Hyccin

Overview
NameHyccin
Smed IDSMED30032439
Length (bp)1592
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Hyccin (SMED30032439) t-SNE clustered cells

Violin plots show distribution of expression levels for Hyccin (SMED30032439) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Hyccin (SMED30032439) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Hyccin (SMED30032439) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032439

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30032439SMESG000023976.1 dd_Smed_v4_5919_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30032439SMESG000023976.1 dd_Smed_v4_5919_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Hyccin vs. Ensembl Human
Match: FAM126A (family with sequence similarity 126 member A [Source:HGNC Symbol;Acc:HGNC:24587])

HSP 1 Score: 83.9593 bits (206), Expect = 8.899e-17
Identity = 80/289 (27.68%), Postives = 134/289 (46.37%), Query Frame = 3
Query:   45 ILKDWLSDFKS-DNNGYSGFFTKYFGNKKFYQKLSQAI-EKKAEI-ESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSP------------VGRPDLDFLNYSLTVPEM-ITTVINDKLLIPGLIQIYNRYLSDYSTESLESYCTLASRISSL-----------DTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSF 827
            ++++WLS+FK+        + T           L + I E ++E+ E +C+Q+++F ++    L +  L FLP ++  YL +S +     +N+ +S   I   LL +YNL   +I+D     K L F IPS +  S++H P            + +  L  + YS   P+  + T  N   ++  L+  YN  L+   + SL+S C + SRI                  RI VSS  + ++  GIYF  +  ++  LA  AL+ I  RA  E+    +L  NAI+ S 
Sbjct:    8 VVEEWLSEFKTLPETSLPNYATNLKDKSSLVSSLYKVIQEPQSELLEPVCHQLFEFYRSGEEQLLQFTLQFLPELIWCYLAVSAS-----RNVHSS-GCIEALLLGVYNL---EIVDKQGHTKVLSFTIPSLSKPSVYHEPSSIGSMALTESALSQHGLSKVVYSGPHPQREMLTAQNRFEVLTFLLLCYNAALTYMPSVSLQSLCQICSRICVCGYPRQHVRKYKGISSRIPVSSGFMVQMLTGIYFAFYNGEW-DLAQKALDDIIYRAQLELYPEPLLVANAIKASL 286          
BLAST of Hyccin vs. Ensembl Human
Match: FAM126A (family with sequence similarity 126 member A [Source:HGNC Symbol;Acc:HGNC:24587])

HSP 1 Score: 83.5741 bits (205), Expect = 2.011e-16
Identity = 80/289 (27.68%), Postives = 134/289 (46.37%), Query Frame = 3
Query:   45 ILKDWLSDFKS-DNNGYSGFFTKYFGNKKFYQKLSQAI-EKKAEI-ESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSP------------VGRPDLDFLNYSLTVPEM-ITTVINDKLLIPGLIQIYNRYLSDYSTESLESYCTLASRISSL-----------DTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSF 827
            ++++WLS+FK+        + T           L + I E ++E+ E +C+Q+++F ++    L +  L FLP ++  YL +S +     +N+ +S   I   LL +YNL   +I+D     K L F IPS +  S++H P            + +  L  + YS   P+  + T  N   ++  L+  YN  L+   + SL+S C + SRI                  RI VSS  + ++  GIYF  +  ++  LA  AL+ I  RA  E+    +L  NAI+ S 
Sbjct:    8 VVEEWLSEFKTLPETSLPNYATNLKDKSSLVSSLYKVIQEPQSELLEPVCHQLFEFYRSGEEQLLQFTLQFLPELIWCYLAVSAS-----RNVHSS-GCIEALLLGVYNL---EIVDKQGHTKVLSFTIPSLSKPSVYHEPSSIGSMALTESALSQHGLSKVVYSGPHPQREMLTAQNRFEVLTFLLLCYNAALTYMPSVSLQSLCQICSRICVCGYPRQHVRKYKGISSRIPVSSGFMVQMLTGIYFAFYNGEW-DLAQKALDDIIYRAQLELYPEPLLVANAIKASL 286          
BLAST of Hyccin vs. Ensembl Human
Match: FAM126A (family with sequence similarity 126 member A [Source:HGNC Symbol;Acc:HGNC:24587])

HSP 1 Score: 78.9518 bits (193), Expect = 5.112e-15
Identity = 70/244 (28.69%), Postives = 114/244 (46.72%), Query Frame = 3
Query:  171 IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSP------------VGRPDLDFLNYSLTVPEM-ITTVINDKLLIPGLIQIYNRYLSDYSTESLESYCTLASRISSL-----------DTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSF 827
            +E +C+Q+++F ++    L +  L FLP ++  YL +S +     +N+ +S   I   LL +YNL   +I+D     K L F IPS +  S++H P            + +  L  + YS   P+  + T  N   ++  L+  YN  L+   + SL+S C + SRI                  RI VSS  + ++  GIYF  +  ++  LA  AL+ I  RA  E+    +L  NAI+ S 
Sbjct:  105 LEPVCHQLFEFYRSGEEQLLQFTLQFLPELIWCYLAVSAS-----RNVHSS-GCIEALLLGVYNL---EIVDKQGHTKVLSFTIPSLSKPSVYHEPSSIGSMALTESALSQHGLSKVVYSGPHPQREMLTAQNRFEVLTFLLLCYNAALTYMPSVSLQSLCQICSRICVCGYPRQHVRKYKGISSRIPVSSGFMVQMLTGIYFAFYNGEW-DLAQKALDDIIYRAQLELYPEPLLVANAIKASL 338          
BLAST of Hyccin vs. Ensembl Human
Match: FAM126B (family with sequence similarity 126 member B [Source:HGNC Symbol;Acc:HGNC:28593])

HSP 1 Score: 75.485 bits (184), Expect = 8.490e-14
Identity = 75/295 (25.42%), Postives = 134/295 (45.42%), Query Frame = 3
Query:   45 ILKDWLSDFKS-DNNGYSGFFTKYFGNKKFYQKLSQAIEKKAE--IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSP--VG----------RPDLDFLNYSLTVPEMITTVINDKL-LIPGLIQIYNRYLSDYSTESLESYCTLASR--ISSLDTK---------PRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSFCINSSD 845
            ++++WLS+FK+  +   + +       K     L + I+      +E +C+Q+++  ++    L +  L FLP ++  YL L  T+ +D +    S   I   LL IYNL   +I D     K L F IPS +  SI+H P  +G          + DL  + YS   P+  T    ++  ++  L+  YN  +      S +S C + SR  +S    +          RI +  E + +L  G+Y+ ++   +  L  + L+ I  RA  E+ +  +L  NA++NS   ++ D
Sbjct:    8 VVEEWLSEFKALPDTQITSYAATLHRKKTLVPALYKVIQDSNNELLEPVCHQLFELYRSSEVRLKRFTLQFLPELMWVYLRL--TVSRDRQ----SNGCIEALLLGIYNL---EIADKDGNNKVLSFTIPSLSKPSIYHEPSTIGSMALTEGALCQHDLIRVVYSDLHPQRETFTAQNRFEVLSFLMLCYNSAIVYMPASSYQSLCRMGSRVCVSGFPRQHEKHWKELCGRIVLDPEFMVQLLTGVYYAMYNGQW-DLGQEVLDDIIYRAQLELFSQPLLVANAMKNSLPFDAPD 292          
BLAST of Hyccin vs. Ensembl Human
Match: FAM126B (family with sequence similarity 126 member B [Source:HGNC Symbol;Acc:HGNC:28593])

HSP 1 Score: 53.9138 bits (128), Expect = 1.310e-7
Identity = 45/166 (27.11%), Postives = 78/166 (46.99%), Query Frame = 3
Query:   45 ILKDWLSDFKS-DNNGYSGFFTKYFGNKKFYQKLSQAIEKKAE--IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSPVGRPDLDFLNYSLTVPEMITTVIND 530
            ++++WLS+FK+  +   + +       K     L + I+      +E +C+Q+++  ++    L +  L FLP ++  YL L  T+ +D +    S   I   LL IYNL   +I D     K L F IPS +  SI+H P     +     +L   ++I  V +D
Sbjct:    8 VVEEWLSEFKALPDTQITSYAATLHRKKTLVPALYKVIQDSNNELLEPVCHQLFELYRSSEVRLKRFTLQFLPELMWVYLRL--TVSRDRQ----SNGCIEALLLGIYNL---EIADKDGNNKVLSFTIPSLSKPSIYHEPSTIGSMALTEGALCQHDLIRVVYSD 164          
BLAST of Hyccin vs. Ensembl Celegans
Match: D1069.3 (pep chromosome:WBcel235:II:341982:347891:-1 gene:WBGene00017037.1 transcript:D1069.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:D1069.3)

HSP 1 Score: 63.5438 bits (153), Expect = 1.814e-10
Identity = 89/314 (28.34%), Postives = 130/314 (41.40%), Query Frame = 3
Query:  171 IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLI-LSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDK-EKPL--FFIPSFTDGSIFHSPVGRPDLDFLNYSLTVPEM----ITTVIN----------------DKLLIPGLIQI-YNRYLSDYSTESLESYCTLAS---------------RISSLDT-----------KPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSFCINS-SDHPIGLKTIIKPRAETMT-NENVITNANFKPEKISEDL 953
            I+SI  QI      K   L    L F+P  +  YL+ LS       K    S+ L  T L++IYN    +I+D S+  EK +    IPS    S++H P        +     VP M    IT V+N                +K +I   I    N  L + ++E    Y  L +               R   LDT           KPR  VS E LN L  G Y  LF      LA  A++ I +RA YE++   +L VN+++NS   N  S    G     +P+ +  T   +++TNA+ K +++ ED+
Sbjct:   62 IQSIIGQILSIY-YKEGVLRLYALQFVPGFVSLYLLALS-------KKQHKSISLFETFLIAIYN---EEIVDGSESNEKKMEDIRIPSIRHHSVYHDPAK------IQVQTDVPVMRNASITPVLNTLRFGPFPSVSKMNGENKFMIINRILFSVNESLFEVASEVAARYVCLGTLSVCRSGFTFPETAFRSRVLDTESHEIIEDFSKKPRQQVSGEFLNHLLRGCYLALF-NGAADLALQAIDAIHLRAQYEMLPDTLLVVNSLRNSLLDNMWSKEKRGELMWTRPQHKDQTKRRDMVTNASLKMKRMPEDI 357          
BLAST of Hyccin vs. Ensembl Fly
Match: Hyccin (gene:FBgn0034269 transcript:FBtr0086884)

HSP 1 Score: 78.1814 bits (191), Expect = 5.578e-15
Identity = 79/356 (22.19%), Postives = 151/356 (42.42%), Query Frame = 3
Query:   42 QILKDWLSDF---KSDNNGYSGFFTKYFGNKKFYQKLSQAIEKKAEIES----ICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL--FFIPSFTDGSIFHSPVGRPDLDFLNYSLTVPEMITTVINDKL----------LIPGLIQIYNRYLSDYSTESLESYCTLASRI--SSLDTK------------------------PRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSFCINSS----DHPIGLKTII---KPRAETMTNENVITNANFKPEKISEDL 953
            ++++DWL+D+   +   +    F  ++  + +  + +     ++   E+    IC Q+  F ++    L+K  L F+P++L  YL    ++   DK        + T L+ IYN      +   D  + +  F +P     S++H     P  D   +       +    + ++          ++  L+  YN+ +S     SL   C + S++      TK                        PRI +S+  L EL + IYF +F   +  +A   L+ I  RA YE+ + V+L  +A++NS   N S    D P+GL   +        T  ++++ITNA+F+ +K+ +D+
Sbjct:    3 ELVRDWLADYQRIRGQPSEAEAFVVEHETDPEIAEAIFTIFNERQRNETLVHDICQQLLAFYRSPEQTLHKFPLQFIPVLLYTYL---HSVAGGDKKAARG---VETLLICIYN----GEVSTEDGGQKVVAFRMPILAQTSVYHEVKNLPMTDLRRWEENCNREVKWGPHQRIESIHAQNRMRILTALLFCYNQQVSQTQKSSLLHLCRVTSQLVNQGFTTKSGHGHRMSYGSDPATGVPFPKPSSPRIPLSAAFLIELVHAIYFAMFN-GFGTIAIQTLDDIHNRAIYEMYSEVILVTSAVRNSLHANPSGQPNDGPMGLSVALTPSTTTVTTSVSKSMITNASFRTKKLPDDI 347          
BLAST of Hyccin vs. Ensembl Fly
Match: Hyccin (gene:FBgn0034269 transcript:FBtr0086883)

HSP 1 Score: 78.1814 bits (191), Expect = 5.578e-15
Identity = 79/356 (22.19%), Postives = 151/356 (42.42%), Query Frame = 3
Query:   42 QILKDWLSDF---KSDNNGYSGFFTKYFGNKKFYQKLSQAIEKKAEIES----ICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL--FFIPSFTDGSIFHSPVGRPDLDFLNYSLTVPEMITTVINDKL----------LIPGLIQIYNRYLSDYSTESLESYCTLASRI--SSLDTK------------------------PRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSFCINSS----DHPIGLKTII---KPRAETMTNENVITNANFKPEKISEDL 953
            ++++DWL+D+   +   +    F  ++  + +  + +     ++   E+    IC Q+  F ++    L+K  L F+P++L  YL    ++   DK        + T L+ IYN      +   D  + +  F +P     S++H     P  D   +       +    + ++          ++  L+  YN+ +S     SL   C + S++      TK                        PRI +S+  L EL + IYF +F   +  +A   L+ I  RA YE+ + V+L  +A++NS   N S    D P+GL   +        T  ++++ITNA+F+ +K+ +D+
Sbjct:    3 ELVRDWLADYQRIRGQPSEAEAFVVEHETDPEIAEAIFTIFNERQRNETLVHDICQQLLAFYRSPEQTLHKFPLQFIPVLLYTYL---HSVAGGDKKAARG---VETLLICIYN----GEVSTEDGGQKVVAFRMPILAQTSVYHEVKNLPMTDLRRWEENCNREVKWGPHQRIESIHAQNRMRILTALLFCYNQQVSQTQKSSLLHLCRVTSQLVNQGFTTKSGHGHRMSYGSDPATGVPFPKPSSPRIPLSAAFLIELVHAIYFAMFN-GFGTIAIQTLDDIHNRAIYEMYSEVILVTSAVRNSLHANPSGQPNDGPMGLSVALTPSTTTVTTSVSKSMITNASFRTKKLPDDI 347          
BLAST of Hyccin vs. Ensembl Zebrafish
Match: fam126a (family with sequence similarity 126 member A [Source:NCBI gene;Acc:402926])

HSP 1 Score: 84.3445 bits (207), Expect = 7.374e-17
Identity = 81/296 (27.36%), Postives = 133/296 (44.93%), Query Frame = 3
Query:   24 LLMKSNQILKDWLSDFKS-DNNGYSGFFTKYFGNKKFYQKLSQAIEKKAE--IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSPVGRPDLDFLNYSL----------TVPEMIT---TVINDKLLIPGLIQIYNRYLSDYSTESLESYCTLASRISSL-----------DTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSF 827
            +L     ++++WLS+FK+ +      +             L + I +     +E +C+Q+++F ++    L +  L FLP ++ +Y  LS T  +D     +    I   LL IYNL   +I+D   + K L F IPS +  S++H P     L     +L          + P +     T  N   ++  L+  YN  LS  S  SL+S C L+SR+S                 R+ V+SE L +L  GI+F L   + V L + AL+ +  RA  E+    +L  NAI++S 
Sbjct:    1 MLAMDQGVVEEWLSEFKTLEETAVYNYAVSLKEKGSLVPALYKVIRENYSDLLEPVCHQLFEFYRSGEPRLQRFTLQFLPELVWSY--LSVTAARD----PHCSGCIEALLLGIYNL---EIVDKDGQSKVLSFTIPSLSKPSVYHEPSSIGSLALTEGALANHGLSRVVYSGPHLQRETFTAQNRFEVLTFLLLCYNASLSYMSGSSLQSLCQLSSRVSICGYPRQQVRRYKGISSRLMVTSEFLVQLITGIHFALCNGE-VDLGSKALDDVLYRAQLELFPEALLVGNAIKSSL 286          
BLAST of Hyccin vs. Ensembl Zebrafish
Match: zgc:158316 (zgc:158316 [Source:ZFIN;Acc:ZDB-GENE-061215-98])

HSP 1 Score: 67.3958 bits (163), Expect = 1.764e-11
Identity = 77/351 (21.94%), Postives = 150/351 (42.74%), Query Frame = 3
Query:   45 ILKDWLSDFKS----DNNGYSGFFTKYFGNKKFYQKLSQAIEKKAE--IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSP------------VGRPDLDFLNYSLTVPEMITTVINDKL-LIPGLIQIYNRYLSDYSTESLESYCTLASRISSLD---------TKP--RIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSFCINSSDHPIG----LKTIIKPRAETMTNENVITNANFKPEKISEDLVHLLDINQNNALN 992
            I++DWLS++K+       GY+    +    +     L   I+      +E +C+Q+++  ++    L    L FLP +L  +L          +   ++   ++  LL IYNL   +I+D     K L F IPS +  SI+H P            + + DL  + YS   P+  T    ++  ++  L+  YN  +    + S  + C ++SR+             + P  R+ +  E + ++   +Y  +F  ++     +AL+ I  RA  E+ +  +L  NA+++S  +++     G    L+  + P A  +T+ ++   +  +     ED   L    +  ALN
Sbjct:    7 IVQDWLSEYKALSEAQRCGYASVLQQ---RETLVPALYSVIQNPHSELLEPVCHQLFELYRSSEERLRCFTLQFLPELLWVFL---------RRGAADASGSVQALLLGIYNL---EIVDKDGNSKLLSFMIPSLSKPSIYHEPSSLGSMALTEGALCQHDLIRVVYSGLHPQRETFTAQNRFEVLCFLMLCYNSVVVYMPSSSYRAVCRMSSRLCVCGFPRQQLKAWSAPGLRVMLDPEFMVQMLTAVYHAIFNGEWDA-GREALDDILYRAELELYSEPLLLGNAMRSSLPVSAPGGSAGSRRLLQVEVTPTASRITHCSITAASIRRLRWQREDADQLSGDEECLALN 341          
BLAST of Hyccin vs. Ensembl Zebrafish
Match: fam126a (family with sequence similarity 126 member A [Source:NCBI gene;Acc:402926])

HSP 1 Score: 63.5438 bits (153), Expect = 6.526e-11
Identity = 64/230 (27.83%), Postives = 105/230 (45.65%), Query Frame = 3
Query:   24 LLMKSNQILKDWLSDFKS-DNNGYSGFFTKYFGNKKFYQKLSQAIEKKAE--IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSP--VGRPDLD---FLNYSL-----TVPEM---ITTVINDKLLIPGLIQIYNRYLSDYSTESLESYCTLASRISSLDTKPRIDV 662
            +L     ++++WLS+FK+ +      +             L + I +     +E +C+Q+++F ++    L +  L FLP ++ +Y  LS T  +D          I   LL IYNL   +I+D   + K L F IPS +  S++H P  +G   L      N+ L     + P +     T  N   ++  L+  YN  LS  S  SL+S C L+SR+ S+   PR  V
Sbjct:    1 MLAMDQGVVEEWLSEFKTLEETAVYNYAVSLKEKGSLVPALYKVIRENYSDLLEPVCHQLFEFYRSGEPRLQRFTLQFLPELVWSY--LSVTAARDPHCSG----CIEALLLGIYNL---EIVDKDGQSKVLSFTIPSLSKPSVYHEPSSIGSLALTEGALANHGLSRVVYSGPHLQRETFTAQNRFEVLTFLLLCYNASLSYMSGSSLQSLCQLSSRV-SICGYPRQQV 220          
BLAST of Hyccin vs. Ensembl Zebrafish
Match: CABZ01079116.1 (protein FAM126B-like [Source:NCBI gene;Acc:100536464])

HSP 1 Score: 51.2174 bits (121), Expect = 9.046e-7
Identity = 50/217 (23.04%), Postives = 94/217 (43.32%), Query Frame = 3
Query:   39 NQILKDWLSDFKS----DNNGYSGFFTKYFGNKKFYQKLSQAIEKKAE--IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSP------------VGRPDLDFLNYSLTVPEMITTVINDKL-LIPGLIQIYNRYLSDYSTESLESYCTLASRI 629
            + I++DWLS++K+       GY+    +    +     L   I+      +E +C+Q+++  ++    L    L FLP +L  ++          +   ++   ++  LL IYNL   +I+D     K L F IPS +  SI+H P            + + DL  + YS   P+  T    ++  ++  L+  YN  +      S  + C ++SR+
Sbjct:    5 SAIVQDWLSEYKALSEAQRCGYASVLQQ---RETLVPALYSVIQNPHSELLEPVCHQLFELYRSSEERLRCFTLQFLPELLWVFM---------RRGAADASGSVQALLLGIYNL---EIVDKDGNSKLLSFMIPSLSKPSIYHEPSSLGSMALTEGALCQHDLIRVVYSGLHPQRETFTAQNRFEVLCFLMLCYNSVVVYMPCSSYRAVCRMSSRL 206          
BLAST of Hyccin vs. Ensembl Xenopus
Match: fam126a (family with sequence similarity 126 member A [Source:NCBI gene;Acc:780214])

HSP 1 Score: 83.1889 bits (204), Expect = 1.519e-16
Identity = 82/296 (27.70%), Postives = 134/296 (45.27%), Query Frame = 3
Query:   24 LLMKSNQILKDWLSDFKSDNNGYSGFFTKYFGNK-KFYQKLSQAIEKKAE--IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSP------------VGRPDLDFLNYSLTVPEM-ITTVINDKLLIPGLIQIYNRYLSDYSTESLESYCTLASRISSL-----------DTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSF 827
            +L     ++++WLS+FK+        +     NK      L + I+K     +E +C+Q+++F ++K   L    L FLP ++  YL +S       + +  S   I   LLSIYNL   +I+D     K L F IPS +  S++H P            + +  L  + YS   P+  + T  N   ++  L+  YN  L+D    SL S C + SR+                K RI +SSE + +L  GIY+  +  ++   A  AL+ +  RA  E++   +L  NAI+ S 
Sbjct:    1 MLTSEKGVVEEWLSEFKTLPEASISSYASGLKNKISLVSALYEVIQKPQSELLEPVCHQLFEFYRSKEKRLGTFTLQFLPELIWCYLSMS-----SSREL-QSCGCIEALLLSIYNL---EIMDEQGHSKILSFTIPSLSKPSVYHEPSSIGSMALTEGALSQHGLTRVVYSGPHPQREMLTAQNRFEVLSFLLLCYNSVLNDMPALSLLSLCQMCSRLCVCGYPRQNARKYQGIKNRIPISSEFMVQLLTGIYYSFYNGEWDA-ARRALDDVLYRAQLELLPEPLLLANAIKASL 286          
BLAST of Hyccin vs. Ensembl Xenopus
Match: fam126a (family with sequence similarity 126 member A [Source:NCBI gene;Acc:780214])

HSP 1 Score: 83.1889 bits (204), Expect = 2.393e-16
Identity = 82/296 (27.70%), Postives = 134/296 (45.27%), Query Frame = 3
Query:   24 LLMKSNQILKDWLSDFKSDNNGYSGFFTKYFGNK-KFYQKLSQAIEKKAE--IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSP------------VGRPDLDFLNYSLTVPEM-ITTVINDKLLIPGLIQIYNRYLSDYSTESLESYCTLASRISSL-----------DTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSF 827
            +L     ++++WLS+FK+        +     NK      L + I+K     +E +C+Q+++F ++K   L    L FLP ++  YL +S       + +  S   I   LLSIYNL   +I+D     K L F IPS +  S++H P            + +  L  + YS   P+  + T  N   ++  L+  YN  L+D    SL S C + SR+                K RI +SSE + +L  GIY+  +  ++   A  AL+ +  RA  E++   +L  NAI+ S 
Sbjct:    1 MLTSEKGVVEEWLSEFKTLPEASISSYASGLKNKISLVSALYEVIQKPQSELLEPVCHQLFEFYRSKEKRLGTFTLQFLPELIWCYLSMS-----SSRELQ-SCGCIEALLLSIYNL---EIMDEQGHSKILSFTIPSLSKPSVYHEPSSIGSMALTEGALSQHGLTRVVYSGPHPQREMLTAQNRFEVLSFLLLCYNSVLNDMPALSLLSLCQMCSRLCVCGYPRQNARKYQGIKNRIPISSEFMVQLLTGIYYSFYNGEWDA-ARRALDDVLYRAQLELLPEPLLLANAIKASL 286          
BLAST of Hyccin vs. Ensembl Xenopus
Match: fam126a (family with sequence similarity 126 member A [Source:NCBI gene;Acc:780214])

HSP 1 Score: 75.8702 bits (185), Expect = 5.205e-14
Identity = 78/275 (28.36%), Postives = 123/275 (44.73%), Query Frame = 3
Query:   87 GYSGFFTKYFGNK-KFYQKLSQAIEKKAE--IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSP------------VGRPDLDFLNYSLTVPEM-ITTVINDKLLIPGLIQIYNRYLSDYSTESLESYCTLASRISSL-----------DTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSF 827
            G  G +     NK      L + I+K     +E +C+Q+++F ++K   L    L FLP ++  YL +S       + +  S   I   LLSIYNL   +I+D     K L F IPS +  S++H P            + +  L  + YS   P+  + T  N   ++  L+  YN  L+D    SL S C + SR+                K RI +SSE + +L  GIY+  +  ++   A  AL+ +  RA  E++   +L  NAI+ S 
Sbjct:   10 GSWGIYASGLKNKISLVSALYEVIQKPQSELLEPVCHQLFEFYRSKEKRLGTFTLQFLPELIWCYLSMS-----SSRELQ-SCGCIEALLLSIYNL---EIMDEQGHSKILSFTIPSLSKPSVYHEPSSIGSMALTEGALSQHGLTRVVYSGPHPQREMLTAQNRFEVLSFLLLCYNSVLNDMPALSLLSLCQMCSRLCVCGYPRQNARKYQGIKNRIPISSEFMVQLLTGIYYSFYNGEWDA-ARRALDDVLYRAQLELLPEPLLLANAIKASL 274          
BLAST of Hyccin vs. Ensembl Xenopus
Match: fam126a (family with sequence similarity 126 member A [Source:NCBI gene;Acc:780214])

HSP 1 Score: 74.7146 bits (182), Expect = 1.178e-13
Identity = 71/244 (29.10%), Postives = 113/244 (46.31%), Query Frame = 3
Query:  171 IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSP------------VGRPDLDFLNYSLTVPEM-ITTVINDKLLIPGLIQIYNRYLSDYSTESLESYCTLASRISSL-----------DTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSF 827
            +E +C+Q+++F ++K   L    L FLP ++  YL +S       + +  S   I   LLSIYNL   +I+D     K L F IPS +  S++H P            + +  L  + YS   P+  + T  N   ++  L+  YN  L+D    SL S C + SR+                K RI +SSE + +L  GIY+  +  ++   A  AL+ +  RA  E++   +L  NAI+ S 
Sbjct:   43 LEPVCHQLFEFYRSKEKRLGTFTLQFLPELIWCYLSMS-----SSRELQ-SCGCIEALLLSIYNL---EIMDEQGHSKILSFTIPSLSKPSVYHEPSSIGSMALTEGALSQHGLTRVVYSGPHPQREMLTAQNRFEVLSFLLLCYNSVLNDMPALSLLSLCQMCSRLCVCGYPRQNARKYQGIKNRIPISSEFMVQLLTGIYYSFYNGEWDA-ARRALDDVLYRAQLELLPEPLLLANAIKASL 276          
BLAST of Hyccin vs. Ensembl Xenopus
Match: tyw1 (tRNA-yW synthesizing protein 1 homolog [Source:Xenbase;Acc:XB-GENE-5955779])

HSP 1 Score: 72.4034 bits (176), Expect = 7.432e-13
Identity = 89/382 (23.30%), Postives = 157/382 (41.10%), Query Frame = 3
Query:   24 LLMKSNQILKDWLSDFKS-DNNGYSGFFTKYFGNKKFYQKLSQAIEKKAE--IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSPVGRPDLDFLNYSLTVPEMITTVINDKLLIPG---------------LIQIYNRYLSDYSTESLESYCTLASRIS-----------SLDTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSFCINSSDHPIGLKTIIK-------PRAETMTNENVITNANFK--------PEK--ISEDLVHLLDINQNNALNKSVKLESLSHIQ 1028
            +L     ++++WLS++K         +       K     L + I+      +E IC+Q+++  ++      +  + FLP ++  YL L  T  +D +    S   I   LL IYNL   +I D     K L F IPS +  SI+H P     +     +L+  ++I  V +D  L P                L+  YN  +      S +S C + SR+              D   R+ +  E + +L  G+Y  ++  ++  L  + L+ I  RA  E+ +  +L  NAI+NS   ++ D     + ++K       PR     +   IT A+ +        PE     ED++++ D ++  +   SV  + LS  Q
Sbjct:    1 MLGSERGVVEEWLSEYKVLPETQLPAYAATLHRKKTLVSSLYKVIQDPNNELLEPICHQLFELYRSSEVRFKRFTMQFLPELICVYLRL--TASRDRQ----SNGCIEALLLGIYNL---EIADKDGNNKILSFTIPSLSKPSIYHEPSSLGSMALTEGALSQHDLIRVVYSD--LHPQRETFTAQNRFEVLSFLMLCYNSAIVYMPPSSYQSLCRMGSRLCVGGFPRQHEKHWKDLCGRVVLDPEFMVQLLTGVYHAIYNGEWH-LGQEVLDDIIYRAQLELYSQPLLVANAIKNSLPFDAPDSSQQGQKVLKVEVTPTVPR----ISRTAITTASIRRHRWRREGPEGTLTGEDILNITDADEGFSSAASVSSQPLSGKQ 366          
BLAST of Hyccin vs. Ensembl Mouse
Match: Fam126a (family with sequence similarity 126, member A [Source:MGI Symbol;Acc:MGI:2149839])

HSP 1 Score: 82.8037 bits (203), Expect = 1.224e-16
Identity = 77/289 (26.64%), Postives = 135/289 (46.71%), Query Frame = 3
Query:   45 ILKDWLSDFKS-DNNGYSGFFTKYFGNKKFYQKLSQAI-EKKAEI-ESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSP------------VGRPDLDFLNYSLTVPEM-ITTVINDKLLIPGLIQIYNRYLSDYSTESLESYCTLASRISSL-----------DTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSF 827
            ++++WLS+FK+        + T           L + I E ++E+ E +C+Q+++F ++    L +  L FLP ++  YL +S +     +++ +S   I   LL +YNL   +I+D     K L F IPS +  S++H P            + +  L  + YS   P+  + T  N   ++  L+  YN  L+   + SL+S C + SRI                  RI +SS  + ++  G+YF ++  ++  LA  AL+ I  RA  E+    +L  NAI+ S 
Sbjct:    8 VVEEWLSEFKTLPETSLPNYATNLKDKSSLVTSLYKVIQEPQSELLEPVCHQLFEFYRSGEEQLLRFTLQFLPELMWCYLAVSAS-----RDVHSS-GCIEALLLGVYNL---EIVDKHGHSKVLSFTIPSLSKPSVYHEPSSIGSMALTESALSQHGLSKVVYSGPHPQREMLTAQNRFEVLTFLLLCYNAALTYMPSVSLQSLCQICSRICVCGYPRQHVRKYRGVSSRIPISSGFMVQMLTGVYFAIYNGEW-DLAQKALDDIIYRAQLELYPEPLLVANAIKASL 286          
BLAST of Hyccin vs. Ensembl Mouse
Match: Fam126a (family with sequence similarity 126, member A [Source:MGI Symbol;Acc:MGI:2149839])

HSP 1 Score: 83.1889 bits (204), Expect = 1.325e-16
Identity = 77/289 (26.64%), Postives = 135/289 (46.71%), Query Frame = 3
Query:   45 ILKDWLSDFKS-DNNGYSGFFTKYFGNKKFYQKLSQAI-EKKAEI-ESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSP------------VGRPDLDFLNYSLTVPEM-ITTVINDKLLIPGLIQIYNRYLSDYSTESLESYCTLASRISSL-----------DTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSF 827
            ++++WLS+FK+        + T           L + I E ++E+ E +C+Q+++F ++    L +  L FLP ++  YL +S +     +++ +S   I   LL +YNL   +I+D     K L F IPS +  S++H P            + +  L  + YS   P+  + T  N   ++  L+  YN  L+   + SL+S C + SRI                  RI +SS  + ++  G+YF ++  ++  LA  AL+ I  RA  E+    +L  NAI+ S 
Sbjct:    8 VVEEWLSEFKTLPETSLPNYATNLKDKSSLVTSLYKVIQEPQSELLEPVCHQLFEFYRSGEEQLLRFTLQFLPELMWCYLAVSAS-----RDVHSS-GCIEALLLGVYNL---EIVDKHGHSKVLSFTIPSLSKPSVYHEPSSIGSMALTESALSQHGLSKVVYSGPHPQREMLTAQNRFEVLTFLLLCYNAALTYMPSVSLQSLCQICSRICVCGYPRQHVRKYRGVSSRIPISSGFMVQMLTGVYFAIYNGEW-DLAQKALDDIIYRAQLELYPEPLLVANAIKASL 286          
BLAST of Hyccin vs. Ensembl Mouse
Match: Fam126a (family with sequence similarity 126, member A [Source:MGI Symbol;Acc:MGI:2149839])

HSP 1 Score: 82.4185 bits (202), Expect = 3.899e-16
Identity = 77/289 (26.64%), Postives = 135/289 (46.71%), Query Frame = 3
Query:   45 ILKDWLSDFKS-DNNGYSGFFTKYFGNKKFYQKLSQAI-EKKAEI-ESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSP------------VGRPDLDFLNYSLTVPEM-ITTVINDKLLIPGLIQIYNRYLSDYSTESLESYCTLASRISSL-----------DTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSF 827
            ++++WLS+FK+        + T           L + I E ++E+ E +C+Q+++F ++    L +  L FLP ++  YL +S +     +++ +S   I   LL +YNL   +I+D     K L F IPS +  S++H P            + +  L  + YS   P+  + T  N   ++  L+  YN  L+   + SL+S C + SRI                  RI +SS  + ++  G+YF ++  ++  LA  AL+ I  RA  E+    +L  NAI+ S 
Sbjct:    8 VVEEWLSEFKTLPETSLPNYATNLKDKSSLVTSLYKVIQEPQSELLEPVCHQLFEFYRSGEEQLLRFTLQFLPELMWCYLAVSAS-----RDVHSS-GCIEALLLGVYNL---EIVDKHGHSKVLSFTIPSLSKPSVYHEPSSIGSMALTESALSQHGLSKVVYSGPHPQREMLTAQNRFEVLTFLLLCYNAALTYMPSVSLQSLCQICSRICVCGYPRQHVRKYRGVSSRIPISSGFMVQMLTGVYFAIYNGEW-DLAQKALDDIIYRAQLELYPEPLLVANAIKASL 286          
BLAST of Hyccin vs. Ensembl Mouse
Match: Fam126b (family with sequence similarity 126, member B [Source:MGI Symbol;Acc:MGI:1098784])

HSP 1 Score: 76.6406 bits (187), Expect = 2.310e-14
Identity = 76/302 (25.17%), Postives = 136/302 (45.03%), Query Frame = 3
Query:   24 LLMKSNQILKDWLSDFKS-DNNGYSGFFTKYFGNKKFYQKLSQAIEKKAE--IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSP--VG----------RPDLDFLNYSLTVPEMITTVINDKL-LIPGLIQIYNRYLSDYSTESLESYCTLASR--ISSLDTK---------PRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSFCINSSD 845
            +L     ++++WLS+FK+  +   + +       K     L + I+      +E +C+Q+++  ++    L +  L FLP ++  YL L  T+ +D +    S   I   LL IYNL   +I D     K L F IPS +  SI+H P  +G          + DL  + YS   P+  T    ++  ++  L+  YN  +      S +S C + SR  +S    +          RI +  E + +L  G+Y+ ++   +  L  + L+ I  RA  E+ +  +L  NA++NS   ++ D
Sbjct:    1 MLGSERAVVEEWLSEFKALPDTQITSYAATLHRKKALVPALYKVIQDSNNELLEPVCHQLFELYRSSEVRLKRFTLQFLPELIWVYLRL--TVSRDRQ----SNGCIEALLLGIYNL---EIADKDGNNKVLSFTIPSLSKPSIYHEPSTIGSMALTEGALCQHDLIRVVYSDLHPQRETFTAQNRFEVLSFLMLCYNSAIVYMPASSYQSLCRMGSRVCVSGFPRQHEKQWKELCGRIVLDPEFMVQLLTGVYYAMYNGQW-DLGQEVLDDIIYRAQLELFSQPLLVANAMKNSLPFDAPD 292          
BLAST of Hyccin vs. Ensembl Mouse
Match: Fam126b (family with sequence similarity 126, member B [Source:MGI Symbol;Acc:MGI:1098784])

HSP 1 Score: 76.6406 bits (187), Expect = 2.310e-14
Identity = 76/302 (25.17%), Postives = 136/302 (45.03%), Query Frame = 3
Query:   24 LLMKSNQILKDWLSDFKS-DNNGYSGFFTKYFGNKKFYQKLSQAIEKKAE--IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSP--VG----------RPDLDFLNYSLTVPEMITTVINDKL-LIPGLIQIYNRYLSDYSTESLESYCTLASR--ISSLDTK---------PRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSFCINSSD 845
            +L     ++++WLS+FK+  +   + +       K     L + I+      +E +C+Q+++  ++    L +  L FLP ++  YL L  T+ +D +    S   I   LL IYNL   +I D     K L F IPS +  SI+H P  +G          + DL  + YS   P+  T    ++  ++  L+  YN  +      S +S C + SR  +S    +          RI +  E + +L  G+Y+ ++   +  L  + L+ I  RA  E+ +  +L  NA++NS   ++ D
Sbjct:    1 MLGSERAVVEEWLSEFKALPDTQITSYAATLHRKKALVPALYKVIQDSNNELLEPVCHQLFELYRSSEVRLKRFTLQFLPELIWVYLRL--TVSRDRQ----SNGCIEALLLGIYNL---EIADKDGNNKVLSFTIPSLSKPSIYHEPSTIGSMALTEGALCQHDLIRVVYSDLHPQRETFTAQNRFEVLSFLMLCYNSAIVYMPASSYQSLCRMGSRVCVSGFPRQHEKQWKELCGRIVLDPEFMVQLLTGVYYAMYNGQW-DLGQEVLDDIIYRAQLELFSQPLLVANAMKNSLPFDAPD 292          
BLAST of Hyccin vs. UniProt/SwissProt
Match: sp|Q5ZM13|HYCCI_CHICK (Hyccin OS=Gallus gallus OX=9031 GN=FAM126A PE=2 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 5.416e-16
Identity = 80/296 (27.03%), Postives = 137/296 (46.28%), Query Frame = 3
Query:   24 LLMKSNQILKDWLSDFKS-DNNGYSGFFTKYFGNKKFYQKLSQAI-EKKAEI-ESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSP------------VGRPDLDFLNYSLTVPEM-ITTVINDKLLIPGLIQIYNRYLSDYSTESLESYCTLASRISSL-----------DTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSF 827
            +L     ++++WLS+FK+      S + T           L + I E ++E+ E +C+Q+++F ++    L +  L FLP ++  YL +S +     +++ +S   I   LL +YNL   +I+D     K L F IPS +  S++H P            + +  L  + YS   P+  + T  N   ++  L+  YN  LS     SL+S C + SRI                  RI VSSE + ++  GIY+  +  ++  LA  A++ +  RA  E+    +L  NAI+ S 
Sbjct:    1 MLAVDTGLVEEWLSEFKTLPEASISSYATNLKDKTALISSLYKVIQEPQSELLEPVCHQLFEFYRSGEEQLLRFTLQFLPELMWCYLAVSAS-----RDLQSS-GCIEALLLGVYNL---EIVDKEGHSKVLSFTIPSLSKPSVYHEPSSIGSMALTEGALSQHGLSRVVYSGPHPQREMLTAQNRFEVLTFLLLCYNAALSYMPAISLQSLCQICSRICVCGYPRQQVRKYKGVNSRIPVSSEFMVQMLTGIYYAFYNGEW-DLARKAMDDVLYRAQLELYPEPLLVANAIKASL 286          
BLAST of Hyccin vs. UniProt/SwissProt
Match: sp|Q6P121|HYCCI_DANRE (Hyccin OS=Danio rerio OX=7955 GN=fam126a PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 5.566e-16
Identity = 81/296 (27.36%), Postives = 133/296 (44.93%), Query Frame = 3
Query:   24 LLMKSNQILKDWLSDFKS-DNNGYSGFFTKYFGNKKFYQKLSQAIEKKAE--IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSPVGRPDLDFLNYSL----------TVPEMIT---TVINDKLLIPGLIQIYNRYLSDYSTESLESYCTLASRISSL-----------DTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSF 827
            +L     ++++WLS+FK+ +      +             L + I +     +E +C+Q+++F ++    L +  L FLP ++ +Y  LS T  +D     +    I   LL IYNL   +I+D   + K L F IPS +  S++H P     L     +L          + P +     T  N   ++  L+  YN  LS  S  SL+S C L+SR+S                 R+ V+SE L +L  GI+F L   + V L + AL+ +  RA  E+    +L  NAI++S 
Sbjct:    1 MLAMDQGVVEEWLSEFKTLEETAVYNYAVSLKEKGSLVPALYKVIRENYSDLLEPVCHQLFEFYRSGEPRLQRFTLQFLPELVWSY--LSVTAARD----PHCSGCIEALLLGIYNL---EIVDKDGQSKVLSFTIPSLSKPSVYHEPSSIGSLALTEGALANHGLSRVVYSGPHLQRETFTAQNRFEVLTFLLLCYNASLSYMSGSSLQSLCQLSSRVSICGYPRQQVRRYKGISSRLMVTSEFLVQLITGIHFALCNGE-VDLGSKALDDVLYRAQLELFPEALLVGNAIKSSL 286          
BLAST of Hyccin vs. UniProt/SwissProt
Match: sp|Q9BYI3|HYCCI_HUMAN (Hyccin OS=Homo sapiens OX=9606 GN=FAM126A PE=1 SV=2)

HSP 1 Score: 83.5741 bits (205), Expect = 9.658e-16
Identity = 80/289 (27.68%), Postives = 134/289 (46.37%), Query Frame = 3
Query:   45 ILKDWLSDFKS-DNNGYSGFFTKYFGNKKFYQKLSQAI-EKKAEI-ESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSP------------VGRPDLDFLNYSLTVPEM-ITTVINDKLLIPGLIQIYNRYLSDYSTESLESYCTLASRISSL-----------DTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSF 827
            ++++WLS+FK+        + T           L + I E ++E+ E +C+Q+++F ++    L +  L FLP ++  YL +S +     +N+ +S   I   LL +YNL   +I+D     K L F IPS +  S++H P            + +  L  + YS   P+  + T  N   ++  L+  YN  L+   + SL+S C + SRI                  RI VSS  + ++  GIYF  +  ++  LA  AL+ I  RA  E+    +L  NAI+ S 
Sbjct:    8 VVEEWLSEFKTLPETSLPNYATNLKDKSSLVSSLYKVIQEPQSELLEPVCHQLFEFYRSGEEQLLQFTLQFLPELIWCYLAVSAS-----RNVHSS-GCIEALLLGVYNL---EIVDKQGHTKVLSFTIPSLSKPSVYHEPSSIGSMALTESALSQHGLSKVVYSGPHPQREMLTAQNRFEVLTFLLLCYNAALTYMPSVSLQSLCQICSRICVCGYPRQHVRKYKGISSRIPVSSGFMVQMLTGIYFAFYNGEW-DLAQKALDDIIYRAQLELYPEPLLVANAIKASL 286          
BLAST of Hyccin vs. UniProt/SwissProt
Match: sp|Q6P9N1|HYCCI_MOUSE (Hyccin OS=Mus musculus OX=10090 GN=Fam126a PE=1 SV=3)

HSP 1 Score: 82.4185 bits (202), Expect = 2.727e-15
Identity = 77/289 (26.64%), Postives = 135/289 (46.71%), Query Frame = 3
Query:   45 ILKDWLSDFKS-DNNGYSGFFTKYFGNKKFYQKLSQAI-EKKAEI-ESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSP------------VGRPDLDFLNYSLTVPEM-ITTVINDKLLIPGLIQIYNRYLSDYSTESLESYCTLASRISSL-----------DTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSF 827
            ++++WLS+FK+        + T           L + I E ++E+ E +C+Q+++F ++    L +  L FLP ++  YL +S +     +++ +S   I   LL +YNL   +I+D     K L F IPS +  S++H P            + +  L  + YS   P+  + T  N   ++  L+  YN  L+   + SL+S C + SRI                  RI +SS  + ++  G+YF ++  ++  LA  AL+ I  RA  E+    +L  NAI+ S 
Sbjct:    8 VVEEWLSEFKTLPETSLPNYATNLKDKSSLVTSLYKVIQEPQSELLEPVCHQLFEFYRSGEEQLLRFTLQFLPELMWCYLAVSAS-----RDVHSS-GCIEALLLGVYNL---EIVDKHGHSKVLSFTIPSLSKPSVYHEPSSIGSMALTESALSQHGLSKVVYSGPHPQREMLTAQNRFEVLTFLLLCYNAALTYMPSVSLQSLCQICSRICVCGYPRQHVRKYRGVSSRIPISSGFMVQMLTGVYFAIYNGEW-DLAQKALDDIIYRAQLELYPEPLLVANAIKASL 286          
BLAST of Hyccin vs. UniProt/SwissProt
Match: sp|Q8C729|F126B_MOUSE (Protein FAM126B OS=Mus musculus OX=10090 GN=Fam126b PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.616e-13
Identity = 76/302 (25.17%), Postives = 136/302 (45.03%), Query Frame = 3
Query:   24 LLMKSNQILKDWLSDFKS-DNNGYSGFFTKYFGNKKFYQKLSQAIEKKAE--IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSP--VG----------RPDLDFLNYSLTVPEMITTVINDKL-LIPGLIQIYNRYLSDYSTESLESYCTLASR--ISSLDTK---------PRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSFCINSSD 845
            +L     ++++WLS+FK+  +   + +       K     L + I+      +E +C+Q+++  ++    L +  L FLP ++  YL L  T+ +D +    S   I   LL IYNL   +I D     K L F IPS +  SI+H P  +G          + DL  + YS   P+  T    ++  ++  L+  YN  +      S +S C + SR  +S    +          RI +  E + +L  G+Y+ ++   +  L  + L+ I  RA  E+ +  +L  NA++NS   ++ D
Sbjct:    1 MLGSERAVVEEWLSEFKALPDTQITSYAATLHRKKALVPALYKVIQDSNNELLEPVCHQLFELYRSSEVRLKRFTLQFLPELIWVYLRL--TVSRDRQ----SNGCIEALLLGIYNL---EIADKDGNNKVLSFTIPSLSKPSIYHEPSTIGSMALTEGALCQHDLIRVVYSDLHPQRETFTAQNRFEVLSFLMLCYNSAIVYMPASSYQSLCRMGSRVCVSGFPRQHEKQWKELCGRIVLDPEFMVQLLTGVYYAMYNGQW-DLGQEVLDDIIYRAQLELFSQPLLVANAMKNSLPFDAPD 292          
BLAST of Hyccin vs. TrEMBL
Match: A0A4C1UWU5 (Hyccin OS=Eumeta variegata OX=151549 GN=Fam126a PE=4 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 3.392e-24
Identity = 90/292 (30.82%), Postives = 153/292 (52.40%), Query Frame = 3
Query:  171 IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPLFF-IPSFTDGSIFHSPVGRPDLDFLNYSL---------------TVPEMITTVINDKL-LIPGLIQIYNRYLSDYSTESLESYCTLASRI---------SSLDTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSFCINSS----DHPIGLKTIIKPRAETMT-NENVITNANFKPEKISEDL 953
            +E +C Q++ F +++ + L +  L F+P ++  Y+ LS ++ ++DK    +   I T L+S+YN    +++D   K K + F +PS    SI+H P+      FL  S                 +P++      ++L ++  L+ +YNR LS     +L  +C  ASRI         ++ +T PRI +SS  L EL +G YF +F + Y  LA  A+N I+ RA YE+   VML   A+ +S   NSS    D P+G+   + P   T+T ++ +ITNA+F+ +K+ +D+
Sbjct:   67 LEDVCMQLFSFYRSRETELQRFTLQFIPTLI--YIYLS-SVAREDKK---TCRCIETLLISLYNF---EVVDEEGKPKVVAFRLPSLAQASIYHEPLSL-GAQFLTESALRRWEECNTKLVTWGPLPQIEVINAQNRLKVMTALLFVYNRQLSLLPKLALRHFCIAASRIVNQGFPSKNNTNNTIPRIPMSSNFLLELIHGSYFSIFNEFYT-LALQAVNDIDQRAQYELFPEVMLVSGAVIHSLQTNSSGQPCDGPMGISVALSPATTTVTMSKCMITNASFRTKKLPDDI 347          
BLAST of Hyccin vs. TrEMBL
Match: A0A2H1WDE2 (SFRICE_015796 OS=Spodoptera frugiperda OX=7108 GN=SFRICE_015796 PE=4 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 2.322e-23
Identity = 93/304 (30.59%), Postives = 147/304 (48.36%), Query Frame = 3
Query:  138 KLSQAIEKKAEIESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSPVGRPDLDFLNYSLTVPEMITT------------VINDK---LLIPGLIQIYNRYLSDYSTESLESYCTLASRI-----------SSLDTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSFCINSS----DHPIGLKTIIKPRAETMT-NENVITNANFKPEKISEDL 953
            KL    E +  +E++C Q++ F ++K   L +  L F+P ++ NYL    ++ +  K    +   I T L+ +YN    +++D   K K + F +PS    SI+H P+          +L   E   T            VIN +    ++  L+ IYNR LS     +L  +C  ASRI            S    PRI VSS  L E+  G YF +F + Y  LA  A+  I+ RA YE+   VML  +A+ NS   N S    D P+G+   + P   T+T ++++ITNA+F+ +K+ +D+
Sbjct:   56 KLENESEYEQILENVCTQLFSFYRSKEVELQRFTLQFVPTLIYNYLS---SVAQGSK---KTWRCIETLLIGLYNY---EVVDEEGKPKVVQFRLPSLAQASIYHEPLSLGSQFLTESALRRWEECNTKLVSWGPFPQVEVINAQNRLKVMSALLFIYNRQLSLLPKLALRHFCIAASRIVTQGFNKKITTPSGKPVPRIPVSSSFLLEMIEGAYFAMFNEFYT-LAHQAVQDIDQRAQYELFPDVMLVTSAVINSLKNNPSGQPCDGPMGISVALSPATTTVTMSKSMITNASFRTKKLPDDI 349          
BLAST of Hyccin vs. TrEMBL
Match: A0A2A4JWI8 (Uncharacterized protein OS=Heliothis virescens OX=7102 GN=B5V51_10206 PE=4 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 3.379e-23
Identity = 96/346 (27.75%), Postives = 172/346 (49.71%), Query Frame = 3
Query:   18 EFLLMKSNQILKDWLSDFKSDNNGYSGFFTKYFGNKKFYQKLSQAIEKKAE--IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSPVG---------------RPDLDFLNYSLTVPEMITTVINDKL-LIPGLIQIYNRYLSDYSTESLESYCTLASRISSLD--TKP--------RIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSFCINSS----DHPIGLKTIIKPRAETMT-NENVITNANFKPEKISEDL 953
            E+  ++ N+I K + ++ + ++   +  F  ++   +     S  +E + E  +E++C Q++ F ++K   L +  L F+P ++ NYL    ++ + +K I      I T L+ +YN    +++D   K K + F +PS    SI+H P+                  +   +N+   +P++      ++L ++  L+ IYNR LS     +L  +C  ASRI +    TKP        RI VS   L E+  G YF +F + Y  LA  A+  I+ RA YE+   VML  +A+ NS   N S    D P+G+   + P   T+T ++++ITNA+F+ +K+ +D+
Sbjct:   14 EYASLQENEI-KSFAAEHEHNHEIATAIFNLFYSEDESELNASNKLESENEQILENVCTQLFSFYRSKEVELQRFTLQFVPTLIYNYL---SSVAQGNKKI---CRCIETLLIGLYNF---EVVDEDGKPKVVSFRLPSLAQASIYHEPLSLGSQFLTESALRRWEECNTKLVNWG-PLPQVEVLNAQNRLKVMSALLFIYNRQLSLLPKLALRHFCIAASRIVTQGFYTKPSGSEKKVSRIPVSPNFLLEMIEGAYFAMFNEFYT-LAHQAVQDIDQRAQYELYPDVMLVSSAVINSLKNNPSGQPCDGPMGISVALSPATTTVTMSKSMITNASFRTKKLPDDI 347          
BLAST of Hyccin vs. TrEMBL
Match: A0A3S2P573 (Uncharacterized protein OS=Chilo suppressalis OX=168631 GN=evm_002564 PE=4 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 4.027e-23
Identity = 99/359 (27.58%), Postives = 168/359 (46.80%), Query Frame = 3
Query:   42 QILKDWLSDFKS-DNNGYSGFFTKYFGNKKFYQKL-----------SQAIEKKAE------IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILS----FTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSPVGRPDLDFLNYSLTVPEMITT------------VINDK---LLIPGLIQIYNRYLSDYSTESLESYCTLASRI------------SSLDTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSFCINSS----DHPIGLKTIIKPRAETMT-NENVITNANFKPEKISEDL 953
            Q++ +WL+++ S   N    F  ++  N +    L           +    K++E      +E++C Q++ F ++K   L +  L FLP ++ NYL  +      IC+           I T L+++YN    +++D + K K + F +PS    SI+H P+          +L   E   T            V+N +    ++  L+ IYNR LS     +L  +C  ASRI            +S  + PRI V+   L E+  G YF +F + Y  LA  A+  I+ RA YE+   VML  +A+ NS   +SS    D P+G+   + P   T+T ++++ITNA+F+ +K+ +D+
Sbjct:    6 QLITEWLNEYASLQENEIKSFAAEHEHNHEISTALFNLFYSEDDCDTSCCSKQSEAQNDEMLENVCTQLFSFYRSKEVELQRFTLQFLPTLIYNYLSCAAHGNLKICR----------CIETLLIALYNF---EVVDEAGKPKVISFRLPSLAQPSIYHEPLSLGPQFLTENALRRWEECNTKLVSWGPMSQVEVLNAQNRLKVMSALLFIYNRQLSLLPKLALRHFCIAASRIVTHGFHKKIGTSNSKKSTPRIPVTPNFLLEMIEGAYFAMFNEFYT-LALQAVKDIDQRAQYELFPDVMLVTSAVMNSLKNSSSGQPCDGPMGISVALSPATTTVTMSKSMITNASFRTKKLPDDI 350          
BLAST of Hyccin vs. TrEMBL
Match: A0A1B6ML45 (Uncharacterized protein OS=Graphocephala atropunctata OX=36148 GN=g.29234 PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 5.824e-23
Identity = 90/350 (25.71%), Postives = 166/350 (47.43%), Query Frame = 3
Query:   36 SNQILKDWLSDFKSDNNG-YSGFFTKYFGNKKFYQKLSQAIEKKAE----IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL---FFIPSFTDGSIFHSPVGRPDLDFLNYSLTVPEMITTVI---------------NDKLLIPGLIQIYNRYLSDYSTESLESYCTLASRIS-----------SLDTK-----PRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNS----FCINSSDHPIGLKTIIKPRAETMT-NENVITNANFKPEKISEDL 953
            + QI+++WL+D+ + +      F      NK+    +   +E++ +    I+ +C  ++ F +++  +L +  L FLP ++  Y+ L+     + KN       +   L+ IYNL   +++D  DK +P    F +PS    SI+H P+          +L   E   T +               N   ++  L+ +YNR++S     +LE  C + S++            S  T+     PRI VSS+ L +L + +YF ++  DY  +A  A+  I  RA Y+  + ++L  N+I+NS         SD P+G+   I P   T T ++++ITNA+F+ +K+ +D+
Sbjct:    2 TEQIVREWLADYSALSPAEVHTFAVTVHHNKEVIAAIYSVLEERYKYQTLIDPVCTALFGFYRSREEDLQRFTLFFLPTLI--YVYLNAVAHSESKNCRG----VEALLVGIYNL---EVVD--DKGQPREISFRLPSLAQASIYHEPMSLAPASLTEAALRRLEECNTKLVRWGPLAQVDRILAQNRLTVMTALLYVYNRHISVLPKAALEYLCKVTSKLVTQGFSKAGKRVSYGTEVPRVLPRIPVSSQLLQQLLHSVYFAMY-NDYGYMAVQAVEDIHQRACYQCYSELLLITNSIKNSSHFIHSGQPSDAPMGISMAISPATATTTVSKSMITNASFRTKKLPDDI 339          
BLAST of Hyccin vs. Ensembl Cavefish
Match: fam126a (family with sequence similarity 126 member A [Source:NCBI gene;Acc:103043168])

HSP 1 Score: 77.7962 bits (190), Expect = 7.853e-15
Identity = 79/299 (26.42%), Postives = 136/299 (45.48%), Query Frame = 3
Query:   24 LLMKSNQILKDWLSDFKSDNNGYSGFFTKYFGNKKFYQKLSQAIEKKAE------IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSP--VGRPDLD---FLNYSL-----TVPEMIT---TVINDKLLIPGLIQIYNRYLSDYSTESLESYCTLASRISSL-----------DTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSF 827
            +L     ++++WLS+FK+         + Y  + K    L  A+ K         +E +C+Q+++F ++    L +  L FLP ++ +YL +S      D +       I   LL IYNL   +I+D   + + L F +PS +  S++H P  +G   L      N+ L     + P +     T  N   ++  L+  YN  LS  ++ SL+S C L+SR+                  R+ V+SE L +L  GI+F L   +   L + AL+ +  RA  E+    +L  NAI+++ 
Sbjct:    1 MLAMDQGVVEEWLSEFKTLPETA---ISSYASSLKEKASLVPAVYKVIRENYSDLLEPVCHQLFEFYRSGEPRLQRFTLQFLPELVWSYLSVS---AGRDPHCSG---CIEALLLGIYNL---EIVDKDGQSRILTFTVPSLSKPSVYHEPSAIGSMALTEGALANHGLSRVVYSGPHLQRETFTAQNRFEVLTFLLLCYNAALSYVTSSSLQSLCQLSSRVCICGYPRQQMRRYKGINSRMMVTSEFLVQLITGIHFALCNGE-TELGSKALDDVLYRAQLELYPEALLVGNAIKSTL 286          
BLAST of Hyccin vs. Ensembl Cavefish
Match: fam126a (family with sequence similarity 126 member A [Source:NCBI gene;Acc:103043168])

HSP 1 Score: 77.7962 bits (190), Expect = 7.853e-15
Identity = 79/299 (26.42%), Postives = 136/299 (45.48%), Query Frame = 3
Query:   24 LLMKSNQILKDWLSDFKSDNNGYSGFFTKYFGNKKFYQKLSQAIEKKAE------IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSP--VGRPDLD---FLNYSL-----TVPEMIT---TVINDKLLIPGLIQIYNRYLSDYSTESLESYCTLASRISSL-----------DTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSF 827
            +L     ++++WLS+FK+         + Y  + K    L  A+ K         +E +C+Q+++F ++    L +  L FLP ++ +YL +S      D +       I   LL IYNL   +I+D   + + L F +PS +  S++H P  +G   L      N+ L     + P +     T  N   ++  L+  YN  LS  ++ SL+S C L+SR+                  R+ V+SE L +L  GI+F L   +   L + AL+ +  RA  E+    +L  NAI+++ 
Sbjct:    1 MLAMDQGVVEEWLSEFKTLPETA---ISSYASSLKEKASLVPAVYKVIRENYSDLLEPVCHQLFEFYRSGEPRLQRFTLQFLPELVWSYLSVS---AGRDPHCSG---CIEALLLGIYNL---EIVDKDGQSRILTFTVPSLSKPSVYHEPSAIGSMALTEGALANHGLSRVVYSGPHLQRETFTAQNRFEVLTFLLLCYNAALSYVTSSSLQSLCQLSSRVCICGYPRQQMRRYKGINSRMMVTSEFLVQLITGIHFALCNGE-TELGSKALDDVLYRAQLELYPEALLVGNAIKSTL 286          
BLAST of Hyccin vs. Ensembl Cavefish
Match: zgc:158316 (zgc:158316 [Source:ZFIN;Acc:ZDB-GENE-061215-98])

HSP 1 Score: 68.5514 bits (166), Expect = 5.974e-12
Identity = 72/299 (24.08%), Postives = 127/299 (42.47%), Query Frame = 3
Query:   24 LLMKSNQILKDWLSDFKS-DNNGYSGFFTKYFGNKKFYQKLSQAIEKKAE--IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSP------------VGRPDLDFLNYSLTVPEMIT-TVINDKLLIPGLIQIYNRYLSDYSTESLESYCTLASRISSLDTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSFCINSSDHPIGLKTI 869
            +L +   ++++WLS+FK+   + +S + +     K     L + I+      +E +C+Q+++  +     L +  L FLP ++  YL L+ +  +           I   LL IYNL   +I+D     K L F IPS +  S+FH P            + + DL  + YS   P+  T T  N   ++  L+  YN  +      S ++ C ++SR                     NG +          L  +AL+ I  RA  E+ +  +L  NA++NS  +++ D   G K +
Sbjct:    1 MLGEGRGVVEEWLSEFKTLPESQFSSYASTLHQKKNLVPALYRVIQDPNSELLEPVCHQLFELYRNSEDRLRRFTLQFLPELVWMYLRLTASRNRQSNGC------IEALLLGIYNL---EIVDKEGNSKLLSFTIPSLSKPSVFHEPSSLGSMALTEGALCQHDLIRVVYSGLHPQRETFTAQNRFEVLCFLMLCYNSAVVYMPASSYQAACRMSSRY--------------------NGEW---------DLGREALDDILYRAQLELYSEPLLLGNAMKNSLPVSAPDGSRGKKVL 261          
BLAST of Hyccin vs. Ensembl Sea Lamprey
Match: FAM126B (family with sequence similarity 126 member B [Source:HGNC Symbol;Acc:HGNC:28593])

HSP 1 Score: 82.8037 bits (203), Expect = 4.459e-17
Identity = 74/338 (21.89%), Postives = 153/338 (45.27%), Query Frame = 3
Query:   45 ILKDWLSDFKSDNNGYSGFFTKYFGNK-----KFYQKLSQAIEKKAEIESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPLFF-IPSFTDGSIFHSPVGRPDLDFLNYSLTVPEMITTVINDKL-------------LIPGLIQIYNRYLSDYSTESLESYCTLASR--ISSL--------DTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSFCINSSDHPIGLKTIIK----PRAETMTNENVITNANFKPEKISEDLVH 959
            ++++WLS+FK+      G +      K       Y+ + +A  +   +E +C+Q+++FA++    L    L FLP++++ YL       +  +  +N        LL +YNL   +I++     K L F IPS +  SI+H P     +  +  +L+  +++       L             ++  L+  YN  +    + S ++ C++ S+  IS          + + RI +S E + +L  GIY+ ++   +  L  +AL+ +  RA  E     +L  NA++NS   ++ D     + +I+    P    ++  N +T+A+ +  +  +D++ 
Sbjct:    8 VVEEWLSEFKALPETSIGSYADKLQQKMTLISALYKVIREAHSEL--LEPVCHQLFEFARSGEPRLRLFTLQFLPVLVDRYLT-GLAAAQGPRPRNNGCA--EALLLGLYNL---EIVEKDATSKVLAFTIPSLSKSSIYHEPGSMGSVAMMEATLSGRDVVRVAYAGPLPHRDAFSAQNRFEVLTFLLVCYNSVVVQMPSSSYQALCSMCSQVCISGFPRQKRIWKEPRARIALSPEFMVQLLTGIYYTIYNGGW-DLGNEALDNVIYRAQLEFYPEPLLVGNAMKNSLRWDAPDSMDPKQQVIQVEVTPTLRRLSR-NAVTSASIRRHRWRKDVLE 335          
BLAST of Hyccin vs. Ensembl Sea Lamprey
Match: FAM126B (family with sequence similarity 126 member B [Source:HGNC Symbol;Acc:HGNC:28593])

HSP 1 Score: 76.2554 bits (186), Expect = 5.834e-15
Identity = 64/290 (22.07%), Postives = 125/290 (43.10%), Query Frame = 3
Query:   45 ILKDWLSDFKS-DNNGYSGFFTKYFGNKKFYQKLSQAIEK--KAEIESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILS--FTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPLFF-IPSFTDGSIFHSPVGRPDLDFLNYSLTVPEMITTVINDKL-------------LIPGLIQIYNRYLSDYSTESLESYCTLASRI----------SSLDTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSF 827
            +++DWLS+FK+   +  S +             L + I       +E +C+Q+++F ++  + L    L FLP ++  YL  S  + +        ++L      LL +YNL   +I++     K L F IP+    S++H P     +  +   L+  E +       L             ++  L+  YN  ++     S ++ C + SR+             + + +I +S E + +L  G+Y+ ++   +V L  +AL  +  RA  E+ T  +L  NA+++S 
Sbjct:    8 VVEDWLSEFKALPESSISSYAVTVHQKTALVSALYKVIGALNSELLEPVCHQLFEFVRSGEARLRHFALQFLPALISRYLAGSAPYGLRVQSHGCVDAL------LLGLYNL---EIVEADGNSKVLAFTIPTLAKPSLYHEPGSLGSMAMMEAVLSGREAVRVAYAGPLPQREAFTAQNRFEVLSFLMLCYNAAIAHMPPSSHQALCHMCSRVCVSGFPRQKKRWREHRTKISLSPEFIVDLLTGVYYSIYNGQWV-LGQEALEDVLYRAQLELYTEPLLVGNAMRSSL 287          
BLAST of Hyccin vs. Ensembl Nematostella
Match: EDO42200 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2A0])

HSP 1 Score: 72.0182 bits (175), Expect = 1.015e-13
Identity = 72/282 (25.53%), Postives = 129/282 (45.74%), Query Frame = 3
Query:  180 ICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPLFFIPSFTDGSIFHSP-VGRPDLDFLNYS-LTVPEMITTVI-----NDKL----------LIPGLIQIYNRYLSDYSTESLESYCTLASRIS-------------------------SLDTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSFCINSS---DHPIGLKTIIKPRAET 890
            IC   ++  +T N +    VL F+P+++  YL  +   C+ DK     L  I   LL+IYN +   ++D    EK  F +PS +  S++H P +G   +  L  S L+  E   T I     N +L          ++  ++  YN  ++  + +S  SYC +A RI+                         SL   PR+ + +  + E+++G+Y+LL+     I A  AL +++ R  + ++    +  NA+ +S  I  +   + P+GL+ +I P A+T
Sbjct:   50 ICSSFFELYRTGNRDAMNFVLQFVPVLIWTYLAAT---CRRDKQGYGELEAI---LLAIYNSV---VMDNKGIEK-TFRLPSLSRPSMYHEPSIGVSSMPALTESVLSRHEQSETPIVINGPNKQLTRISAGYRMSVLCTVLSQYNSSIALMNEDSHTSYCIMAHRIAKAGFSKLCRKDSTDCNGFLSNEELQSLSNHPRVPIVAPLIQEITHGLYYLLYNGQPDI-AKTALEQLDFRVAHGLLAPAHVLTNAVVHSQSITDAAPKEGPLGLQVLI-PSADT 319          
BLAST of Hyccin vs. Ensembl Medaka
Match: fam126a (family with sequence similarity 126 member A [Source:NCBI gene;Acc:101165651])

HSP 1 Score: 80.8777 bits (198), Expect = 7.846e-16
Identity = 75/296 (25.34%), Postives = 134/296 (45.27%), Query Frame = 3
Query:   24 LLMKSNQILKDWLSDFKS-DNNGYSGFFTKYFGNKKFYQKLSQAIEKKAE--IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSPVGRPDLDFLNYSL----------TVPEMITTVINDK---LLIPGLIQIYNRYLSDYSTESLESYCTLASRISSL-----------DTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSF 827
            +L     ++++WLS+FK+  ++  S +             L + I +     +E +C+Q+++F ++    L +  L FLP +L ++  LS +  +D          I   LL IYNL   +I+D   + K L F +PS +  S++H P     +     +L          + P +     N +    ++  L+  YN  LS  +T SL+S C L+SR+                  R+ V+SE L +L  GI++ L   + V + + AL+ +  RA  E+    +L  NAI++S 
Sbjct:    1 MLAMDQGVVEEWLSEFKTLPDSAISTYAVSLKDKGALVPALYKVIRENYSDLLEPVCHQLFEFYRSGVPQLQRFTLQFLPELLWSF--LSVSAARDPHTSG----CIEALLLGIYNL---EIVDKDGQSKILSFTVPSLSKPSVYHEPSAIGSIALTEGALANHGQSRVVYSGPHLQRETFNAQNRFEVLTFLLLCYNAALSYMTTTSLQSLCQLSSRVCICGYPRQQMRRYKGISTRLTVTSEFLVQLITGIHYALCNGE-VEVGSKALDDVLYRAQLELFPEALLVGNAIKSSL 286          
BLAST of Hyccin vs. Ensembl Medaka
Match: zgc:158316 (family with sequence similarity 126 member B [Source:NCBI gene;Acc:101169153])

HSP 1 Score: 71.633 bits (174), Expect = 7.631e-13
Identity = 72/306 (23.53%), Postives = 139/306 (45.42%), Query Frame = 3
Query:   45 ILKDWLSDFKSDNNGYSGFFTKYFGNKKFYQKLSQAIEKKAE------IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSP------------VGRPDLDFLNYSLTVPEMITTVINDKL-LIPGLIQIYNRYLSDYSTESLESYCTLASRI---------SSLDTKP--RIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSFCINSSDHPIGLKTI 869
            ++++WLS+FKS    +      Y G+    + L  A+ +  +      +E +C+Q+++  ++    L +  L FLP ++  ++ L  T  +D +    S   I   LL IYNL   +I+D     + L F IPS +  SI+H P            + + D   + YS   P+  T    ++  ++  L+  YN  +      S +S C ++SR+           L  +P  R+ +  E + ++   +Y  ++  ++  +  +AL  I  RA  E+ +  +L  NA+++S   ++ D P G K +
Sbjct:    8 VVEEWLSEFKSLPETH---IPSYAGSLHLKKSLVPALYRVIQDPNNELLEPVCHQLFELYRSSEDRLRRFTLQFLPELV--WVYLRITASRDRQ----SNGCIEALLLGIYNL---EIVDKDGNSRLLSFTIPSLSKPSIYHEPSSLGSMVLTEGALCQHDQIRVLYSGLHPQRETFTAQNRFEVLCFLMLCYNAAVVYMPLSSYQSVCRMSSRLCVCGFPRQQQKLWREPCNRVLLDPEFMVQMLTAVYHAIYNGEWE-MGREALEDIVYRAQLELYSQPLLLGNAMKSSLPESAPDDPRGRKVL 300          
BLAST of Hyccin vs. Ensembl Medaka
Match: zgc:158316 (family with sequence similarity 126 member B [Source:NCBI gene;Acc:101169153])

HSP 1 Score: 71.2478 bits (173), Expect = 1.015e-12
Identity = 74/306 (24.18%), Postives = 139/306 (45.42%), Query Frame = 3
Query:   45 ILKDWLSDFKSDNNGYSGFFTKYFGNKKFYQKLSQAIEKKAE------IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSP------------VGRPDLDFLNYSLTVPEMIT-TVINDKLLIPGLIQIYNRYLSDYSTESLESYCTLASRI---------SSLDTKP--RIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSFCINSSDHPIGLKTI 869
            ++++WLS+FKS    +      Y G+    + L  A+ +  +      +E +C+Q+++  ++    L +  L FLP ++  ++ L  T  +D +    S   I   LL IYNL   +I+D     + L F IPS +  SI+H P            + + D   + YS   P+  T T  N   ++  L+  YN  +      S +S C ++SR+           L  +P  R+ +  E + ++   +Y  ++  ++  +  +AL  I  RA  E+ +  +L  NA+++S   ++ D P G K +
Sbjct:    8 VVEEWLSEFKSLPETH---IPSYAGSLHLKKSLVPALYRVIQDPNNELLEPVCHQLFELYRSSEDRLRRFTLQFLPELV--WVYLRITASRDRQ----SNGCIEALLLGIYNL---EIVDKDGNSRLLSFTIPSLSKPSIYHEPSSLGSMVLTEGALCQHDQIRVLYSGLHPQRETFTAQNRFEVLCFLMLCYNAAVVYMPLSSYQSVCRMSSRLCVCGFPRQQQKLWREPCNRVLLDPEFMVQMLTAVYHAIYNGEWE-MGREALEDIVYRAQLELYSQPLLLGNAMKSSLPESAPDDPRGRKVL 300          
BLAST of Hyccin vs. Ensembl Medaka
Match: zgc:158316 (family with sequence similarity 126 member B [Source:NCBI gene;Acc:101169153])

HSP 1 Score: 71.2478 bits (173), Expect = 1.015e-12
Identity = 74/306 (24.18%), Postives = 139/306 (45.42%), Query Frame = 3
Query:   45 ILKDWLSDFKSDNNGYSGFFTKYFGNKKFYQKLSQAIEKKAE------IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSP------------VGRPDLDFLNYSLTVPEMIT-TVINDKLLIPGLIQIYNRYLSDYSTESLESYCTLASRI---------SSLDTKP--RIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSFCINSSDHPIGLKTI 869
            ++++WLS+FKS    +      Y G+    + L  A+ +  +      +E +C+Q+++  ++    L +  L FLP ++  ++ L  T  +D +    S   I   LL IYNL   +I+D     + L F IPS +  SI+H P            + + D   + YS   P+  T T  N   ++  L+  YN  +      S +S C ++SR+           L  +P  R+ +  E + ++   +Y  ++  ++  +  +AL  I  RA  E+ +  +L  NA+++S   ++ D P G K +
Sbjct:    8 VVEEWLSEFKSLPETH---IPSYAGSLHLKKSLVPALYRVIQDPNNELLEPVCHQLFELYRSSEDRLRRFTLQFLPELV--WVYLRITASRDRQ----SNGCIEALLLGIYNL---EIVDKDGNSRLLSFTIPSLSKPSIYHEPSSLGSMVLTEGALCQHDQIRVLYSGLHPQRETFTAQNRFEVLCFLMLCYNAAVVYMPLSSYQSVCRMSSRLCVCGFPRQQQKLWREPCNRVLLDPEFMVQMLTAVYHAIYNGEWE-MGREALEDIVYRAQLELYSQPLLLGNAMKSSLPESAPDDPRGRKVL 300          
BLAST of Hyccin vs. Ensembl Medaka
Match: zgc:158316 (family with sequence similarity 126 member B [Source:NCBI gene;Acc:101169153])

HSP 1 Score: 61.6178 bits (148), Expect = 1.049e-9
Identity = 71/295 (24.07%), Postives = 125/295 (42.37%), Query Frame = 3
Query:   45 ILKDWLSDFKSDNNGYSGFFTKYFGNKKFYQKLSQAIEKKAE------IESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPL-FFIPSFTDGSIFHSP------------VGRPDLDFLNYSLTVPEMIT-TVINDKLLIPGLIQIYNRYLSDYSTESLESYCTLASRISSLDTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSFCINSSDHPIGLKTI 869
            ++++WLS+FKS    +      Y G+    + L  A+ +  +      +E +C+Q+++  ++    L +  L FLP ++  ++ L  T  +D +    S   I   LL IYNL   +I+D     + L F IPS +  SI+H P            + + D   + YS   P+  T T  N   ++  L+  YN  +      S +S C ++SR                     NG +          +  +AL  I  RA  E+ +  +L  NA+++S   ++ D P G K +
Sbjct:    8 VVEEWLSEFKSLPETH---IPSYAGSLHLKKSLVPALYRVIQDPNNELLEPVCHQLFELYRSSEDRLRRFTLQFLPELV--WVYLRITASRDRQ----SNGCIEALLLGIYNL---EIVDKDGNSRLLSFTIPSLSKPSIYHEPSSLGSMVLTEGALCQHDQIRVLYSGLHPQRETFTAQNRFEVLCFLMLCYNAAVVYMPLSSYQSVCRMSSRY--------------------NGEWE---------MGREALEDIVYRAQLELYSQPLLLGNAMKSSLPESAPDDPRGRKVL 261          
BLAST of Hyccin vs. Planmine SMEST
Match: SMESG000023976.1 (SMESG000023976.1)

HSP 1 Score: 786.563 bits (2030), Expect = 0.000e+0
Identity = 388/391 (99.23%), Postives = 389/391 (99.49%), Query Frame = 3
Query:   30 MKSNQILKDWLSDFKSDNNGYSGFFTKYFGNKKFYQKLSQAIEKKAEIESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSIYNLLKPKILDISDKEKPLFFIPSFTDGSIFHSPVGRPDLDFLNYSLTVPEMITTVINDKLLIPGLIQIYNRYLSDYSTESLESYCTLASRISSLDTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYEIMTSVMLTVNAIQNSFCINSSDHPIGLKTIIKPRAETMTNENVITNANFKPEKISEDLVHLLDINQNNALNKSVKLESLSHIQGSKSEHVTIDPAEISVQFKSSSTNQIPKSSNRIKFSLKSDKSHNQNGENRICETEAQM 1202
            MKSNQILKDWLSDFKSDNNGYSGFFTKYFGNKKFYQKLSQAIEKKAEIESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLS+YNLLKPKILDISDKEKPLFFIPSFTDGSIFHSPVGRPDLDFLNYSLTVPEMITTVINDKLLIPGLIQIYNRYLSDYSTESLESYCTLASRISSLDTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDAL KIEVRANYEIMTSVMLTVNAIQNSFCINSSDHPIGLK IIKPRAETMTNENVITNANFKPEKISEDLVHLLDINQNNALNKSVKLESLSHIQGSKSEHVTIDPAEISVQFKSSSTNQIPKSSNRIKFSLKSDKSHNQNGENRICETEAQM
Sbjct:    1 MKSNQILKDWLSDFKSDNNGYSGFFTKYFGNKKFYQKLSQAIEKKAEIESICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLVLIRTCLLSLYNLLKPKILDISDKEKPLFFIPSFTDGSIFHSPVGRPDLDFLNYSLTVPEMITTVINDKLLIPGLIQIYNRYLSDYSTESLESYCTLASRISSLDTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALKKIEVRANYEIMTSVMLTVNAIQNSFCINSSDHPIGLKAIIKPRAETMTNENVITNANFKPEKISEDLVHLLDINQNNALNKSVKLESLSHIQGSKSEHVTIDPAEISVQFKSSSTNQIPKSSNRIKFSLKSDKSHNQNGENRICETEAQM 391          
The following BLAST results are available for this feature:
BLAST of Hyccin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FAM126A8.899e-1727.68family with sequence similarity 126 member A [Sour... [more]
FAM126A2.011e-1627.68family with sequence similarity 126 member A [Sour... [more]
FAM126A5.112e-1528.69family with sequence similarity 126 member A [Sour... [more]
FAM126B8.490e-1425.42family with sequence similarity 126 member B [Sour... [more]
FAM126B1.310e-727.11family with sequence similarity 126 member B [Sour... [more]
back to top
BLAST of Hyccin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
D1069.31.814e-1028.34pep chromosome:WBcel235:II:341982:347891:-1 gene:W... [more]
back to top
BLAST of Hyccin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Hyccin5.578e-1522.19gene:FBgn0034269 transcript:FBtr0086884[more]
Hyccin5.578e-1522.19gene:FBgn0034269 transcript:FBtr0086883[more]
back to top
BLAST of Hyccin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
fam126a7.374e-1727.36family with sequence similarity 126 member A [Sour... [more]
zgc:1583161.764e-1121.94zgc:158316 [Source:ZFIN;Acc:ZDB-GENE-061215-98][more]
fam126a6.526e-1127.83family with sequence similarity 126 member A [Sour... [more]
CABZ01079116.19.046e-723.04protein FAM126B-like [Source:NCBI gene;Acc:1005364... [more]
back to top
BLAST of Hyccin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fam126a1.519e-1627.70family with sequence similarity 126 member A [Sour... [more]
fam126a2.393e-1627.70family with sequence similarity 126 member A [Sour... [more]
fam126a5.205e-1428.36family with sequence similarity 126 member A [Sour... [more]
fam126a1.178e-1329.10family with sequence similarity 126 member A [Sour... [more]
tyw17.432e-1323.30tRNA-yW synthesizing protein 1 homolog [Source:Xen... [more]
back to top
BLAST of Hyccin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fam126a1.224e-1626.64family with sequence similarity 126, member A [Sou... [more]
Fam126a1.325e-1626.64family with sequence similarity 126, member A [Sou... [more]
Fam126a3.899e-1626.64family with sequence similarity 126, member A [Sou... [more]
Fam126b2.310e-1425.17family with sequence similarity 126, member B [Sou... [more]
Fam126b2.310e-1425.17family with sequence similarity 126, member B [Sou... [more]
back to top
BLAST of Hyccin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZM13|HYCCI_CHICK5.416e-1627.03Hyccin OS=Gallus gallus OX=9031 GN=FAM126A PE=2 SV... [more]
sp|Q6P121|HYCCI_DANRE5.566e-1627.36Hyccin OS=Danio rerio OX=7955 GN=fam126a PE=2 SV=1[more]
sp|Q9BYI3|HYCCI_HUMAN9.658e-1627.68Hyccin OS=Homo sapiens OX=9606 GN=FAM126A PE=1 SV=... [more]
sp|Q6P9N1|HYCCI_MOUSE2.727e-1526.64Hyccin OS=Mus musculus OX=10090 GN=Fam126a PE=1 SV... [more]
sp|Q8C729|F126B_MOUSE1.616e-1325.17Protein FAM126B OS=Mus musculus OX=10090 GN=Fam126... [more]
back to top
BLAST of Hyccin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4C1UWU53.392e-2430.82Hyccin OS=Eumeta variegata OX=151549 GN=Fam126a PE... [more]
A0A2H1WDE22.322e-2330.59SFRICE_015796 OS=Spodoptera frugiperda OX=7108 GN=... [more]
A0A2A4JWI83.379e-2327.75Uncharacterized protein OS=Heliothis virescens OX=... [more]
A0A3S2P5734.027e-2327.58Uncharacterized protein OS=Chilo suppressalis OX=1... [more]
A0A1B6ML455.824e-2325.71Uncharacterized protein OS=Graphocephala atropunct... [more]
back to top
BLAST of Hyccin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
fam126a7.853e-1526.42family with sequence similarity 126 member A [Sour... [more]
fam126a7.853e-1526.42family with sequence similarity 126 member A [Sour... [more]
zgc:1583165.974e-1224.08zgc:158316 [Source:ZFIN;Acc:ZDB-GENE-061215-98][more]
back to top
BLAST of Hyccin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
FAM126B4.459e-1721.89family with sequence similarity 126 member B [Sour... [more]
FAM126B5.834e-1522.07family with sequence similarity 126 member B [Sour... [more]
back to top
BLAST of Hyccin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hyccin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO422001.015e-1325.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Hyccin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fam126a7.846e-1625.34family with sequence similarity 126 member A [Sour... [more]
zgc:1583167.631e-1323.53family with sequence similarity 126 member B [Sour... [more]
zgc:1583161.015e-1224.18family with sequence similarity 126 member B [Sour... [more]
zgc:1583161.015e-1224.18family with sequence similarity 126 member B [Sour... [more]
zgc:1583161.049e-924.07family with sequence similarity 126 member B [Sour... [more]
back to top
BLAST of Hyccin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000023976.10.000e+099.23SMESG000023976.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032439 ID=SMED30032439|Name=Hyccin|organism=Schmidtea mediterranea sexual|type=transcript|length=1592bp
ATATAAATCTTATATGAGAATTTCTTCTTATGAAATCAAATCAAATATTA
AAAGATTGGCTTTCTGATTTTAAATCTGACAATAATGGCTATTCTGGATT
TTTTACGAAATATTTTGGCAACAAAAAATTTTATCAAAAGTTATCACAAG
CTATAGAAAAGAAAGCAGAAATTGAATCAATATGTTATCAAATTTATAAA
TTTGCTCAAACGAAAAACTCTAATCTTAACAAAATGGTTTTAGATTTTTT
GCCTATTATTTTAGAAAATTATTTAATTTTATCTTTTACAATATGTAAAG
ATGATAAAAATATTGATAATAGTTTAGTATTAATAAGAACGTGTCTATTA
AGTATATACAATCTATTGAAACCAAAGATTTTGGATATCTCAGACAAAGA
GAAACCATTATTTTTCATACCTTCATTTACTGATGGATCAATATTCCATT
CACCAGTAGGGCGCCCTGATTTAGATTTCCTCAATTATAGCCTAACAGTG
CCAGAAATGATAACAACTGTAATAAATGACAAACTGTTAATTCCCGGCTT
AATTCAAATTTACAATCGATATCTTTCAGATTATTCTACGGAATCACTTG
AAAGTTATTGTACTCTGGCATCTAGAATATCTTCCCTGGACACTAAACCA
AGAATTGATGTATCAAGTGAAACTCTAAATGAATTATCGAATGGGATTTA
TTTTCTATTATTTAAACAAGATTACGTGATCTTGGCCACAGACGCGTTGA
ATAAAATAGAAGTACGAGCAAACTATGAGATTATGACCAGTGTTATGTTG
ACAGTGAATGCTATTCAAAATTCGTTTTGCATCAATTCATCCGATCATCC
AATCGGCCTTAAAACCATTATCAAGCCTCGCGCAGAAACTATGACCAATG
AAAATGTGATTACCAATGCAAATTTTAAGCCGGAAAAGATTTCAGAAGAT
CTTGTACATTTGTTGGATATCAATCAGAACAATGCGTTGAACAAATCGGT
AAAATTGGAGAGTTTATCACATATTCAGGGATCCAAGAGTGAACACGTTA
CCATTGATCCCGCCGAGATTAGCGTTCAATTCAAGTCTTCCTCAACCAAT
CAAATTCCAAAGTCCAGCAATAGAATTAAATTTTCCTTGAAATCCGATAA
GTCGCACAACCAAAATGGAGAAAATCGAATTTGCGAAACTGAAGCACAAA
TGTGAACTGAGAATATATATTTTTGTCTAGAAGATTTCTTTTTTCTATAT
TTTATTTGAGTTCGTTTTTATGTGCTTTCTTTAGAATTATGTCAAGCATA
CAAACATTGCTCAATTAATCGTAGTTGTAACGTCTGTTTCTGTGTGTATC
AATGATGAGTAATGTGCGTATTAATGGTATGGAGATGTGTGTGTATAAAT
GATTCGGTGATGTGTTTATGCATACTCACATTGTTATCAAATTCGATTCT
TTTACGAATTTGTCATTTTTCCGTTATTTTTGTTAGCCAATTAAATTTTT
AGAAATACGTGTTCATTATTGATTTTGTCACATTGTTGTATTGATGGGCT
CCCAAATTATGTATAATATTGACTATTTTTTACCGAATTTAG
back to top

protein sequence of SMED30032439-orf-1

>SMED30032439-orf-1 ID=SMED30032439-orf-1|Name=SMED30032439-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=392bp
MKSNQILKDWLSDFKSDNNGYSGFFTKYFGNKKFYQKLSQAIEKKAEIES
ICYQIYKFAQTKNSNLNKMVLDFLPIILENYLILSFTICKDDKNIDNSLV
LIRTCLLSIYNLLKPKILDISDKEKPLFFIPSFTDGSIFHSPVGRPDLDF
LNYSLTVPEMITTVINDKLLIPGLIQIYNRYLSDYSTESLESYCTLASRI
SSLDTKPRIDVSSETLNELSNGIYFLLFKQDYVILATDALNKIEVRANYE
IMTSVMLTVNAIQNSFCINSSDHPIGLKTIIKPRAETMTNENVITNANFK
PEKISEDLVHLLDINQNNALNKSVKLESLSHIQGSKSEHVTIDPAEISVQ
FKSSSTNQIPKSSNRIKFSLKSDKSHNQNGENRICETEAQM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR018619Hyccin
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005886plasma membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0042552myelination
GO:0046854phosphatidylinositol phosphorylation
GO:0090002establishment of protein localization to plasma membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018619HyccinPFAMPF09790Hyccincoord: 33..311
e-value: 6.8E-32
score: 110.8
IPR018619HyccinPANTHERPTHR31220HYCCIN RELATEDcoord: 209..319
IPR018619HyccinPANTHERPTHR31220HYCCIN RELATEDcoord: 6..206
NoneNo IPR availablePANTHERPTHR31220:SF1coord: 209..319
NoneNo IPR availablePANTHERPTHR31220:SF1coord: 6..206