDKAMRIAQCVEAGSFWINSYNLISPQTPFGGYKMSGMGRELGKEALDGYLQTKVISMPISVKNS 512          
BLAST of Aldehyde dehydrogenase,putative vs. TrEMBL
Match: A0A4D5R9U2 (Retinal dehydrogenase 1 OS=Scolopendra viridis OX=118503 PE=3 SV=1)

HSP 1 Score: 629.017 bits (1621), Expect = 0.000e+0
Identity = 311/486 (63.99%), Postives = 373/486 (76.75%), Query Frame = 3
Query:  135 PEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKGDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            PE+K TKIFINNEW DS  G TFPTINP+  EVI QVQEG   DI+KAV AAK AF+ GS WRT+DAS RG  L +LA+L+E N +Y++ LE LDNGK    A+GD+  ++ I+RYYAG+ADKIHG T   DGD  S+TR+EPVG+ G IIPWN+P ++  FKLAP +AAGC ++IKPAEQTPL+AL + DLV +AG P GVVN+VPGYGPTAGAAL  HPDV KI FTGSTEVGHII +    T+LKRV+LELGGKSPL+IFADA +LD A   AH A M N GQ C AG+RT V+  +Y+  V+  ++ A KR+VGDP++ +  QGPQ+DK QF KI+DLIESGK+EGA L+ GG R GD G+FI+PTVF DV DNMRIAKEEIFGPVQ + KF T+EE IER+N THYGL AGV T+DINKAI+ +Q + AGSVW+N Y+     TPFGGFK+SG GRELG   L  YLEVK VTI IPQKNS
Sbjct:    6 PEIKHTKIFINNEWHDSVSGKTFPTINPSTGEVICQVQEGDKADIDKAVAAAKEAFQLGSVWRTIDASMRGECLRRLANLMEKNTEYLASLETLDNGKPVTAAEGDMFMAINIIRYYAGWADKIHGKTIPADGDVFSFTRLEPVGICGQIIPWNFPILMFAFKLAPALAAGCCVIIKPAEQTPLTALVIADLVKEAGIPPGVVNVVPGYGPTAGAALVEHPDVDKIAFTGSTEVGHIIQQNSSKTNLKRVSLELGGKSPLVIFADA-DLDMAVELAHNAVMINQGQACSAGSRTLVQEEIYNEFVKLSKEKALKRVVGDPYEAEVEQGPQIDKIQFEKILDLIESGKKEGASLLCGGERHGDKGYFIKPTVFADVNDNMRIAKEEIFGPVQQILKFTTLEEAIERSNSTHYGLAAGVCTNDINKAIVFAQGVRAGSVWVNTYNYVTAQTPFGGFKESGHGRELGEDCLHEYLEVKTVTIQIPQKNS 490          
BLAST of Aldehyde dehydrogenase,putative vs. TrEMBL
Match: C1LFP4 (Putative aldehyde dehydrogenase 1B1 OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 628.632 bits (1620), Expect = 0.000e+0
Identity = 307/486 (63.17%), Postives = 383/486 (78.81%), Query Frame = 3
Query:  135 PEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKGDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            PEVK+T++FINNE+ DS+   TFPT+NP+ EEVI  VQE  + D+N+AV+AAK AFK GS+WRT+DAS+RG+LL KLA+LIE NA+YI+ L+A+DNGK+   A GD+ F+ +I RYYAGYADKIHG     DG+ +++TR EP+GVV  I PWNYPF L++ K+ P + AGCT+V+KPAEQTPLSALYL  L  +AGFP GV N++ GYG T G ALT HPDVR I+FTGSTEVG +IMK    +S+K V LELGGKSPLIIFADA ++++AA  AHEA M NHGQCCVAGTR FV+A +Y+ +VE+++KLAE+R VGDPF   T+QGPQ+D  QF+KIM  IE GK +GA+LVTGG R+GD G+FIQPTVF DV D M IAKEEIFGPVQS+ KF+T+EEVIERAN THYGLGAGVFTSD++KA+ ++Q +EAGS WIN Y+      PFGGFK SGIGRE G   L+ YL+ K +++ I  KNS
Sbjct:    8 PEVKYTQLFINNEFVDSKSRKTFPTVNPSTEEVICHVQEADENDVNRAVEAAKVAFKIGSKWRTMDASERGVLLYKLANLIEKNAEYIACLDAMDNGKAVESALGDVLFAAQITRYYAGYADKIHGKQLPVDGNMVTFTRREPLGVVACITPWNYPFALSIIKITPCLCAGCTVVLKPAEQTPLSALYLAALFKEAGFPPGVFNVICGYGETTGEALTHHPDVRAISFTGSTEVGQVIMKA-AASSIKHVKLELGGKSPLIIFADA-DIEKAAEVAHEATMVNHGQCCVAGTRLFVQAPIYNQMVERMKKLAEQRKVGDPFVSGTVQGPQIDNIQFDKIMSYIEKGKAQGARLVTGGCRIGDKGYFIQPTVFADVSDEMCIAKEEIFGPVQSILKFDTLEEVIERANATHYGLGAGVFTSDMDKAMRVAQCVEAGSFWINSYNTVCPQAPFGGFKMSGIGREFGKEALDGYLQTKVISMPISIKNS 491          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Cavefish
Match: aldh2.2 (aldehyde dehydrogenase 2 family member [Source:NCBI gene;Acc:103036383])

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 296/487 (60.78%), Postives = 367/487 (75.36%), Query Frame = 3
Query:  135 PEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKG-DLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            P+V + K+FINNEW D+    TFPTINP+  EVI +V EG   D++KAVKAA+ AF+ GS WR +DAS+RG+LLN+LAD +E +A Y++ LE LDNGK + +A   D+   VK LRYYAG+ADK  G T   DGDF  YTR EPVGV G IIPWN+P ++  +KL P +A G T+V+K AEQTPL+ALY+  L+ + GFP GVVNI+ G G TAGAA++SH DV KI FTGSTEVGHII +  G ++LK+VTLELGGKSP II +DA N++EA   AH A   N GQCC AG+RT+V+ S+Y+  VE+  + A+KR+VG+PFD KT QGPQVD EQF KI+  I SGK+EGAKL+ GG    D G+FIQPTVFG+V+D+M+IA+EEIFGPV  + KF T+EEVIERANDT+YGL A V T+DINKA  +S SL AG+VWINCY+V  V  PFGG+K SG GRE+G YGLE Y EVK VT  IPQKNS
Sbjct:   36 PDVHYNKLFINNEWHDALSKKTFPTINPSTGEVICEVAEGDKADVDKAVKAARDAFRLGSPWRRMDASRRGVLLNRLADAVERDAGYLAELETLDNGKPFSVAYSVDVPMVVKCLRYYAGWADKWEGKTVPIDGDFFCYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNTIVMKVAEQTPLTALYVASLIKEVGFPPGVVNIISGLGHTAGAAISSHMDVDKIAFTGSTEVGHIIQQAAGASNLKKVTLELGGKSPNIILSDA-NMEEAVEQAHMAIFFNMGQCCSAGSRTYVQESIYNEFVERSVERAKKRVVGNPFDLKTDQGPQVDDEQFKKILGYISSGKKEGAKLMYGGGVAADRGYFIQPTVFGEVQDDMKIAREEIFGPVMQILKFKTIEEVIERANDTNYGLAAAVCTTDINKAHYISNSLRAGTVWINCYNVFGVQAPFGGYKASGTGREMGEYGLEAYTEVKTVTTKIPQKNS 521          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Cavefish
Match: aldh2.2 (aldehyde dehydrogenase 2 family member [Source:NCBI gene;Acc:103036383])

HSP 1 Score: 576.63 bits (1485), Expect = 0.000e+0
Identity = 289/479 (60.33%), Postives = 361/479 (75.37%), Query Frame = 3
Query:  135 PEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKG-DLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVT 1568
            P+V + K+FINNEW D+    TFPTINP+  EVI +V EG   D++KAVKAA+ AF+ GS WR +DAS+RG+LLN+LAD +E +A Y++ LE LDNGK + +A   D+   VK LRYYAG+ADK  G T   DGDF  YTR EPVGV G IIPWN+P ++  +KL P +A G T+V+K AEQTPL+ALY+  L+ + GFP GVVNI+ G G TAGAA++SH DV KI FTGSTEVGHII +  G ++LK+VTLELGGKSP II +DA N++EA   AH A   N GQCC AG+RT+V+ S+Y+  VE+  + A+KR+VG+PFD KT QGPQVD EQF KI+  I SGK+EGAKL+ GG    D G+FIQPTVFG+V+D+M+IA+EEIFGPV  + KF T+EEVIERANDT+YGL A V T+DINKA  +S SL AG+VWINCY+V  V  PFGG+K SG GRE+G YGLE Y EVK V+
Sbjct:   36 PDVHYNKLFINNEWHDALSKKTFPTINPSTGEVICEVAEGDKADVDKAVKAARDAFRLGSPWRRMDASRRGVLLNRLADAVERDAGYLAELETLDNGKPFSVAYSVDVPMVVKCLRYYAGWADKWEGKTVPIDGDFFCYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNTIVMKVAEQTPLTALYVASLIKEVGFPPGVVNIISGLGHTAGAAISSHMDVDKIAFTGSTEVGHIIQQAAGASNLKKVTLELGGKSPNIILSDA-NMEEAVEQAHMAIFFNMGQCCSAGSRTYVQESIYNEFVERSVERAKKRVVGNPFDLKTDQGPQVDDEQFKKILGYISSGKKEGAKLMYGGGVAADRGYFIQPTVFGEVQDDMKIAREEIFGPVMQILKFKTIEEVIERANDTNYGLAAAVCTTDINKAHYISNSLRAGTVWINCYNVFGVQAPFGGYKASGTGREMGEYGLEAYTEVKTVS 513          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Cavefish
Match: aldh1a2 (aldehyde dehydrogenase 1 family member A2 [Source:NCBI gene;Acc:103042804])

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 278/497 (55.94%), Postives = 360/497 (72.43%), Query Frame = 3
Query:   93 LIGSSLFNYIKMSAPEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKG-DLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIP 1580
            L+ S       ++ PE+K TKIFINNEW DS  G TF T NP   E I  VQE    D++KAVKAA+SAF   SEWR +D+S RG LL+KLADL+E +  Y++ LE+LD GK ++ +   DL+ ++K LRY+AG+ADKIHG +   DG +LS+TR EP+GV G IIPWN+P M+  +KL P +  G T+V+KPAEQTPL+ LY+G L+ +AGFP GVVNI+PG+GPTAGA + SH  + K+ FTGST+VG +I +  G ++LKRVTLELGGK+P IIFADA +LD A   AH+    N GQCC AG+R FVE S+YD  V +  + A++RIVG PFD  T QGPQ+  EQ  ++++ +ESG  EGAKL  GG      GF+IQPTVF +V+D+MRIA+EEIFGPVQ + KF T+EEVIERAN+T YGL A VFT+DI+KA+ +S +L+AG+VWINC++      PFGGFK SG GRELG YGL  Y EVK +T+ +P
Sbjct:   20 LLASLRLTPCPLTNPEIKHTKIFINNEWHDSLSGKTFSTYNPATGEKICDVQEADKADVDKAVKAARSAFSLSSEWRRMDSSDRGRLLSKLADLVERDRLYLATLESLDTGKPFLSSFFVDLQGTIKTLRYFAGWADKIHGTSIPTDGGYLSFTRHEPIGVCGQIIPWNFPLMMMAWKLGPALCCGNTVVMKPAEQTPLTCLYMGSLIKEAGFPPGVVNILPGFGPTAGAGIASHMGIDKVAFTGSTKVGKLIQEAAGKSNLKRVTLELGGKNPNIIFADA-DLDLAVEQAHQGVFFNSGQCCTAGSRIFVEESIYDEFVSRSVERAKRRIVGSPFDPTTEQGPQISAEQQRRVLEFVESGISEGAKLECGGKAHFSKGFYIQPTVFSNVQDHMRIAREEIFGPVQQIMKFKTMEEVIERANNTEYGLTAAVFTNDISKAMAISTALQAGTVWINCFNALSCQCPFGGFKMSGNGRELGEYGLREYTEVKTITVKMP 515          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Cavefish
Match: aldh1a2 (aldehyde dehydrogenase 1 family member A2 [Source:NCBI gene;Acc:103042804])

HSP 1 Score: 536.954 bits (1382), Expect = 0.000e+0
Identity = 268/478 (56.07%), Postives = 347/478 (72.59%), Query Frame = 3
Query:   93 LIGSSLFNYIKMSAPEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKG-DLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGREL 1523
            L+ S       ++ PE+K TKIFINNEW DS  G TF T NP   E I  VQE    D++KAVKAA+SAF   SEWR +D+S RG LL+KLADL+E +  Y++ LE+LD GK ++ +   DL+ ++K LRY+AG+ADKIHG +   DG +LS+TR EP+GV G IIPWN+P M+  +KL P +  G T+V+KPAEQTPL+ LY+G L+ +AGFP GVVNI+PG+GPTAGA + SH  + K+ FTGST+VG +I +  G ++LKRVTLELGGK+P IIFADA +LD A   AH+    N GQCC AG+R FVE S+YD  V +  + A++RIVG PFD  T QGPQ+  EQ  ++++ +ESG  EGAKL  GG      GF+IQPTVF +V+D+MRIA+EEIFGPVQ + KF T+EEVIERAN+T YGL A VFT+DI+KA+ +S +L+AG+VWINC++      PFGGFK SG GREL
Sbjct:   20 LLASLRLTPCPLTNPEIKHTKIFINNEWHDSLSGKTFSTYNPATGEKICDVQEADKADVDKAVKAARSAFSLSSEWRRMDSSDRGRLLSKLADLVERDRLYLATLESLDTGKPFLSSFFVDLQGTIKTLRYFAGWADKIHGTSIPTDGGYLSFTRHEPIGVCGQIIPWNFPLMMMAWKLGPALCCGNTVVMKPAEQTPLTCLYMGSLIKEAGFPPGVVNILPGFGPTAGAGIASHMGIDKVAFTGSTKVGKLIQEAAGKSNLKRVTLELGGKNPNIIFADA-DLDLAVEQAHQGVFFNSGQCCTAGSRIFVEESIYDEFVSRSVERAKRRIVGSPFDPTTEQGPQISAEQQRRVLEFVESGISEGAKLECGGKAHFSKGFYIQPTVFSNVQDHMRIAREEIFGPVQQIMKFKTMEEVIERANNTEYGLTAAVFTNDISKAMAISTALQAGTVWINCFNALSCQCPFGGFKMSGNGREL 496          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Cavefish
Match: aldh1a3 (aldehyde dehydrogenase 1 family member A3 [Source:NCBI gene;Acc:103032207])

HSP 1 Score: 533.487 bits (1373), Expect = 0.000e+0
Identity = 259/484 (53.51%), Postives = 350/484 (72.31%), Query Frame = 3
Query:  138 EVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKG-DLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQK 1586
            ++K TK+FINNEW  S +G T P  NP   + I +V+E    D++ AV+AA++A K GS WR +D S RG LL+KLA+L+E +   ++ +E++D+GK ++ +   DLE S+K LRYYAG+ADKIHG T   D +F+ +T+ EPVGV GAIIPWN+P ++  +K+AP +  G T+VIKP+E TPL+AL++G L+ +AGFP GVVNIVPG+GPT+GAA+ SH  + K+ FTGS EVG +I +    ++LKRVTLELGGK+P I+F D+ +L  A   A +    N GQCC A +R FVE  VYD  V    + A+K + GDP D +T  GPQ++++QF KI+DL+ESGK+EGAKL  GG+ + D G FIQPT+F DVKD+MR+AKEEIFGPVQ + KF + EEVIERAN THYGL A VFT  +++A+ +S +LEAG+VW+NCY+      PFGG+K SG GRELG Y L  Y EVKAVTI + ++
Sbjct:   28 DIKHTKLFINNEWHSSAKGKTIPIFNPATGDKICEVEEADKADVDVAVEAARAAMKRGSAWRRMDVSGRGRLLHKLAELLERDRTLLATMESMDSGKPFLQSFFIDLEGSIKTLRYYAGWADKIHGKTMPVDDNFMCFTKHEPVGVCGAIIPWNFPLLMFTWKIAPALCCGNTVVIKPSELTPLTALHVGALIKEAGFPPGVVNIVPGFGPTSGAAIASHMGIDKVAFTGSVEVGQLIKEAAAKSNLKRVTLELGGKNPCIVFGDS-DLQLAVQEAQKGAFYNQGQCCTAASRVFVEERVYDEFVRLSVESAKKIVAGDPMDPRTSHGPQINQQQFEKILDLVESGKREGAKLECGGHALQDKGLFIQPTIFSDVKDHMRLAKEEIFGPVQCIMKFKSQEEVIERANSTHYGLAAAVFTRSVDRAMSVSSALEAGTVWVNCYNALHAQAPFGGYKMSGNGRELGEYALAEYTEVKAVTIKLSEQ 510          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Sea Lamprey
Match: aldh1l2 (aldehyde dehydrogenase 1 family, member L2 [Source:ZFIN;Acc:ZDB-GENE-100426-6])

HSP 1 Score: 398.667 bits (1023), Expect = 1.269e-131
Identity = 220/482 (45.64%), Postives = 313/482 (64.94%), Query Frame = 3
Query:  153 KIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIA-KGDLEFSVKILRYYAGYADKIHG-----NTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPG-YGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKF--NTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTI 1571
            + FI+ ++ D++   T+ T+NPT+  VI +V      D+++AV AAK AF+ G EW  ++   RG LL KLADL+E + + ++ +E LD+G  Y +A K  +  S++  RY+AG+ DKIHG     N   P+ + L++T+ EP+GV G +IPWNYP M+  +K A  +AAG TLV+KPA+ TPL+AL   +L  KAGFPKGV+NI+PG  G   G  ++ HP +RK+ FTGST +G  IMK+   ++LK+V+LELGGKSPLIIF D  ++D+A      A   N G+ C+A  R FVE S++D  V ++ +  +K  VGDP D  T  GPQ  +    K+++  E G +EGA LV GG +V     F  P+VF  V+D+M IA+EE FGP+  + KF    ++ V+ RAN+T +GL +GVFT DI+KA+ +S  LEAG+V+IN Y+   V  PFGGFKQSG G++LG   L  YL  KAVT+
Sbjct:  211 QCFIDGKFVDADTSKTYDTVNPTDGSVICKVAFASVADVDEAVAAAKRAFESG-EWGRMNPRDRGRLLYKLADLMEEHQEELATIETLDSGAVYTLALKTHVGMSIQTFRYFAGWCDKIHGTTIPINQARPNRN-LTFTKREPIGVCGIVIPWNYPLMMLAWKSAACLAAGNTLVLKPAQVTPLTALKFAELAAKAGFPKGVINIIPGSVGSIVGQRMSEHPHIRKLGFTGSTPIGKQIMKSCATSNLKKVSLELGGKSPLIIFNDC-DIDKAVRMGMSAVFFNKGENCIAAGRLFVEESIHDEYVRRVVEEIKKMKVGDPLDRSTDHGPQNHRAHMEKLVEYCEVGVKEGATLVHGGRQVPRPEVFANPSVFTGVEDHMYIAQEESFGPIMVISKFPDGDIDGVLARANNTEFGLASGVFTRDISKALYVSDQLEAGTVFINTYNKTDVAAPFGGFKQSGFGKDLGEEALNEYLRTKAVTV 689          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004609.1 (pep scaffold:Pmarinus_7.0:GL479321:13801:23388:1 gene:ENSPMAG00000004155.1 transcript:ENSPMAT00000004609.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 305.449 bits (781), Expect = 1.326e-97
Identity = 182/472 (38.56%), Postives = 269/472 (56.99%), Query Frame = 3
Query:  183 SEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKGDLEFSVKILRYYAGYADKIHGNTTS-PDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDV------GFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAI 1577
            S  G  F  +NP    ++ + Q     D+  AVK A+ AF+    WR L  S+R   L + + +I+   + ++ +E  D GK    A+ D++   + L Y+AG A  I G     P G F+ Y+R EP+GV   I  WN+PF +A +K AP +A G  +V KP+  TPL+A+ L ++  +AG P G+ NIV G G T G  L SH DV K++ TGS   G  +++      +K VTLELGGKSPLI+F+D  +LD A   A      + GQ C   TR FV+ SV +  +E+L        +GDP  + T  G  + +   ++++  ++   QEGAKLV GG +          GFF+ P V  + +D+M+  +EEIFGPV +V  F+T EEV++RAN T +GL AGVFT D+ +A  +  +L+AGS +IN Y+V L+  PFGG+K SG GRE G   ++ Y ++K V + +
Sbjct:   53 STGGPEFDVVNPATGGLLCRGQASGAVDVQAAVKDAREAFE--GSWRGLSGSERSQHLLRASAIIKERREELAVMEVKDTGKPVYEARMDVDSGWQCLEYFAGLAPTIAGQHIQLPGGSFM-YSRREPLGVCVGIGAWNFPFQIACWKSAPALACGNAMVFKPSPLTPLTAVALAEIYTEAGLPPGLFNIVQGDGET-GQLLCSHNDVAKVSCTGSVGTGVKVLQQTA-PRIKPVTLELGGKSPLIVFSDC-DLDNAVKAALMGNFLSQGQVCSNATRVFVQRSVCERFLERLLDRVSAIRIGDPQRDSTTMGALISQSHLDRVLAYVQRAVQEGAKLVCGGKKYVPEDPSLKGGFFMTPCVLAECRDDMQAVREEIFGPVMAVLAFDTEEEVLQRANATDFGLAAGVFTKDLTRAHRVIAALQAGSCYINNYNVVLMEMPFGGYKMSGFGRENGMATVDYYTQLKTVYVEM 518          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Sea Lamprey
Match: aldh5a1 (aldehyde dehydrogenase 5 family, member A1 (succinate-semialdehyde dehydrogenase) [Source:ZFIN;Acc:ZDB-GENE-070228-2])

HSP 1 Score: 253.447 bits (646), Expect = 5.675e-79
Identity = 156/418 (37.32%), Postives = 223/418 (53.35%), Query Frame = 3
Query:  339 KRGILLNKLADLIESNADYISRLEALDNGKSYVIAKGDLEFSVKILRYYAGYADKIHGN---TTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAA---LTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRI-VGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTI 1571
            +RG LL +  ++I  N   +++L   ++GK    + G++ +    L ++   A + +G    + +PD    S    +PVGV   I PWN+P  +   K+   +AAGCT V+KPAE TPLSAL L  L ++AG P GV+N+VP       A    L +HP V KI+FTGST  G ++M     T +KRV++ELGG +P I+F  A +LD A      +     GQ CV   R  V+ SV+D  V +L      ++ VG   D     GP +++    K+   +     +GA++V GG R    G F QPTV  DV  NM  A+EE FGP+  + KF T EE I  AN T  GL    F+ D+ +   +S++LE G V  N   +  V  PFGG KQSG+GRE    G+  Y+ VK V +
Sbjct:    2 ERGALLKRWYEVILQNRQELAQLITAESGKPQQESLGEVSYGAAFLEWFGEEARRAYGQIIPSAAPDRRMFSM--YQPVGVAAMITPWNFPVAMITRKVGAALAAGCTAVVKPAEDTPLSALALAQLAVEAGLPPGVLNVVPCSRANVAAVGELLCTHPSVSKISFTGSTATGKVLMAHAVGT-VKRVSMELGGHAPFIVFESA-DLDAAVRGLLSSKFRFSGQTCVCPNRMLVQESVHDAFVSRLAHAVSTQLRVGPGADTGNTLGPLINEHALEKVERHVVDAVSQGARVVVGGARHALGGSFFQPTVLADVTPNMLCAREETFGPLAPIIKFKTEEEAIALANSTAMGLAGYFFSRDVAQVWRVSEALEVGMVGANEGLLSAVEAPFGGIKQSGLGREGAQQGMLEYMHVKYVCL 415          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Sea Lamprey
Match: aldh8a1 (aldehyde dehydrogenase 8 family, member A1 [Source:NCBI gene;Acc:447801])

HSP 1 Score: 231.491 bits (589), Expect = 1.008e-69
Identity = 155/427 (36.30%), Postives = 222/427 (51.99%), Query Frame = 3
Query:  318 WRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKG-DLEFSVKILRYYAGYADKIHGNTTSPDG-DFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGN-------RVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTI 1571
            W      +RG +L +LA+LIES  + ++  E+ D GK+   A+  D+  +    R++A          T  D    + YT   PVGVVG I PWN P  L  +K+AP +A G T+V KP+E T ++A  L  L+ +AG P GVVN+V G G  AGAAL  HPDV  I+FTGST     I         KR++LELGGK+P +IFADA +LD   AT   +   N      +        SV      +  +  +   VG P D  +  GP + KE   K+   +E  +++G +++ G              G+F+ PTV   V D+    +EEIFGPV  V  F   +E + R+N   YGL A V++ D+ +   +++ L+AG VW NC+ +  +  PFGG K SGIGRE      E + +VK +TI
Sbjct:   61 WAARSPQERGRILTRLAELIESRLEELAIAESHDQGKTVEHARTVDIPRAAYNFRFFASAVQHYTTECTQADHVGCMHYTVRSPVGVVGLISPWNLPLYLLTWKIAPAIALGNTVVAKPSELTSVTAWMLCMLLREAGVPPGVVNVVLGTGQKAGAALVGHPDVPAISFTGSTATACDI-TVRSALHCKRLSLELGGKNPAVIFADA-DLDACVATTVRSSFANQTGHVPSSLSAIFSHSVVVQCPRRFFRTTKAWKVGPPDDFTSNMGPLISKEHLAKVRGYVELAERDGGQVLCGEGVDPLLLPPRCQGGYFLAPTVITGVPDDSPAMQEEIFGPVVCVSPFEDEDEAVTRSNGVRYGLAAVVWSRDVARVHRVAKRLQAGIVWTNCWLIRELNLPFGGMKASGIGREGAKDSFEFFTDVKTITI 485          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002659.1 (pep scaffold:Pmarinus_7.0:GL481598:469:3326:1 gene:ENSPMAG00000002422.1 transcript:ENSPMAT00000002659.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.956 bits (463), Expect = 2.113e-55
Identity = 83/158 (52.53%), Postives = 117/158 (74.05%), Query Frame = 3
Query: 1119 PQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            PQ+D++Q +KI++L++S  +EGA L  GG      GF++QPTVF DV D+ RI +EEIFGPVQ + +F+++E+V+ RAN + YGL   VFT D+ +A+ +S +++AG+VWINCY+     +PFGG+K SG GRE+G YGL+ Y EVK VTI I QKNS
Sbjct:    1 PQIDEKQRSKILELVQSALEEGAHLECGGVACEGRGFYVQPTVFSDVPDSARITREEIFGPVQLIMRFDSLEDVVARANASPYGLVGAVFTRDLERALAVSAAMQAGTVWINCYNAMNAQSPFGGYKMSGNGREMGEYGLQEYTEVKTVTIKISQKNS 158          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Yeast
Match: ALD5 (Mitochondrial aldehyde dehydrogenase; involved in regulation or biosynthesis of electron transport chain components and acetate formation; activated by K+; utilizes NADP+ as the preferred coenzyme; constitutively expressed [Source:SGD;Acc:S000000875])

HSP 1 Score: 452.981 bits (1164), Expect = 3.199e-155
Identity = 233/476 (48.95%), Postives = 324/476 (68.07%), Query Frame = 3
Query:  150 TKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKGDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAI 1577
            T +FIN E+  S++  TF  INP+NEE I  V +  + D+++AV AAK AF+  ++W  ++   R   L  LADL+E + + ++ +E++DNGKS   A+GD+    K LR   G+ADKI+GN      +  +Y+  EP+GV G IIPWN+P ++  +K+ P +A G T+V+KPAE TPLSAL+   L  +AG P GVVNI+PG G   G  L++HPDV+KI FTGST  G  IMK   +T +K+VTLELGGKSP I+FADA +LD+A          N G+ C AG+R +++ +VY+ V++KL+   E   VGDPFDE+  QG Q   +Q +KI+D ++  K EGA+LVTGG R G  G+F++PTVF DVK++MRI KEE+FGP+ +V KF+TV+EVI  AND+ YGL AG+ T+DINKA+ +S+ ++AG+VWIN Y+      PFGGF QSGIGRE+G   L  Y + K+V IAI
Sbjct:   44 TGLFINGEFVASKQKKTFDVINPSNEEKITTVYKAMEDDVDEAVAAAKKAFE--TKWSIVEPEVRAKALFNLADLVEKHQETLAAIESMDNGKSLFCARGDVALVSKYLRSCGGWADKIYGNVIDTGKNHFTYSIKEPLGVCGQIIPWNFPLLMWSWKIGPALATGNTVVLKPAETTPLSALFASQLCQEAGIPAGVVNILPGSGRVVGERLSAHPDVKKIAFTGSTATGRHIMKVAADT-VKKVTLELGGKSPNIVFADA-DLDKAVKNIAFGIFYNSGEVCCAGSRIYIQDTVYEEVLQKLKDYTESLKVGDPFDEEVFQGAQTSDKQLHKILDYVDVAKSEGARLVTGGARHGSKGYFVKPTVFADVKEDMRIVKEEVFGPIVTVSKFSTVDEVIAMANDSQYGLAAGIHTNDINKAVDVSKRVKAGTVWINTYNNFHQNVPFGGFGQSGIGREMGEAALSNYTQTKSVRIAI 515          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Yeast
Match: ALD4 (Mitochondrial aldehyde dehydrogenase; required for growth on ethanol and conversion of acetaldehyde to acetate; phosphorylated; activity is K+ dependent; utilizes NADP+ or NAD+ equally as coenzymes; expression is glucose repressed; can substitute for cytosolic NADP-dependent aldehyde dehydrogenase when directed to the cytosol; human homolog ALDH2 can complement yeast ald4 mutant [Source:SGD;Acc:S000005901])

HSP 1 Score: 449.129 bits (1154), Expect = 9.549e-154
Identity = 233/494 (47.17%), Postives = 323/494 (65.38%), Query Frame = 3
Query:  111 FNYIKMSAPEVKF---------TKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKGDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAV 1565
            F+++ M+ P +K          T +FINN++  S++  TF  INP+ EE I  + EGR+ D+ +AV+AA  AF  GS W  +D   RG  L +LA+LIE + D I+ +E LDNGK+   ++GD++  +  L+  AG+ADKI G          SYT+ +P+GV G IIPWN+P ++  +K+AP +  G T+V+K AE TPLSALY+   + +AG P GV+NIV G+G   G A+T+HP ++K+ FTGST  G  I ++     LK+VTLELGGKSP I+FADA  L +A          N G+ C AG+R +VE S+YD  +E+ +  +E   VGDPFDE T QG Q  + Q NKI+  ++ GK EGA L+TGG R+G  G+FI+PTVFGDVK++MRI KEEIFGPV +V KF + +EVI  AND+ YGL AG+ TS+IN A+ ++  + AG+VWIN Y+      PFGGF  SG+GRE+    L+ YL+VKAV
Sbjct:   24 FSHLPMTVP-IKLPNGLEYEQPTGLFINNKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGS-WNGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVINYLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAWKIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKIVGEAITNHPKIKKVAFTGSTATGRHIYQSAA-AGLKKVTLELGGKSPNIVFADAE-LKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASESIKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKGYFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLAAGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMSVDALQNYLQVKAV 513          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Yeast
Match: ALD6 (Cytosolic aldehyde dehydrogenase; activated by Mg2+ and utilizes NADP+ as the preferred coenzyme; required for conversion of acetaldehyde to acetate; constitutively expressed; locates to the mitochondrial outer surface upon oxidative stress [Source:SGD;Acc:S000005982])

HSP 1 Score: 431.024 bits (1107), Expect = 6.368e-147
Identity = 218/477 (45.70%), Postives = 316/477 (66.25%), Query Frame = 3
Query:  150 TKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKGDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRI-VGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAI 1577
            T +FINN++  +++G T+P  +P+ E  + +V     +D+  A++ A  AF   +EW T D  +RG LL+KLAD +ES  D +S +EALDNGK+  +A+GD+  ++  LR  A YADK++G T +    ++++T +EP+GV G IIPWN+P M+  +K+AP +A G   ++KPA  TPL+ALY   L  K G P GVVNIVPG G T GAALT+ P +RK+ FTGSTEVG  +      ++LK++TLELGGKS  ++F DA N+ +           N GQ C +G+R +V+  +YD ++   +   E  I VG+PFD+   QG   +++QF+ IM+ I+ GK+EGAK++TGG +VGD G+FI+PTVF DV ++MRI KEEIFGPV +V KF T+EE +E AN + +GLG+G+ T  ++  + +++ L+AG+VWIN Y+      PFGG KQSG GRE+G      Y EVKAV I +
Sbjct:   26 TGLFINNKFMKAQDGKTYPVEDPSTENTVCEVSSATTEDVEYAIECADRAFHD-TEWATQDPRERGRLLSKLADELESQIDLVSSIEALDNGKTLALARGDVTIAINCLRDAAAYADKVNGRTINTGDGYMNFTTLEPIGVCGQIIPWNFPIMMLAWKIAPALAMGNVCILKPAAVTPLNALYFASLCKKVGIPAGVVNIVPGPGRTVGAALTNDPRIRKLAFTGSTEVGKSVAVDSSESNLKKITLELGGKSAHLVFDDA-NIKKTLPNLVNGIFKNAGQICSSGSRIYVQEGIYDELLAAFKAYLETEIKVGNPFDKANFQGAITNRQQFDTIMNYIDIGKKEGAKILTGGEKVGDKGYFIRPTVFYDVNEDMRIVKEEIFGPVVTVAKFKTLEEGVEMANSSEFGLGSGIETESLSTGLKVAKMLKAGTVWINTYNDFDSRVPFGGVKQSGYGREMGEEVYHAYTEVKAVRIKL 500          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Yeast
Match: ALD2 (Cytoplasmic aldehyde dehydrogenase; involved in ethanol oxidation and beta-alanine biosynthesis; uses NAD+ as the preferred coenzyme; expression is stress induced and glucose repressed; very similar to Ald3p [Source:SGD;Acc:S000004780])

HSP 1 Score: 404.06 bits (1037), Expect = 2.102e-136
Identity = 232/509 (45.58%), Postives = 315/509 (61.89%), Query Frame = 3
Query:  117 YIKMSAPEVKFT-----KIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSY-VIAKGDLEFSVKILRYYAGYADKIHGNTTSP-DGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKR--IVG--DPFDEKTIQGPQVDKEQFNKIMDLIESGKQE-------GAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKN 1589
            Y  +  P++K +      +FINNE+C S +G T  T+NP   E I   Q   +KD++KAVKAA++AF   + W    + +RGI L+ L  LIE   D ++ LE LD GK Y   AKGDL   +++ RY+AG ADK     T P   +  +YT   P GVV  I+PWNYP  +A +KL   +AAG T++IKPAE T LS LY   L+ KAGFP GVVNIVPGYG   G AL SH D+ KI+FTGST+VG  +++  G ++LK VTLE GGKSP ++F DA +LD+A          N GQ C A +R +V++S+YD  VEK ++ A+K   + G  DPFDEK I GP +   Q+++I   IE GK+E        ++   GG +    G+FI PT+F DV    ++ ++EIFGPV  V KF   ++ ++ ANDT YGL + VFT D+ KA M ++ ++AG+VWIN  +   VT PFGGFK SGIGRELG  G++ YL+ KAV I +   N
Sbjct:    5 YTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQAANEKDVDKAVKAARAAFD--NVWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPYHSNAKGDLAQILQLTRYFAGSADKFDKGATIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACWKLQGALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNIVPGYGSLVGQALASHMDIDKISFTGSTKVGGFVLEASGQSNLKDVTLECGGKSPALVFEDA-DLDKAIDWIAAGIFYNSGQNCTANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKREEKLDMFQTSEFPIGGAK----GYFIPPTIFTDVPQTSKLLQDEIFGPVVVVSKFTNYDDALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINSSNDEDVTVPFGGFKMSGIGRELGQSGVDTYLQTKAVHINLSLDN 506          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Yeast
Match: ALD3 (Cytoplasmic aldehyde dehydrogenase; involved in beta-alanine synthesis; uses NAD+ as the preferred coenzyme; very similar to Ald2p; expression is induced by stress and repressed by glucose [Source:SGD;Acc:S000004779])

HSP 1 Score: 386.726 bits (992), Expect = 1.312e-129
Identity = 219/503 (43.54%), Postives = 310/503 (61.63%), Query Frame = 3
Query:  117 YIKMSAPEVKFT-----KIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSY-VIAKGDLEFSVKILRYYAGYADKIHGNTTSP-DGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKR--IVG--DPFDEKTIQGPQVDKEQFNKIMDLIESGKQE-------GAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTI 1571
            Y  +  P++K +      +FINNE+C S +G T  T+NP   E I   Q   +KD++KAVKAA++AF   + W    + +RGI L+ L  LIE   D ++ LE LD GK +   AK DL   +++ RYYAG  DK +   T P   +  +YT   P GVV  I+PWNYP  +A  K+   +AAG T++IKPAE T LS LY   L+ KAGFP GVVN++PGYG   G AL +H D+ KI+FTGST+VG  +++  G ++LK +TLE GGKSP ++F DA +LD+A          N GQ C A +R +V++S+YD  VEK ++ A+K   + G  DPFDEK I GP +   Q+++I   IE GK+E        ++   GG +    G+FI PT+F DV +  ++ ++EIFGPV  V KF   ++ ++ ANDT YGL + VFT D+ KA M ++ ++AG+VWIN  +      PFGGFK SGIGRE G  G++ YL++K+V +
Sbjct:    5 YTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQAANEKDVDKAVKAARAAF--DNVWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQIIELTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKISFTGSTKVGGSVLEASGQSNLKDITLECGGKSPALVFEDA-DLDKAIEWVANGIFFNSGQICTANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKKEEKLDMFQTSEFPIGGAK----GYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGRESGDTGVDNYLQIKSVHV 500          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Nematostella
Match: EDO47653 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLS5])

HSP 1 Score: 596.275 bits (1536), Expect = 0.000e+0
Identity = 293/487 (60.16%), Postives = 367/487 (75.36%), Query Frame = 3
Query:  135 PEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKG-DLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            PE+K+ ++FINN++ +S  G TF T NP+  EVI  V EG   D++ AVKAA+SAFK GS WRT+DAS RG LLN+LADLIE +  Y++ LE LDNGK Y  +   DLEF++K  RYYAG+ADKIHG T   DG F  YTR EPVGVVG +IPWN+P ++  +KL P +A G T+V+KPAEQTPL+ALY+  L+ +AGFP+GVVNIVPG+GPTAG A+ SH DV KI FTGSTEVGHII ++ G ++LK VTLELGGKSP I+ AD+ ++D A   +H A   N GQCC AG+RTFV+  +YD  VEK  + A+ R+VG+PFD KT QGPQVD EQ  KI++LIESG++EGAKL  GG+R GD G+FIQPTVF DV+DNMRIA+EEIFGPV  +F+F  + ++IERAN T YGL   V T ++  A+M+S SL  G+VW+NCYD      PFGG+K SG+GRELG YGL+ Y EVK VTIAIPQKN+
Sbjct:   38 PEIKYNQVFINNQFVNSVSGKTFQTFNPSTGEVICDVAEGDKHDVDIAVKAAQSAFKLGSPWRTMDASDRGRLLNRLADLIERDKAYLASLETLDNGKPYNDSFNVDLEFTIKCYRYYAGWADKIHGKTIPLDGSFFCYTRHEPVGVVGQVIPWNFPLLMQAWKLGPALACGNTVVMKPAEQTPLTALYVASLIAEAGFPEGVVNIVPGFGPTAGGAIASHMDVDKIAFTGSTEVGHIIQQSAGASNLKNVTLELGGKSPNIVLADS-DVDFAVDMSHFALFFNQGQCCCAGSRTFVQEGIYDEFVEKSVQRAKNRVVGNPFDLKTQQGPQVDGEQMTKILNLIESGRKEGAKLEVGGDRAGDKGYFIQPTVFSDVQDNMRIAQEEIFGPVMQIFRFKDMNDIIERANKTTYGLAGSVMTKNLENALMLSNSLRVGTVWVNCYDALSAQAPFGGYKMSGVGRELGEYGLQQYSEVKTVTIAIPQKNT 523          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Nematostella
Match: EDO45538 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSB4])

HSP 1 Score: 580.867 bits (1496), Expect = 0.000e+0
Identity = 289/485 (59.59%), Postives = 364/485 (75.05%), Query Frame = 3
Query:  135 PEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKGDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKN 1589
            P++K+TK+FINNE+ D   G  FPTINPT  E I  + EG  +D++KAVKAAK AFK GS WRT+DAS RG LL KLA LI+ +  Y++ LE +D+GK +  + GD++ S    RYYAG+ADK+ G T   DG +  YTR EPVG+VGAI PWN+P  +A  K+AP +A G  +++KPAEQTPL+ALY   LV +AGFP GVVN++PGYGPTAGAA+T+H D+ K++FTGSTEVG +I +    ++LKR+TLELGGKSP I+FAD+ ++D A   AHEA   N GQCC AG+RTFV+ ++YD  V+K  K A+ R VGDPFD    QGPQ+D+EQF+KIMDLIESGK+EGAK+  GG R G+ GFFIQPTVF DV D+MRIAKEEIFGPVQ + KF +V+EVIERAN+T YGL AGVFT +I+ AI +S  L AG+VWINCY+ G    PFGG+K SG GRE G YG+ PY EVK VT+ +P KN
Sbjct:   11 PQIKYTKLFINNEFVDCTSGKVFPTINPTTGEKICDISEGDKEDVDKAVKAAKEAFKLGSAWRTMDASMRGKLLYKLAQLIDRDIAYLASLETIDSGKLFSDSVGDMQSSANCFRYYAGWADKVTGKTIPADGPYFVYTRHEPVGLVGAITPWNFPLNMASVKIAPALACGNVVILKPAEQTPLTALYFCALVKEAGFPAGVVNVIPGYGPTAGAAITTHLDIDKVSFTGSTEVGRLIQEASAKSNLKRLTLELGGKSPNIVFADS-DMDYAVEMAHEALFFNQGQCCSAGSRTFVQDTIYDEFVKKSVKRAKARTVGDPFDS-VEQGPQIDQEQFDKIMDLIESGKKEGAKMQCGGARHGNKGFFIQPTVFSDVTDDMRIAKEEIFGPVQQLIKFKSVDEVIERANNTTYGLAAGVFTKNIDTAIAVSSGLRAGTVWINCYECGAPQAPFGGYKMSGYGREWGEYGVLPYCEVKTVTMKVPLKN 493          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Nematostella
Match: EDO36183 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJA5])

HSP 1 Score: 523.087 bits (1346), Expect = 0.000e+0
Identity = 260/441 (58.96%), Postives = 330/441 (74.83%), Query Frame = 3
Query:  126 MSAPEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKGDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVW 1448
            M+ P+VK+T++FINNE+ DS  G TFPT+NP  EE I  V E    D++ AV AAK AFK GS WRT+DAS RG  L KLADL E +ADY++RLE+ D GK    AK D++  +   RYYAG+ADK+ G T   DG F +YTR EPVGVVGAI PWN+P ++   KLAP +A GC +++KPAEQTPL+ALYL  LV +AGFP GVVN++PGYGPTAGAA++SH  + KI+FTGSTEVG +I +T   ++LKRVTLELGGKSP I+FADA +LD A   +      N GQCC AGTR FVE S++D  V +    A+ R+VGDP +EKT+QGPQVD+EQFNKI+ LIESGKQ+GAK+  GG R G+ G+F++PTVF  V+D+MRIAKEEIFGPV  + KFN + EVI RANDT YGL   VF+ DI+KA+M++ S++AG++W
Sbjct:    1 MAKPDVKYTQLFINNEFVDSVSGKTFPTLNPATEEKICDVSEADKADVDIAVAAAKEAFKLGSVWRTMDASARGHFLYKLADLCERDADYLARLESYDGGKVINEAKIDVQGMISCFRYYAGWADKVTGKTIPADGPFFTYTRHEPVGVVGAITPWNFPLLMEGLKLAPALACGCVVILKPAEQTPLTALYLASLVKEAGFPTGVVNVLPGYGPTAGAAISSHMGIDKISFTGSTEVGRLIQETAAKSNLKRVTLELGGKSPNIVFADA-DLDWAVEMSCLGLFINQGQCCCAGTRIFVEESIHDEFVRQCVARAKARVVGDPLEEKTVQGPQVDEEQFNKILGLIESGKQQGAKVECGGGRHGNKGYFVEPTVFSGVQDDMRIAKEEIFGPVMQILKFNEINEVIRRANDTTYGLAGAVFSKDIDKALMVAHSIQAGTMW 440          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Nematostella
Match: EDO46151 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQR3])

HSP 1 Score: 426.787 bits (1096), Expect = 4.601e-140
Identity = 225/494 (45.55%), Postives = 324/494 (65.59%), Query Frame = 3
Query:  114 NYIKMSAPEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIA-KGDLEFSVKILRYYAGYADKIHG-----NTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFN--TVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTI 1571
            NY+ +  P     ++FIN E+ DS  G TF TINPT+  V+ QV     +D++ AV AAK AF  G  W +++A  R  L+N+LADL+E + + ++ +E+LD+G  Y +A K  +  S+  +RY+AG+ DKI G     N   P+ + L YT+ EP+GV G I+PWNYP M+  +K++P++AAG T+V+KPA+ TP++AL   +L  +AGFPKGV+NI+PG G   G  +  HPDVRK+ FTGST VG  IM++   ++LK+ +LELGGKSPLIIF+D  +++ A      AC+ N G+ C+A  R FVE S++D  V +L    +K  +GDP D  T  GPQ  K   + +++ ++ G +EGAKLV GG  +   GFF +P VF +V+D+M IAKEE FGPV  + KF+   VE V+E AN T YGL +GVFT D++KA+ ++ +LEAG+ ++N Y+   V  PFGG KQSG G++LG   L  YL+ K +TI
Sbjct:  386 NYMTIHMPH----QLFINGEFVDSHHGKTFNTINPTDGTVLAQVSLATHEDVDDAVDAAKEAFYNGP-WGSMNARDRATLMNRLADLMEQHKEELATIESLDSGAVYTLALKTHVGMSIDTVRYFAGWCDKIQGLTVPVNNAKPNRN-LCYTKREPIGVCGLIVPWNYPLMMLAWKISPLLAAGNTVVLKPAQVTPMTALKFAELAARAGFPKGVINILPGSGSVVGNRICEHPDVRKLGFTGSTPVGKAIMESCATSNLKKCSLELGGKSPLIIFSDC-DMERAVRQGMMACLFNKGENCIAAGRLFVEESIHDEFVNRLVDELKKLKIGDPLDTATDHGPQNHKAHLDSLVEYVKRGVEEGAKLVYGGRHLDRPGFFFEPAVFTNVEDDMFIAKEESFGPVVIISKFDDGDVEGVLESANGTEYGLASGVFTKDMSKALRVADALEAGTCFVNTYNKTDVAAPFGGCKQSGFGKDLGMEALNEYLKTKVITI 872          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Nematostella
Match: EDO27860 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T836])

HSP 1 Score: 395.971 bits (1016), Expect = 1.590e-133
Identity = 228/472 (48.31%), Postives = 294/472 (62.29%), Query Frame = 3
Query:  156 IFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKGDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTI 1571
            +FINNE+ D   G  FPTINPT  E I  + EG  +D++KAVKAAK AFK GS WRT+DAS RG LL KLA LI+ +  Y++ LE +D+GK +  + GD++ S    RYYAG+ADK+ G T    G  +       + +        Y    +VF     +  G  +          S  Y   LV      KG  ++           L   P+++         VG +I +    ++LKR+TLELGGKSP I+FAD+ ++D A   AHEA   N GQCC AG+RTFV+ ++YD  V+K  + A+ R VGDPFD    QGPQ+D+EQF+KIMDLIESGK+EGAK+  GG R G+ GFFIQPTVF DV D+MRIAKEEIFGPVQ + KF +V+EVIERAN+T YGL AGVFT +I+ A+ +S  L AG+VWINCY+ G    PFGG+K SG GRE G YG+ PY EVK V +
Sbjct:    2 LFINNEFVDCTSGKVFPTINPTTGEKICDISEGDKEDVDKAVKAAKEAFKLGSAWRTMDASMRGKLLYKLAQLIDRDIAYLASLETIDSGKLFSDSVGDMQSSANCFRYYAGWADKVTGKTIPAAGFMI-------LDLTDKYTTETYTNGRSVFCFGNKILQGSKI---------RSLQYSIFLVFAC--SKGCRDL---------RFLQKTPNIK--------NVGRLIQEASAKSNLKRLTLELGGKSPNIVFADS-DMDYAVEIAHEALFFNQGQCCSAGSRTFVQDTIYDEFVKKSVERAKARTVGDPFDS-VDQGPQIDQEQFDKIMDLIESGKKEGAKMQCGGARHGNKGFFIQPTVFSDVTDDMRIAKEEIFGPVQQLIKFKSVDEVIERANNTTYGLAAGVFTKNIDTAMAVSSGLRAGTVWINCYECGAPQAPFGGYKMSGYGREWGEYGVLPYCEVKTVCM 436          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Medaka
Match: aldh2.2 (aldehyde dehydrogenase 2 family member [Source:NCBI gene;Acc:101172271])

HSP 1 Score: 608.601 bits (1568), Expect = 0.000e+0
Identity = 301/489 (61.55%), Postives = 368/489 (75.26%), Query Frame = 3
Query:  129 SAPEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKG-DLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            + PEV + K+FINN W D+E G TFPTINP   EVI QV E  + D+NKAVKAA  AF+ GS WR +DAS RG+LLN+LAD IE +A Y++ LE LDNGK Y +A   DL   VK LRYYAG+ADK  G T   DGD+  YTR EPVGV G IIPWN+P ++  +KL P +A G T+V+K AEQTPL+ALY+  L+ + GFP+GVVNI+PG GPTAGAA+  H DV K+ FTGSTEVGH+I +  G+++LKRVTLELGGKSP I+ +DA N+++A   +H A   N GQCC AG+RT+V+A +YD  VE+  + A++R+VGDPFD KT QGPQVD+EQFNKI+  I SGK+EGAKL+ GG    D G+FIQPTVFGDV+DNM IA+EEIFGPV  +FKF T+EEV+ RAND+ YGL A VFT DI+KA  +S  L AG+VWINCYDV     PFGG+K SG+GRELG YGLE Y EVK VTI IPQKNS
Sbjct:   80 TQPEVHYNKLFINNRWQDAESGKTFPTINPATGEVICQVAEADESDVNKAVKAASDAFRLGSPWRRMDASHRGLLLNRLADAIERDAAYLAELETLDNGKPYAVAYSVDLPNVVKCLRYYAGWADKWEGKTIPIDGDYFCYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTPLTALYVASLIKEVGFPEGVVNILPGMGPTAGAAIARHMDVDKVAFTGSTEVGHLIQQASGSSNLKRVTLELGGKSPNIVLSDA-NMEDAVEQSHFALFFNQGQCCCAGSRTYVQADIYDEFVERSVERAKRRVVGDPFDMKTEQGPQVDQEQFNKILGYISSGKREGAKLMCGGGVAADRGYFIQPTVFGDVQDNMTIAREEIFGPVMQIFKFKTLEEVLTRANDSKYGLAAAVFTKDIDKANYVSSGLRAGTVWINCYDVFGAQAPFGGYKASGVGRELGQYGLENYTEVKTVTIKIPQKNS 567          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Medaka
Match: aldh2.2 (aldehyde dehydrogenase 2 family member [Source:NCBI gene;Acc:101172271])

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 293/480 (61.04%), Postives = 360/480 (75.00%), Query Frame = 3
Query:  129 SAPEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKG-DLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAV 1565
            + PEV + K+FINN W D+E G TFPTINP   EVI QV E  + D+NKAVKAA  AF+ GS WR +DAS RG+LLN+LAD IE +A Y++ LE LDNGK Y +A   DL   VK LRYYAG+ADK  G T   DGD+  YTR EPVGV G IIPWN+P ++  +KL P +A G T+V+K AEQTPL+ALY+  L+ + GFP+GVVNI+PG GPTAGAA+  H DV K+ FTGSTEVGH+I +  G+++LKRVTLELGGKSP I+ +DA N+++A   +H A   N GQCC AG+RT+V+A +YD  VE+  + A++R+VGDPFD KT QGPQVD+EQFNKI+  I SGK+EGAKL+ GG    D G+FIQPTVFGDV+DNM IA+EEIFGPV  +FKF T+EEV+ RAND+ YGL A VFT DI+KA  +S  L AG+VWINCYDV     PFGG+K SG+GRELG YGLE Y EVK V
Sbjct:   80 TQPEVHYNKLFINNRWQDAESGKTFPTINPATGEVICQVAEADESDVNKAVKAASDAFRLGSPWRRMDASHRGLLLNRLADAIERDAAYLAELETLDNGKPYAVAYSVDLPNVVKCLRYYAGWADKWEGKTIPIDGDYFCYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTPLTALYVASLIKEVGFPEGVVNILPGMGPTAGAAIARHMDVDKVAFTGSTEVGHLIQQASGSSNLKRVTLELGGKSPNIVLSDA-NMEDAVEQSHFALFFNQGQCCCAGSRTYVQADIYDEFVERSVERAKRRVVGDPFDMKTEQGPQVDQEQFNKILGYISSGKREGAKLMCGGGVAADRGYFIQPTVFGDVQDNMTIAREEIFGPVMQIFKFKTLEEVLTRANDSKYGLAAAVFTKDIDKANYVSSGLRAGTVWINCYDVFGAQAPFGGYKASGVGRELGQYGLENYTEVKTV 558          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Medaka
Match: aldh1a2 (aldehyde dehydrogenase 1 family member A2 [Source:NCBI gene;Acc:100049450])

HSP 1 Score: 559.296 bits (1440), Expect = 0.000e+0
Identity = 274/487 (56.26%), Postives = 363/487 (74.54%), Query Frame = 3
Query:  135 PEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKG-DLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            PE+K+TKIFINNEW  S  G  FP  NP   E I +VQE    D++KAV+AA+ AF  GS WR +DAS+RG LL KLADL+E ++ Y++ +E+L++GK ++     DL+ ++K LRY+AGYADKIHG +   DG++L++TR EP+GV G IIPWN+P M+A +KLAP +A G T+V+KP+E+TPL+ LY+  LV +AGFP GVVNI+PG+GPTAGAA+ SH  + K+ FTGSTEVG +I +  G ++LKRVTLE+GGK+P IIFADA +LD A   AH+    N GQCC AG+R +VE  +YD  V +  + A++RIVG PFD  T QGPQ+ +E  N++++ I+SG QEGAKL  GG  +G  GFFI+PTVF DVKD+MRIAKEEIFGPVQ + KF TVEE IERAN++ YGL A VFT+DINKA+ +S +++AG+VW+NC++      PFGG+K SG GRELG  GL+ YLE+K +T+    KNS
Sbjct:   33 PELKYTKIFINNEWHVSVSGKVFPVYNPATGEQICEVQEADKADVDKAVQAARLAFSLGSVWRRMDASERGKLLAKLADLVERDSVYLATIESLNSGKPFLPTLFVDLQGTIKTLRYFAGYADKIHGTSIPMDGEYLTFTRYEPIGVCGQIIPWNFPLMMAAWKLAPALACGNTVVLKPSEETPLTCLYVAALVKEAGFPPGVVNILPGFGPTAGAAIASHMGIDKVAFTGSTEVGKLIQEAAGRSNLKRVTLEMGGKNPNIIFADA-DLDLAVEQAHQGVFFNAGQCCTAGSRIYVEEPIYDEFVRRSVERAKRRIVGSPFDPTTEQGPQISREHQNRVLEYIQSGIQEGAKLECGGKALGLKGFFIEPTVFSDVKDDMRIAKEEIFGPVQQIMKFKTVEEAIERANNSDYGLTAAVFTTDINKAMTVSTAMQAGTVWVNCFNALSTQCPFGGYKMSGNGRELGESGLKEYLEIKTITMKTVTKNS 518          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Medaka
Match: aldh1a2 (aldehyde dehydrogenase 1 family member A2 [Source:NCBI gene;Acc:100049450])

HSP 1 Score: 539.265 bits (1388), Expect = 0.000e+0
Identity = 263/464 (56.68%), Postives = 348/464 (75.00%), Query Frame = 3
Query:  135 PEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKG-DLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGREL 1523
            PE+K+TKIFINNEW  S  G  FP  NP   E I +VQE    D++KAV+AA+ AF  GS WR +DAS+RG LL KLADL+E ++ Y++ +E+L++GK ++     DL+ ++K LRY+AGYADKIHG +   DG++L++TR EP+GV G IIPWN+P M+A +KLAP +A G T+V+KP+E+TPL+ LY+  LV +AGFP GVVNI+PG+GPTAGAA+ SH  + K+ FTGSTEVG +I +  G ++LKRVTLE+GGK+P IIFADA +LD A   AH+    N GQCC AG+R +VE  +YD  V +  + A++RIVG PFD  T QGPQ+ +E  N++++ I+SG QEGAKL  GG  +G  GFFI+PTVF DVKD+MRIAKEEIFGPVQ + KF TVEE IERAN++ YGL A VFT+DINKA+ +S +++AG+VW+NC++      PFGG+K SG GREL
Sbjct:   33 PELKYTKIFINNEWHVSVSGKVFPVYNPATGEQICEVQEADKADVDKAVQAARLAFSLGSVWRRMDASERGKLLAKLADLVERDSVYLATIESLNSGKPFLPTLFVDLQGTIKTLRYFAGYADKIHGTSIPMDGEYLTFTRYEPIGVCGQIIPWNFPLMMAAWKLAPALACGNTVVLKPSEETPLTCLYVAALVKEAGFPPGVVNILPGFGPTAGAAIASHMGIDKVAFTGSTEVGKLIQEAAGRSNLKRVTLEMGGKNPNIIFADA-DLDLAVEQAHQGVFFNAGQCCTAGSRIYVEEPIYDEFVRRSVERAKRRIVGSPFDPTTEQGPQISREHQNRVLEYIQSGIQEGAKLECGGKALGLKGFFIEPTVFSDVKDDMRIAKEEIFGPVQQIMKFKTVEEAIERANNSDYGLTAAVFTTDINKAMTVSTAMQAGTVWVNCFNALSTQCPFGGYKMSGNGREL 495          
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Medaka
Match: aldh1l2 (aldehyde dehydrogenase 1 family member L2 [Source:NCBI gene;Acc:101167504])

HSP 1 Score: 429.098 bits (1102), Expect = 4.731e-140
Identity = 231/481 (48.02%), Postives = 323/481 (67.15%), Query Frame = 3
Query:  153 KIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIA-KGDLEFSVKILRYYAGYADKIHG-----NTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNT--VEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTI 1571
            + FIN ++ D+E+G T+ TINPT+  VI +V      D+++AV AAK AF  G  W  ++   RG LL KLADL+E + + ++ +E++D+G  Y +A K  +  S++  RY+AG+ DKI G     N   P+ + L++T+ EP+GV   +IPWNYP M+  +K A  +AAG TLV+KPA+ TPL+AL   +L +KAG PKGV+NI+PG G   G  L+ HPD+RK+ FTGST VG  IMK+   ++LK+V+LELGGKSPLIIF+D  ++D+A      +   N G+ C+A  R FVE S++D  + ++ +   K  +GDP D  T  GPQ  K   +K+++  E G +EGA LV GG +V   GFF+QPTVF DV+D+M IAKEE FGPV  V KF    V+ V++RANDT YGL +GVFT DINKA+ +S+ LEAG+V++N Y+   V +PFGGFKQSG G++LG   L  YL+ KAVT+
Sbjct:  444 QCFINGKFEDAEDGKTYSTINPTDGSVICKVSYAAVGDVDRAVAAAKEAFDNGP-WGRMNPRDRGSLLYKLADLMEEHQEELATIESIDSGAVYTLALKTHVGMSIQTFRYFAGWCDKIQGKTIPINQARPNRN-LTFTKKEPLGVCAIVIPWNYPLMMLAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGIPKGVINILPGSGGMVGQRLSDHPDIRKLGFTGSTPVGKQIMKSCALSNLKKVSLELGGKSPLIIFSDC-DMDKAVRMGMSSVFFNKGENCIAAGRLFVEESIHDEYIRRVVEEIMKMKIGDPLDRSTDHGPQNHKAHLDKLLEYCEIGVKEGATLVYGGKQVDRPGFFMQPTVFTDVEDHMFIAKEESFGPVMVVSKFRNGDVDGVLQRANDTEYGLASGVFTRDINKAMYVSEQLEAGTVFVNTYNKTDVASPFGGFKQSGFGKDLGEDALSEYLKTKAVTV 921          
BLAST of Aldehyde dehydrogenase,putative vs. Planmine SMEST
Match: SMESG000001708.1 (SMESG000001708.1)

HSP 1 Score: 980.319 bits (2533), Expect = 0.000e+0
Identity = 489/489 (100.00%), Postives = 489/489 (100.00%), Query Frame = 3
Query:  126 MSAPEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKGDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            MSAPEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINKAVKAAKSAFKFGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKGDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS
Sbjct:    1 MSAPEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINKAVKAAKSAFKFGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKGDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 489          
BLAST of Aldehyde dehydrogenase,putative vs. Planmine SMEST
Match: SMESG000001723.1 (SMESG000001723.1)

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 317/335 (94.63%), Postives = 324/335 (96.72%), Query Frame = 3
Query:  126 MSAPEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKGDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVD 1130
            MS PEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINKAVKAAK AFK GSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKGDLE +VKILRYYAGYADKIHGNTTSPDGDFLSYTR+EPVGVVGAI+PWN+PFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVL+AGFPKGVVNIVPGYGPTAGAAL SHPDVR ITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAH ACM NHGQ C+A +RTFVEASVYDVVVEKLRKLAEKRIVGDPFDE TIQGPQVD
Sbjct:    1 MSIPEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINKAVKAAKIAFKIGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKGDLELAVKILRYYAGYADKIHGNTTSPDGDFLSYTRLEPVGVVGAILPWNFPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLRAGFPKGVVNIVPGYGPTAGAALISHPDVRTITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHRACMFNHGQSCIAASRTFVEASVYDVVVEKLRKLAEKRIVGDPFDENTIQGPQVD 335          
BLAST of Aldehyde dehydrogenase,putative vs. Planmine SMEST
Match: SMESG000001723.1 (SMESG000001723.1)

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 317/377 (84.08%), Postives = 324/377 (85.94%), Query Frame = 3
Query:  126 MSAPEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKGDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKA------------------------------------------GFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVD 1130
            MS PEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINKAVKAAK AFK GSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKGDLE +VKILRYYAGYADKIHGNTTSPDGDFLSYTR+EPVGVVGAI+PWN+PFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVL+A                                          GFPKGVVNIVPGYGPTAGAAL SHPDVR ITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAH ACM NHGQ C+A +RTFVEASVYDVVVEKLRKLAEKRIVGDPFDE TIQGPQVD
Sbjct:    1 MSIPEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINKAVKAAKIAFKIGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKGDLELAVKILRYYAGYADKIHGNTTSPDGDFLSYTRLEPVGVVGAILPWNFPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLRAVIRICLFLMAFRSIQSVSEVSDRPQDFHSTTRPLLCPQAGLHGFPKGVVNIVPGYGPTAGAALISHPDVRTITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHRACMFNHGQSCIAASRTFVEASVYDVVVEKLRKLAEKRIVGDPFDENTIQGPQVD 377          
BLAST of Aldehyde dehydrogenase,putative vs. Planmine SMEST
Match: SMESG000016195.1 (SMESG000016195.1)

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 279/498 (56.02%), Postives = 352/498 (70.68%), Query Frame = 3
Query:  102 SSLFNYIKMSAPEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKG-DLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            SSL   I  +  +V +TKIFINNEW DS    TFPT NP   + I QV EG  +DI+KAV AA  AF+ GS WR +DA+ RG L+ KLA LI  +ADY++ LE LD+GK   IA+  D+E ++K   YYAG+ADK HG      GD++ +TR EPVGV G IIPWN+P ++  +KLAP ++ G T+V+K AEQTPL+A Y+  L  +AGFP GVVNIVPG GPTAGAAL +HP V KI FTGSTEVG II K     ++KR+TLELGGKSP I+FADA + D A  T++ A   N GQCC AG+R +VE  +YD  VE +   A+ ++VG+PFD    QGPQ+D+EQ NKI+  I+SGK EGA++ TGG ++G  GFFI+PT+F  V+D+MRIAKEEIFGPV  + KF    EVI RAN+  YGL A +FT DI+K++ ++QSL AG+VW+NCYDV     PFGG+K SG+GRELG YGL  Y EVK VTI  P KNS
Sbjct:   25 SSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAGFPPGVVNIVPGMGPTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADA-DFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDN-VDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 520          
BLAST of Aldehyde dehydrogenase,putative vs. Planmine SMEST
Match: SMESG000016195.1 (SMESG000016195.1)

HSP 1 Score: 551.592 bits (1420), Expect = 0.000e+0
Identity = 279/498 (56.02%), Postives = 352/498 (70.68%), Query Frame = 3
Query:  102 SSLFNYIKMSAPEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINXXXXXXXXXXXXGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKG-DLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 1592
            SSL   I  +  +V +TKIFINNEW DS    TFPT NP   + I QV EG  +DI+KAV AA  AF+ GS WR +DA+ RG L+ KLA LI  +ADY++ LE LD+GK   IA+  D+E ++K   YYAG+ADK HG      GD++ +TR EPVGV G IIPWN+P ++  +KLAP ++ G T+V+K AEQTPL+A Y+  L  +AGFP GVVNIVPG GPTAGAAL +HP V KI FTGSTEVG II K     ++KR+TLELGGKSP I+FADA + D A  T++ A   N GQCC AG+R +VE  +YD  VE +   A+ ++VG+PFD    QGPQ+D+EQ NKI+  I+SGK EGA++ TGG ++G  GFFI+PT+F  V+D+MRIAKEEIFGPV  + KF    EVI RAN+  YGL A +FT DI+K++ ++QSL AG+VW+NCYDV     PFGG+K SG+GRELG YGL  Y EVK VTI  P KNS
Sbjct:   21 SSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAGFPPGVVNIVPGMGPTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADA-DFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDN-VDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 516          
The following BLAST results are available for this feature:
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ALDH20.000e+060.57aldehyde dehydrogenase 2 family member [Source:HGN... [more]
ALDH1A20.000e+058.23aldehyde dehydrogenase 1 family member A2 [Source:... [more]
ALDH1B10.000e+058.11aldehyde dehydrogenase 1 family member B1 [Source:... [more]
ALDH1A20.000e+057.76aldehyde dehydrogenase 1 family member A2 [Source:... [more]
ALDH1A20.000e+057.73aldehyde dehydrogenase 1 family member A2 [Source:... [more]
back to top
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alh-10.000e+057.76ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;A... [more]
alh-10.000e+057.76ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;A... [more]
alh-20.000e+057.85ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;A... [more]
alh-10.000e+058.63ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;A... [more]
alh-10.000e+058.63ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG310750.000e+055.65gene:FBgn0051075 transcript:FBtr0085080[more]
CG310750.000e+055.00gene:FBgn0051075 transcript:FBtr0307506[more]
Aldh0.000e+056.12gene:FBgn0012036 transcript:FBtr0332597[more]
Aldh0.000e+056.12gene:FBgn0012036 transcript:FBtr0079806[more]
CG86652.436e-13444.62gene:FBgn0032945 transcript:FBtr0081517[more]
back to top
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldh2.10.000e+059.96aldehyde dehydrogenase 2 family member, tandem dup... [more]
aldh2.20.000e+058.93aldehyde dehydrogenase 2 family member, tandem dup... [more]
aldh2.20.000e+058.93aldehyde dehydrogenase 2 family member, tandem dup... [more]
aldh1a20.000e+056.67aldehyde dehydrogenase 1 family, member A2 [Source... [more]
aldh1a20.000e+056.67aldehyde dehydrogenase 1 family, member A2 [Source... [more]
back to top
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mamdc40.000e+059.05MAM domain containing 4 [Source:Xenbase;Acc:XB-GEN... [more]
ALDH1B10.000e+058.78aldehyde dehydrogenase 1 family member B1 [Source:... [more]
mamdc40.000e+057.86MAM domain containing 4 [Source:Xenbase;Acc:XB-GEN... [more]
mamdc40.000e+058.84MAM domain containing 4 [Source:Xenbase;Acc:XB-GEN... [more]
mamdc40.000e+058.63MAM domain containing 4 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Aldh20.000e+061.19aldehyde dehydrogenase 2, mitochondrial [Source:MG... [more]
Aldh1a20.000e+058.85aldehyde dehydrogenase family 1, subfamily A2 [Sou... [more]
Aldh1b10.000e+059.18aldehyde dehydrogenase 1 family, member B1 [Source... [more]
Aldh1a10.000e+058.02aldehyde dehydrogenase family 1, subfamily A1 [Sou... [more]
Aldh1a10.000e+058.02aldehyde dehydrogenase family 1, subfamily A1 [Sou... [more]
back to top
BLAST of Aldehyde dehydrogenase,putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P81178|ALDH2_MESAU0.000e+061.60Aldehyde dehydrogenase, mitochondrial OS=Mesocrice... [more]
sp|P11884|ALDH2_RAT0.000e+061.19Aldehyde dehydrogenase, mitochondrial OS=Rattus no... [more]
sp|P47738|ALDH2_MOUSE0.000e+061.19Aldehyde dehydrogenase, mitochondrial OS=Mus muscu... [more]
sp|P05091|ALDH2_HUMAN0.000e+060.57Aldehyde dehydrogenase, mitochondrial OS=Homo sapi... [more]
sp|Q5RF00|ALDH2_PONAB0.000e+060.37Aldehyde dehydrogenase, mitochondrial OS=Pongo abe... [more]
back to top
BLAST of Aldehyde dehydrogenase,putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2MI020.000e+065.78Aldedh domain-containing protein OS=Opisthorchis f... [more]
G4LWI30.000e+064.61Aldehyde dehydrogenase,putative OS=Schistosoma man... [more]
A0A095A4B60.000e+063.58Aldehyde dehydrogenase X, mitochondrial OS=Schisto... [more]
A0A4D5R9U20.000e+063.99Retinal dehydrogenase 1 OS=Scolopendra viridis OX=... [more]
C1LFP40.000e+063.17Putative aldehyde dehydrogenase 1B1 OS=Schistosoma... [more]
back to top
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldh2.20.000e+060.78aldehyde dehydrogenase 2 family member [Source:NCB... [more]
aldh2.20.000e+060.33aldehyde dehydrogenase 2 family member [Source:NCB... [more]
aldh1a20.000e+055.94aldehyde dehydrogenase 1 family member A2 [Source:... [more]
aldh1a20.000e+056.07aldehyde dehydrogenase 1 family member A2 [Source:... [more]
aldh1a30.000e+053.51aldehyde dehydrogenase 1 family member A3 [Source:... [more]
back to top
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldh1l21.269e-13145.64aldehyde dehydrogenase 1 family, member L2 [Source... [more]
ENSPMAT00000004609.11.326e-9738.56pep scaffold:Pmarinus_7.0:GL479321:13801:23388:1 g... [more]
aldh5a15.675e-7937.32aldehyde dehydrogenase 5 family, member A1 (succin... [more]
aldh8a11.008e-6936.30aldehyde dehydrogenase 8 family, member A1 [Source... [more]
ENSPMAT00000002659.12.113e-5552.53pep scaffold:Pmarinus_7.0:GL481598:469:3326:1 gene... [more]
back to top
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ALD53.199e-15548.95Mitochondrial aldehyde dehydrogenase; involved in ... [more]
ALD49.549e-15447.17Mitochondrial aldehyde dehydrogenase; required for... [more]
ALD66.368e-14745.70Cytosolic aldehyde dehydrogenase; activated by Mg2... [more]
ALD22.102e-13645.58Cytoplasmic aldehyde dehydrogenase; involved in et... [more]
ALD31.312e-12943.54Cytoplasmic aldehyde dehydrogenase; involved in be... [more]
back to top
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO476530.000e+060.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455380.000e+059.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361830.000e+058.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461514.601e-14045.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO278601.590e-13348.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Aldehyde dehydrogenase,putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldh2.20.000e+061.55aldehyde dehydrogenase 2 family member [Source:NCB... [more]
aldh2.20.000e+061.04aldehyde dehydrogenase 2 family member [Source:NCB... [more]
aldh1a20.000e+056.26aldehyde dehydrogenase 1 family member A2 [Source:... [more]
aldh1a20.000e+056.68aldehyde dehydrogenase 1 family member A2 [Source:... [more]
aldh1l24.731e-14048.02aldehyde dehydrogenase 1 family member L2 [Source:... [more]
back to top
BLAST of Aldehyde dehydrogenase,putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000001708.10.000e+0100.00SMESG000001708.1[more]
SMESG000001723.10.000e+094.63SMESG000001723.1[more]
SMESG000001723.10.000e+084.08SMESG000001723.1[more]
SMESG000016195.10.000e+056.02SMESG000016195.1[more]
SMESG000016195.10.000e+056.02SMESG000016195.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032456 ID=SMED30032456|Name=Aldehyde dehydrogenase,putative|organism=Schmidtea mediterranea sexual|type=transcript|length=1686bp
CTTTAACACAAGATTAACAAATCATCAATTAATACAAAGTTCACATTTTG
TTAGTTTAAATAGAAGTTTAAAAACATTGAATACAGTTTAATTTAATTGG
CTCGAGTTTGTTTAATTACATTAAGATGTCAGCTCCCGAAGTTAAATTTA
CTAAAATTTTCATCAATAATGAATGGTGTGATAGTGAAGAAGGGCATACT
TTCCCTACAATTAATCCTACAAATGAAGAAGTAATAGTTCAAGTTCAAGA
AGGCCGAGATAAAGATATTAATAAAGCTGTAAAAGCAGCTAAAAGTGCAT
TTAAATTTGGATCTGAATGGCGTACTTTGGATGCCTCAAAACGGGGAATT
TTATTGAATAAATTGGCTGATCTAATCGAATCGAATGCTGATTACATTTC
CAGACTGGAAGCTTTAGACAATGGAAAATCCTATGTAATTGCTAAAGGAG
ATCTTGAATTTTCGGTGAAAATTTTGAGATATTATGCGGGATATGCTGAT
AAAATTCATGGCAATACAACTTCGCCCGATGGTGATTTTCTTTCGTACAC
TCGAATCGAACCGGTTGGAGTCGTCGGTGCAATTATACCATGGAATTATC
CATTCATGCTGGCTGTTTTCAAATTGGCCCCTGTTATGGCGGCTGGTTGC
ACTCTTGTTATTAAACCCGCTGAACAAACTCCGTTATCAGCTTTATATTT
GGGAGATTTAGTATTAAAAGCAGGATTTCCTAAAGGTGTAGTAAACATTG
TACCGGGGTACGGACCAACTGCCGGTGCTGCTTTGACTTCTCACCCTGAT
GTTAGGAAAATCACATTCACTGGCAGCACCGAAGTTGGGCACATTATAAT
GAAAACTATTGGTAACACAAGTTTGAAGAGGGTAACGTTGGAATTAGGAG
GAAAATCTCCATTGATCATATTTGCTGATGCGCACAATTTGGATGAAGCC
GCTGCTACCGCTCATGAAGCATGTATGACCAATCACGGTCAGTGTTGCGT
TGCGGGAACACGAACATTTGTAGAGGCCAGTGTATATGACGTTGTAGTTG
AGAAATTAAGAAAACTTGCGGAGAAAAGAATTGTTGGAGACCCTTTCGAT
GAGAAAACCATTCAAGGTCCACAGGTTGATAAAGAACAATTTAATAAAAT
CATGGATCTGATTGAAAGTGGGAAACAAGAAGGTGCAAAATTAGTAACCG
GAGGAAACCGAGTTGGAGATGTCGGGTTTTTTATCCAGCCAACAGTTTTC
GGTGACGTGAAAGATAATATGAGAATCGCGAAAGAGGAAATATTTGGACC
AGTTCAATCGGTTTTCAAATTTAACACAGTTGAAGAAGTGATAGAACGAG
CAAATGACACACATTATGGATTGGGAGCTGGAGTTTTCACATCTGATATA
AACAAAGCAATTATGATGAGCCAATCTTTGGAAGCCGGATCAGTTTGGAT
AAATTGCTATGATGTCGGCCTCGTAACAACACCTTTCGGTGGGTTTAAAC
AATCTGGAATCGGCAGAGAACTTGGTTGCTATGGACTTGAGCCTTATCTT
GAAGTAAAAGCTGTTACAATTGCAATTCCACAGAAAAATTCTTAGGCTCT
TGAATAAATTCATAGATTGGTGTTTGTTGAAATTTAGTGATAGTTTAAAA
TTTTCAAATTGAAATATTTGTTTTGTCAAAAAAAAA
back to top

protein sequence of SMED30032456-orf-1

>SMED30032456-orf-1 ID=SMED30032456-orf-1|Name=SMED30032456-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=490bp
MSAPEVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINK
AVKAAKSAFKFGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNG
KSYVIAKGDLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVV
GAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAG
FPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSL
KRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVE
ASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGK
QEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFN
TVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLV
TTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000067goblet cell
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR015590Aldehyde_DH_dom
IPR016162Ald_DH_N
IPR016163Ald_DH_C
IPR029510Ald_DH_CS_GLU
IPR016161Ald_DH/histidinol_DH
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0008152metabolic process
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
GO:0016620oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0004029aldehyde dehydrogenase (NAD) activity
GO:0004030aldehyde dehydrogenase [NAD(P)+] activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR016162Aldehyde dehydrogenase, N-terminalGENE3DG3DSA:3.40.605.10coord: 25..480
e-value: 9.8E-186
score: 619.6
IPR016163Aldehyde dehydrogenase, C-terminalGENE3DG3DSA:3.40.309.10coord: 261..451
e-value: 9.8E-186
score: 619.6
IPR015590Aldehyde dehydrogenase domainPFAMPF00171Aldedhcoord: 17..480
e-value: 7.8E-173
score: 575.2
NoneNo IPR availablePANTHERPTHR11699ALDEHYDE DEHYDROGENASE-RELATEDcoord: 3..488
NoneNo IPR availablePANTHERPTHR11699:SF274coord: 3..488
IPR029510Aldehyde dehydrogenase, glutamic acid active sitePROSITEPS00687ALDEHYDE_DEHYDR_GLUcoord: 255..262
IPR016161Aldehyde/histidinol dehydrogenaseSUPERFAMILYSSF53720ALDH-likecoord: 6..483