Adipocyte plasma membrane-associated protein

Overview
NameAdipocyte plasma membrane-associated protein
Smed IDSMED30032436
Length (bp)1393
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Adipocyte plasma membrane-associated protein (SMED30032436) t-SNE clustered cells

Violin plots show distribution of expression levels for Adipocyte plasma membrane-associated protein (SMED30032436) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Adipocyte plasma membrane-associated protein (SMED30032436) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Adipocyte plasma membrane-associated protein (SMED30032436) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032436

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30032436SMESG000064318.1 Contig2304GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30032436SMESG000052602.1 Contig2304GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30032436SMESG000052602.1 dd_Smed_v4_3602_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032436SMESG000052602.1 dd_Smed_v4_3602_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30032436SMESG000052602.1 dd_Smed_v4_3602_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032436SMESG000052602.1 dd_Smed_v4_3602_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Human
Match: APMAP (adipocyte plasma membrane associated protein [Source:HGNC Symbol;Acc:HGNC:13238])

HSP 1 Score: 151.754 bits (382), Expect = 1.342e-40
Identity = 104/391 (26.60%), Postives = 192/391 (49.10%), Query Frame = 2
Query:   71 YRILFMLIKFVIVVSL-GILIYWAAPKIETDPKLVIKKNTQLKFSSTFKRISWDNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKYVDKDKLIVADAYHGIYAIHLGRDMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGI-IYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKI---NLLKSQDNVEVFVDGLLGTVDNVKRDNQDNFYVAL----PTEDSYLLSFIHRYPLINYYVAWLIPKRVFNIFLKSKSRILKINNEGEIVLEI-SGNKVGMDFITEAYETNGKILLGNLFNPYLDVLYLN 1213
            +R+ F+++   + V L G ++   +P    DP+ +  K   L             + RLF     GPES  H  +   ++TG ADG++  L+  +I T  +        +  C++ +    CGR LG++      L VADAY G++ ++  +     ++L+S +  +  +++ F N L V+++G  IYFT SS KW   D L   +EG   GR+  YD VTR++ ++   L FPNG+ L+  +  ++VAE T  R+ ++    L+K     ++FV+ + G  DN++  +   ++V +    P     +L F+   P I   +  L  +     F+   S +L++++ G     +   + +   +I+E +E +G + LG+  +P+L  L L 
Sbjct:   39 FRVTFLMLAVSLTVPLLGAMMLLESP---IDPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAH--IGDVMFTGTADGRVVKLENGEIETIARF------GSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREV--KLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGLMKG--GADLFVENMPGFPDNIRPSSSGGYWVGMSTIRPNPGFSMLDFLSERPWIKRMIFKLFSQETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYLGSFRSPFLCRLSLQ 414          
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Human
Match: APMAP (adipocyte plasma membrane associated protein [Source:HGNC Symbol;Acc:HGNC:13238])

HSP 1 Score: 144.821 bits (364), Expect = 3.661e-38
Identity = 104/399 (26.07%), Postives = 192/399 (48.12%), Query Frame = 2
Query:   71 YRILFMLIKFVIVVSL-GILIYWAAPKIETDPKLVIKKNTQLKFSSTFKRISWDNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKYVDKDKLIVADAYHGIYAIHLGRDMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGI-IYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKI---NLLKSQDNVEVFVDGLLGTVDNVKRDNQDNFYVAL----PTEDSYLLSFIHRYPLINYYV--------AWLIPKRVFNIFLKSKSRILKINNEGEIVLEI-SGNKVGMDFITEAYETNGKILLGNLFNPYLDVLYLN 1213
            +R+ F+++   + V L G ++   +P    DP+ +  K   L             + RLF     GPES  H  +   ++TG ADG++  L+  +I T  +        +  C++ +    CGR LG++      L VADAY G++ ++  +     ++L+S +  +  +++ F N L V+++G  IYFT SS KW   D L   +EG   GR+  YD VTR++ ++   L FPNG+ L+  +  ++VAE T  R+ ++    L+K     ++FV+ + G  DN++  +   ++V +    P     +L F+   P I   +          L  +     F+   S +L++++ G     +   + +   +I+E +E +G + LG+  +P+L  L L 
Sbjct:   24 FRVTFLMLAVSLTVPLLGAMMLLESP---IDPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAH--IGDVMFTGTADGRVVKLENGEIETIARF------GSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREV--KLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGLMKG--GADLFVENMPGFPDNIRPSSSGGYWVGMSTIRPNPGFSMLDFLSERPWIKRMIFKGSCAGCDLLFSQETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYLGSFRSPFLCRLSLQ 407          
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Celegans
Match: F57C2.5 (pep chromosome:WBcel235:II:14526213:14528296:-1 gene:WBGene00010197.1 transcript:F57C2.5a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F57C2.5)

HSP 1 Score: 106.686 bits (265), Expect = 4.446e-25
Identity = 91/341 (26.69%), Postives = 163/341 (47.80%), Query Frame = 2
Query:  227 DNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGK-LYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKYV--DKDKLIVADAYHGIYAIHLG--RDMATKQVLVSPDKDMLTRSLK--FFNSLDVSKNGIIYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLKSQDNVEVFVDGLLGTVDNVKRDNQDNFYVALPTEDSY----LLSFIHRYPLINYYVAWLIP----KRVFNIFLKSKSRILKINNEGEIVL---EISGNKVGMDFITEAYETNGKILLGNLFNPYL 1195
            + +  +  G   GPES   D    AIY    D K L I+D   +S    S+    +   +C   +    CGR LG++ +   K K +V DAY G+Y +     ++  + Q+L   D  +    LK  F N LDV     +  + SS +      + A LE  + GR++   + T+ + ++A  L FPNG+ LT+++ S++ AE +  R+ K+ +  +   VE+F   L G  DN++   +  ++V L    S     LL  +   P I  ++  ++P    K +  +F    S I+++++ G+IV    +++G  VG    ++  E NG + +G+  + Y+
Sbjct:   57 EKAEHILDGKIVGPESMVVD--DEAIYVSVNDAKVLKIVDGRVVSKA--SYSEKSKFFPDCGHFDTEPECGRPLGIRRLVAGKPKFVVCDAYLGVYIVDFTDEQNPISTQIL---DSKVPIDGLKPRFLNDLDVISEDELIISDSSTRHDRRHFMAAILEHQADGRIFHLKISTKSVKVLADKLYFPNGIQLTEDKKSVIFAECSMARIKKLTI--ASKKVEMFAANLPGLPDNIRSSGRGTYWVGLTATRSATHPSLLDRLGSLPGIRQFLVDIVPGPYWKPLLGLFKNPHSIIIELDSVGKIVRSLHDVTGKHVGD--ASQVTEHNGHLYIGSFADHYI 386          
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Celegans
Match: F57C2.5 (pep chromosome:WBcel235:II:14526213:14528239:-1 gene:WBGene00010197.1 transcript:F57C2.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F57C2.5)

HSP 1 Score: 106.686 bits (265), Expect = 4.446e-25
Identity = 91/341 (26.69%), Postives = 163/341 (47.80%), Query Frame = 2
Query:  227 DNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGK-LYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKYV--DKDKLIVADAYHGIYAIHLG--RDMATKQVLVSPDKDMLTRSLK--FFNSLDVSKNGIIYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLKSQDNVEVFVDGLLGTVDNVKRDNQDNFYVALPTEDSY----LLSFIHRYPLINYYVAWLIP----KRVFNIFLKSKSRILKINNEGEIVL---EISGNKVGMDFITEAYETNGKILLGNLFNPYL 1195
            + +  +  G   GPES   D    AIY    D K L I+D   +S    S+    +   +C   +    CGR LG++ +   K K +V DAY G+Y +     ++  + Q+L   D  +    LK  F N LDV     +  + SS +      + A LE  + GR++   + T+ + ++A  L FPNG+ LT+++ S++ AE +  R+ K+ +  +   VE+F   L G  DN++   +  ++V L    S     LL  +   P I  ++  ++P    K +  +F    S I+++++ G+IV    +++G  VG    ++  E NG + +G+  + Y+
Sbjct:   57 EKAEHILDGKIVGPESMVVD--DEAIYVSVNDAKVLKIVDGRVVSKA--SYSEKSKFFPDCGHFDTEPECGRPLGIRRLVAGKPKFVVCDAYLGVYIVDFTDEQNPISTQIL---DSKVPIDGLKPRFLNDLDVISEDELIISDSSTRHDRRHFMAAILEHQADGRIFHLKISTKSVKVLADKLYFPNGIQLTEDKKSVIFAECSMARIKKLTI--ASKKVEMFAANLPGLPDNIRSSGRGTYWVGLTATRSATHPSLLDRLGSLPGIRQFLVDIVPGPYWKPLLGLFKNPHSIIIELDSVGKIVRSLHDVTGKHVGD--ASQVTEHNGHLYIGSFADHYI 386          
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Celegans
Match: F57C2.5 (pep chromosome:WBcel235:II:14526213:14528207:-1 gene:WBGene00010197.1 transcript:F57C2.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F57C2.5)

HSP 1 Score: 100.908 bits (250), Expect = 1.748e-23
Identity = 85/317 (26.81%), Postives = 154/317 (48.58%), Query Frame = 2
Query:  299 AIYTGAADGK-LYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKYV--DKDKLIVADAYHGIYAIHLG--RDMATKQVLVSPDKDMLTRSLK--FFNSLDVSKNGIIYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLKSQDNVEVFVDGLLGTVDNVKRDNQDNFYVALPTEDSY----LLSFIHRYPLINYYVAWLIP----KRVFNIFLKSKSRILKINNEGEIVL---EISGNKVGMDFITEAYETNGKILLGNLFNPYL 1195
            AIY    D K L I+D   +S    S+    +   +C   +    CGR LG++ +   K K +V DAY G+Y +     ++  + Q+L   D  +    LK  F N LDV     +  + SS +      + A LE  + GR++   + T+ + ++A  L FPNG+ LT+++ S++ AE +  R+ K+ +  +   VE+F   L G  DN++   +  ++V L    S     LL  +   P I  ++  ++P    K +  +F    S I+++++ G+IV    +++G  VG    ++  E NG + +G+  + Y+
Sbjct:    7 AIYVSVNDAKVLKIVDGRVVSKA--SYSEKSKFFPDCGHFDTEPECGRPLGIRRLVAGKPKFVVCDAYLGVYIVDFTDEQNPISTQIL---DSKVPIDGLKPRFLNDLDVISEDELIISDSSTRHDRRHFMAAILEHQADGRIFHLKISTKSVKVLADKLYFPNGIQLTEDKKSVIFAECSMARIKKLTI--ASKKVEMFAANLPGLPDNIRSSGRGTYWVGLTATRSATHPSLLDRLGSLPGIRQFLVDIVPGPYWKPLLGLFKNPHSIIIELDSVGKIVRSLHDVTGKHVGD--ASQVTEHNGHLYIGSFADHYI 314          
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Celegans
Match: T12G3.4 (pep chromosome:WBcel235:IV:12048268:12049943:1 gene:WBGene00011739.1 transcript:T12G3.4.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T12G3.4)

HSP 1 Score: 97.4413 bits (241), Expect = 1.101e-21
Identity = 81/349 (23.21%), Postives = 165/349 (47.28%), Query Frame = 2
Query:  212 KRISWDNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCE-SNEFGKACGRILGLKYVDKDKLIVADAYHGIYAIHLGRDMATKQVLVS--PDKDMLTRSLKFFNSLDVSKNGIIYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQT-------SLVVAELTKGRLLKINLLK-----SQDNVEVFVDGLLGTVDNVKRDNQDNFYVALPTEDSYLLSFIHRYPLINYYVAWLIPKR----VFNIFLKSKSRILKINNEGEIVLEISGNKVG-MDFITEAYETN-GKILLGNLFNPYL 1195
            KR++  ++  L V    GPES   D     +Y G   G +  +D+ +    +   V++ + N +C+ S +    CGR LGL+  D  +L++ADAY G++AI+   +   K +     P  +     +K+ N LD+  +G + FT SS K+   D +    E   +GR+  YD   + L ++   L FPNG+ L+  +         ++ +E+   R+++I + +     +       ++ L G  DN++     +  + + +  S    F+ + P +  ++  ++  +    V N     +  ++K+N E   ++E   ++ G ++ ++ A +   G++LLG+  N Y+
Sbjct:   96 KRLT--DAELLLVDQVYGPESLVLDEKNSKLYAGFKTGIIAEIDMKEGREKIVHAVQLAQGNHDCDGSYKKMNLCGRPLGLRLSDVGELVIADAYLGLFAINWQEEKVVKILGAGELPANNENAAPIKYLNDLDILPDGRVIFTESSTKFDDRDFILDLFEHRPNGRLLIYDPRKKDLRVLKDGLYFPNGVQLSIEKGMGKNAPWRVLYSEMGLARVMQIWVPRDHYSTAPVKTSPLIENLPGYPDNIRLTKSGHLLIPIASHRSEEDRFLEQNPSVREFITKILSPQALGYVANYVADVEGLVIKVNTETGQIIESYHDQTGRVEAVSIAIDDGKGRMLLGSDVNYYI 442          
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Celegans
Match: T12G3.4 (pep chromosome:WBcel235:IV:12048256:12049928:1 gene:WBGene00011739.1 transcript:T12G3.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T12G3.4)

HSP 1 Score: 97.4413 bits (241), Expect = 1.101e-21
Identity = 81/349 (23.21%), Postives = 165/349 (47.28%), Query Frame = 2
Query:  212 KRISWDNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCE-SNEFGKACGRILGLKYVDKDKLIVADAYHGIYAIHLGRDMATKQVLVS--PDKDMLTRSLKFFNSLDVSKNGIIYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQT-------SLVVAELTKGRLLKINLLK-----SQDNVEVFVDGLLGTVDNVKRDNQDNFYVALPTEDSYLLSFIHRYPLINYYVAWLIPKR----VFNIFLKSKSRILKINNEGEIVLEISGNKVG-MDFITEAYETN-GKILLGNLFNPYL 1195
            KR++  ++  L V    GPES   D     +Y G   G +  +D+ +    +   V++ + N +C+ S +    CGR LGL+  D  +L++ADAY G++AI+   +   K +     P  +     +K+ N LD+  +G + FT SS K+   D +    E   +GR+  YD   + L ++   L FPNG+ L+  +         ++ +E+   R+++I + +     +       ++ L G  DN++     +  + + +  S    F+ + P +  ++  ++  +    V N     +  ++K+N E   ++E   ++ G ++ ++ A +   G++LLG+  N Y+
Sbjct:   96 KRLT--DAELLLVDQVYGPESLVLDEKNSKLYAGFKTGIIAEIDMKEGREKIVHAVQLAQGNHDCDGSYKKMNLCGRPLGLRLSDVGELVIADAYLGLFAINWQEEKVVKILGAGELPANNENAAPIKYLNDLDILPDGRVIFTESSTKFDDRDFILDLFEHRPNGRLLIYDPRKKDLRVLKDGLYFPNGVQLSIEKGMGKNAPWRVLYSEMGLARVMQIWVPRDHYSTAPVKTSPLIENLPGYPDNIRLTKSGHLLIPIASHRSEEDRFLEQNPSVREFITKILSPQALGYVANYVADVEGLVIKVNTETGQIIESYHDQTGRVEAVSIAIDDGKGRMLLGSDVNYYI 442          
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Fly
Match: Hmu (gene:FBgn0015737 transcript:FBtr0085164)

HSP 1 Score: 118.242 bits (295), Expect = 2.967e-28
Identity = 109/415 (26.27%), Postives = 186/415 (44.82%), Query Frame = 2
Query:   68 FYRILFMLIKFVIVVSLGILIYWAAPKIE---TDPKLVIKKNTQLKFSSTFKRISWDNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKY-VDKDKLIVADAYHGIYAIHLGRDMATKQVLVSPDKDM----LTRSLKFFNSLDVSKNGIIYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLKSQ-DNVEVFVDGLLGTVDNVKRDNQDNFYVALPTEDSYL---LSFIHRYPLINYYVAWL-----IPKRVFN----------------------IFLKSKSRILKINNEGEIVLEISGNKVGMDFITEAYETNGKILLGNLFNPYL 1195
             Y +   ++ F+I   L IL+    P+      D  +   K+ +    S F     + + RL  G   GPE          IYTG   G++  L  N ++        + +    CE       CGR LGL +    + LI+ADAY+G++ + LG +   K +LVSP +++    + R  K FN + VSK G +Y+T SS  +T++D ++A    + SGR++ Y+       ++   L+F NGL+L+ N+  +VVAE    RL K +L  ++    EVFVDGL G  DN+  D +  +   + + DS      +   R+P +  ++A +     +P R  N                      +    ++ +++++  G IV  + G       ++   E    + LG+  N YL
Sbjct:    4 LYALRVRIMNFMIFFLLIILMPGLPPRTTFPFKDYIVTPPKDLKGALESNFH---LEGAERLLEGRVYGPECLIAR--NNEIYTGIHGGEVIKLTSNHVT-------HVTKIGQPCEDIYEESRCGRPLGLAFDTQGNNLIIADAYYGLWQVDLGTN--KKTLLVSPAQELAGKSINRPAKIFNGVTVSKEGDVYWTDSSSDFTIEDLVFASF-ANPSGRLFKYNRSKNVSEVLLDELAFANGLALSPNEDFIVVAETGAMRLTKYHLKGAKAGQSEVFVDGLPGLPDNLTPDAEGIWVPLVQSADSEHPNGFTLFTRFPSVRLFLARMLALFELPFRYLNSVYPNKFSQRFVHFVGHMESITVLAPKRTTVVRVDWNGNIVGSLHGFDKSAATVSHVLEFQDFLFLGSPTNQYL 403          
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Fly
Match: Ssl2 (gene:FBgn0041780 transcript:FBtr0345060)

HSP 1 Score: 101.293 bits (251), Expect = 5.893e-23
Identity = 99/358 (27.65%), Postives = 170/358 (47.49%), Query Frame = 2
Query:  227 DNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKY-VDKDKLIVADAYHGIYAIHLGRDMATKQVLVSPDKDMLT-----RSLKFFNSLDVSKNGIIYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLKSQ-DNVEVFVDGLLGTVDNVKRDNQD---NFYVALPTEDSYLLSFIHRYPLINYYVAWLI-----PKRVFNIFLKS--------------------KSRILKINNEGEIVLEISGNKVGMDFITEAYETNGKILLGNLFNPYL 1195
            + + +L+     GPE      +   IYTG   G+  ++ +N+   +++   +I +    C+     + CG  +GL      + LIV+DAY+GI+ + L  +   K VLV P + +L      R  K FNSL +S+ G I++T S   ++ D    AF   + SGR++ YD V +   ++   LSF NGL+L+ ++  +++AE T  RL +  L  S+    EVFV+GL G  DN+  D +       VA  +++  L + +  YP +  ++A L+     P RV N    +                    +S +++++  G IV  + G       I+   E  G + LG+ FN Y+
Sbjct:   57 NGARKLWKDQIFGPECLIV--LEDKIYTGIHSGE--VIRLNN-EESVQPITKIGQP---CDYIFDDELCGYPVGLALDTQGNNLIVSDAYYGIWQVDL--ETKKKTVLV-PAEQILPGKGANRRAKLFNSLVISRQGDIFWTDS---FSEDFVFAAF--ANPSGRLFRYDRVKKTNEVLLDELSFANGLALSPSEDFIILAETTAMRLRRYYLKGSRAGESEVFVEGLPGCPDNLTADEEGIWVPLSVASDSQNPNLFAVLAPYPRLRSFLARLVALMRLPLRVLNHIYPNDIAARLFHSFNDLVIRNAPKRSTVVRVDWNGNIVRSLHGFDRSASGISHVLEVKGHLYLGSPFNHYV 398          
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Zebrafish
Match: apmap (adipocyte plasma membrane associated protein [Source:NCBI gene;Acc:266637])

HSP 1 Score: 151.754 bits (382), Expect = 7.881e-41
Identity = 106/347 (30.55%), Postives = 179/347 (51.59%), Query Frame = 2
Query:  230 NSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKYVDKDKLIVADAYHGIYAIHLGRDMATKQV--LVSPDKDMLTRSLKFFNSLDVSKNGI-IYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLK-SQDNVEVFVDGLLGTVDNVKRDNQDNFYVAL----PTEDSYLLSFIHRYPLINYYVAWLIPKRVFNIFLKSKSRILKINNEGEIVLEISGNKVGMD-----------FITEAYETNGKILLGNLFNPYLDVLYLN 1213
             + RLF     GPES  +  +    YTG ADGK+  ++  +I       V        C S E    CGR LG++      L VADAY G++ +    +  T +V  LVS +K +  R L F N LDV+++G  +YFT SS +W   D ++  +E  + GRV  YD  T++++++  NL FPNG+ L  ++ S++VAE T  R+ ++++   ++  ++ F++ L G  DN++R +   ++VA+    P     +L F+ + P       WL  K +F +F  S+  +LK      +V+E+ G+   +            + +EA+E +G + LG+  +PYL  L L+
Sbjct:   89 QAERLFEERLVGPESLAN--IGDVFYTGTADGKIVKIEGRNIH------VLATIGKPPCGSREHEHTCGRPLGIRVGPNGTLFVADAYLGLFEV----NPVTGEVKSLVSTEKRIAGRRLGFVNDLDVTQDGKKVYFTDSSSRWQRRDFMHLIMEATADGRVLEYDTETKEVNVMMENLRFPNGIQLFPDEESVLVAETTMARIKRVHVSGLNKGGMDTFIENLPGFPDNIRRSSSGGYWVAMSAVRPNPGFSMLDFLSQRP-------WL-KKLIFKLF--SQDTLLKFVPRYSLVVELQGDGTCVRSFHDPQGLVSAYSSEAHEYSGHLYLGSFRSPYLCKLDLS 413          
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Zebrafish
Match: zgc:194209 (zgc:194209 [Source:ZFIN;Acc:ZDB-GENE-081022-75])

HSP 1 Score: 138.658 bits (348), Expect = 6.257e-36
Identity = 94/333 (28.23%), Postives = 173/333 (51.95%), Query Frame = 2
Query:  239 RLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCE-SNEFGKACGRILGLKYVDKDKLIVADAYHGIYAIHLGRDMAT-KQVLVSPDKDMLTR-SLKFFNSLDVSKNGIIYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLKSQDNV-EVFVDGLLGTVDNVKRDNQDNFYVALPTED------SYLLSFIHRYPLINYYVAWLIPKRVFNIFLKSKSRILKINNEGEIVLEISGNKVGMDF-ITEAYETNGKILLGNLFNPYLDVL 1204
            +LF G   GPESFT D   G +YTG  DGKL+ ++    + +LK   ++ +N   C  S ++   CGR  GL+     +LIVAD+Y+G++ +    D +T ++ L+   KD        F N L++SKNG ++FT SS KW      Y  LE +  GR+ ++D  + ++  +  +L  PNG + + ++  L++AE + GR++K  L   +  + EV ++ ++G  DN++  ++  F V + T           L  I  YP +   +  L+P   +++ L     +L++++ G+++  +      + + +++ ++      LGN   P+L VL
Sbjct:  105 KLFSGQLKGPESFTAD-QNGNVYTGTVDGKLWRIN----NESLKFITQMGQNIPQCGFSTDYEPVCGRPHGLRLDRDGQLIVADSYYGLFKV----DPSTGEKTLLHSSKDGADGIPFGFLNGLEISKNGTVFFTDSSSKWGRRHVRYEVLETNRLGRLLTFDPTSGRVRTLLDSLYMPNGFAFSPDEDFLLLAETSIGRIIKFWLKGPKAGMKEVVLNNMIGYPDNIRLSDRGTFLVGISTVRFAGRLFPPFLDLIGPYPALKRAIVKLVPLSWYDLLLPKYGVVLELDSAGQVIDSLHDPTGHLTWAVSDVFQHGTVYYLGNTDLPFLPVL 428          
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Xenopus
Match: ENSXETT00000037041.1 (adipocyte plasma membrane associated protein LIKE [Source:NCBI gene;Acc:548386])

HSP 1 Score: 160.229 bits (404), Expect = 3.061e-43
Identity = 111/379 (29.29%), Postives = 186/379 (49.08%), Query Frame = 2
Query:   98 FVIVVSLGILIYWAAPKIETDPKLVIKKNTQLKFSSTFKRISWDNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNL-NCESNEFGKACGRILGLKYVDKDKLIVADAYHGIYAI--HLGRDMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGIIYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLKSQDNV-EVFVDGLLGTVDNVKRDNQDNFYVAL-----PTEDSYLLSFIHRYPLINYYVAWLIPKRVFNIFLKSKSRILKINNEGEIVLEISGNKVGMDF-ITEAYETNGKILLGNLFNPYLDVL 1204
            ++ ++++ + +Y     I+ +P    K    L  S    R       R+F G   GPESFT D   G +YTG  DGKL+++    +      F+  M  N+  C + E+   CGR  G++      LIVAD+Y G+Y +  H G     K +L+S +  +     +F N L+VSKNG IYFT SS KW      Y  LE +  GR+  YD VT+K   +   L   NG++L+  +  ++VAE +  R+++  L  ++  + EVFVD L G  DN++  +   + V +     P   +  L  I  YP++   +  + P  +++I L+     L++  +GE++         + + I++ +E    + +GN   P+L VL
Sbjct:  102 YIALLAVAVGVYLLPSPIDPEPFTFDKPPPTLVGSLAINR-KLQQGRRIFYGQLKGPESFTTD-TEGNLYTGTVDGKLWVIRGEQLF-----FITQMGQNVPECGTPEYEPICGRPHGIRMAPDGYLIVADSYFGLYRVQPHTGE----KSLLISNEAGLDQIPFRFLNGLEVSKNGTIYFTDSSSKWGRRHHRYEVLETNHLGRLLQYDPVTQKAKSLLDKLYMANGIALSPEEDFILVAETSICRIVRYWLTGTKAGMKEVFVDNLPGYPDNIRLSSVGTYRVGMSTTRFPGHFTPFLDAIAPYPVLKRLIVKVTPLSLYSILLRKHGLFLEVGEDGEVLASYHDPDGSVTWAISDVFEHKENLYIGNTDLPFLVVL 469          
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Xenopus
Match: ENSXETT00000024163.1 (adipocyte plasma membrane associated protein LIKE [Source:NCBI gene;Acc:548386])

HSP 1 Score: 155.221 bits (391), Expect = 4.356e-42
Identity = 108/378 (28.57%), Postives = 183/378 (48.41%), Query Frame = 2
Query:   98 FVIVVSLGILIYWAAPKIETDPKLVIKKNTQLKFSSTFKRISWDNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCE--SNEFGKACGRILGLKYVDKDKLIVADAYHGIYAIHLGRDMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGIIYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLKSQDNV-EVFVDGLLGTVDNVKRDNQDNFYVAL-----PTEDSYLLSFIHRYPLINYYVAWLIPKRVFNIFLKSKSRILKINNEGEIVLEISGNKVGMDF-ITEAYETNGKILLGNLFNPYLDVL 1204
            ++ ++++ + +Y     I+ +P    K    L  S    R       R+F G   GPESFT D   G +YTG  DGKL+++        L    ++ +N   C   + E+   CGR  G++      LIVAD+Y G+Y +        K +L+S +  +     +F N L+VSKNG IYFT SS KW      Y  LE +  GR+  YD VT+K   +   L   NG++L+  +  ++VAE +  R+++  L  ++  + EVFVD L G  DN++  +   + V +     P   +  L  I  YP++   +  + P  +++I L+     L++  +GE++         + + I++ +E    + +GN   P+L VL
Sbjct:   25 YIALLAVAVGVYLLPSPIDPEPFTFDKPPPTLVGSLAINR-KLQQGRRIFYGQLKGPESFTTD-TEGNLYTGTVDGKLWVIR----GEQLFFITQMGQNVPECGRCTPEYEPICGRPHGIRMAPDGYLIVADSYFGLYRVQ--PHTGEKSLLISNEAGLDQIPFRFLNGLEVSKNGTIYFTDSSSKWGRRHHRYEVLETNHLGRLLQYDPVTQKAKSLLDKLYMANGIALSPEEDFILVAETSICRIVRYWLTGTKAGMKEVFVDNLPGYPDNIRLSSVGTYRVGMSTTRFPGHFTPFLDAIAPYPVLKRLIVKVTPLSLYSILLRKHGLFLEVGEDGEVLASYHDPDGSVTWAISDVFEHKENLYIGNTDLPFLVVL 394          
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Xenopus
Match: edem2 (ER degradation enhancer, mannosidase alpha-like 2 [Source:Xenbase;Acc:XB-GENE-941890])

HSP 1 Score: 126.331 bits (316), Expect = 2.184e-31
Identity = 95/335 (28.36%), Postives = 160/335 (47.76%), Query Frame = 2
Query:  230 NSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKYVDKDKLIVADAYHGIYAIHLGRDMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGI-IYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLK-SQDNVEVFVDGLLGTVDNVKRDNQDNFYVALPT----EDSYLLSFIHRYPLINYYVAWLIPKRVFNIFLKSKSRILKINNEGEIVLEIS-GNKVGMDFITEAYETNGKILLGNLFNPYLDVLYLN 1213
             + RL+ G+  GPES  +  +   ++TG ADG+  IL I D    + +  R+      C   E    CGR LGL+      L V+DAY GI+ ++         +LVS    +  + + F N L V+ +G  IYFT SS KW   D  Y  +EG   GR+  YD VT+ + ++   L F NG+ L+  +  ++VAE T  R+ +  +   ++   ++FV+ + G  DN++  +   ++VA+          ++ F+   P I   V  L        F+   S +++I  +G         N     FI+EA+E +G + +G+  +P++  L L 
Sbjct:   91 QAKRLYEGELVGPESLAN--IGDVLFTGTADGQ--ILKIED--GKIHTIARL--GKPPCGFREHEHTCGRPLGLRVGPNGTLYVSDAYQGIFEVN--PVTGAVAMLVSSKVPVEGKIMSFVNDLTVTSDGRKIYFTDSSSKWQRRDYPYLIMEGTDDGRLLEYDTVTKVVKVLMGGLRFANGVQLSPAEDFVLVAETTMARIRRYYVSGLTKGGADMFVENMPGFPDNIRLSSSGGYWVAMSAVRLNPGFSMIDFLSDKPWIRRNVFKLFSHDTVMQFVPRYSLVVEIGEKGSYKRSFHDPNGEVATFISEAHEHDGYLYMGSFRSPFICRLNLK 415          
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Xenopus
Match: edem2 (ER degradation enhancer, mannosidase alpha-like 2 [Source:Xenbase;Acc:XB-GENE-941890])

HSP 1 Score: 126.331 bits (316), Expect = 2.344e-31
Identity = 95/334 (28.44%), Postives = 160/334 (47.90%), Query Frame = 2
Query:  230 NSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKYVDKDKLIVADAYHGIYAIHLGRDMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGI-IYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLK-SQDNVEVFVDGLLGTVDNVKRDNQDNFYVALPT----EDSYLLSFIHRYPLINYYVAWLIPKRVFNIFLKSKSRILKINNEGEIVLEIS-GNKVGMDFITEAYETNGKILLGNLFNPYLDVLYL 1210
             + RL+ G+  GPES  +  +   ++TG ADG+  IL I D    + +  R+      C   E    CGR LGL+      L V+DAY GI+ ++         +LVS    +  + + F N L V+ +G  IYFT SS KW   D  Y  +EG   GR+  YD VT+ + ++   L F NG+ L+  +  ++VAE T  R+ +  +   ++   ++FV+ + G  DN++  +   ++VA+          ++ F+   P I   V  L        F+   S +++I  +G         N     FI+EA+E +G + +G+  +P++  L L
Sbjct:  100 QAKRLYEGELVGPESLAN--IGDVLFTGTADGQ--ILKIED--GKIHTIARL--GKPPCGFREHEHTCGRPLGLRVGPNGTLYVSDAYQGIFEVN--PVTGAVAMLVSSKVPVEGKIMSFVNDLTVTSDGRKIYFTDSSSKWQRRDYPYLIMEGTDDGRLLEYDTVTKVVKVLMGGLRFANGVQLSPAEDFVLVAETTMARIRRYYVSGLTKGGADMFVENMPGFPDNIRLSSSGGYWVAMSAVRLNPGFSMIDFLSDKPWIRRNVFKLFSHDTVMQFVPRYSLVVEIGEKGSYKRSFHDPNGEVATFISEAHEHDGYLYMGSFRSPFICRLNL 423          
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Mouse
Match: Apmap (adipocyte plasma membrane associated protein [Source:MGI Symbol;Acc:MGI:1919131])

HSP 1 Score: 142.895 bits (359), Expect = 1.595e-37
Identity = 100/392 (25.51%), Postives = 193/392 (49.23%), Query Frame = 2
Query:   71 YRILFMLIKFVIVVSL-GILIYWAAPKIETDPKLVIKKNTQLKFSSTFKRISWDNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKYVDKDKLIVADAYHGIYAIHLGRDMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGI-IYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKI---NLLKSQDNVEVFVDGLLGTVDNVKRDNQDNFYVALPTEDS----YLLSFIHRYPLINYYVAWLIPKRVFNIFLKSKSRILKINNEGEI--VLEISGNKVGMDFITEAYETNGKILLGNLFNPYLDVLYLN 1213
            +R+ F+++   + + L G ++   +P    DP+    K     F           + RLF    +GPES  +  +   ++TG ADG++  L+  +I T  +        +  C++ +    CGR LG++      L V DAY G++ ++  +   + ++L+S +  +  + + F N L V+++G  IYFT SS KW   D L   +E    GR+  YD VT+++ ++   L FPNG+ L+  +  ++VAE T  R+ ++    L+K     ++FV+ + G  DN++  +   ++VA  T  +     +L F+   P I   +  +  +     F+   S +L++++ G     L     +V + +++EA+E +G + LG+  +P++  L L 
Sbjct:   38 FRMTFLMLAVSLAIPLLGAMMLLESP---IDPQSFSFKEPPFMFGVLHPNTKLRQAERLFENQLSGPESIVN--IGDVLFTGTADGRVVKLENGEIETIARF------GSGPCKTRDDEPTCGRPLGIRAGPNGTLFVVDAYKGLFEVNPQK--RSVKLLLSSETPIEGKKMSFVNDLTVTRDGRKIYFTDSSSKWQRRDYLLLVMEATDDGRLLEYDTVTKEVKVLLDQLQFPNGVQLSPEEDFVLVAETTMARIRRVYVSGLMKG--GADMFVENMPGFPDNIRPSSSGGYWVAAATIRANPGFSMLDFLSDKPFIKRMIFKMFSQETVMKFVPRYSLVLEVSDSGAFRRSLHDPDGQV-VTYVSEAHEHDGYLYLGSFRSPFICRLSLQ 413          
BLAST of Adipocyte plasma membrane-associated protein vs. UniProt/SwissProt
Match: sp|Q803F5|APMAP_DANRE (Adipocyte plasma membrane-associated protein OS=Danio rerio OX=7955 GN=apmap PE=2 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 5.264e-40
Identity = 101/338 (29.88%), Postives = 177/338 (52.37%), Query Frame = 2
Query:  230 NSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKYVDKDKLIVADAYHGIYAIHLGRDMATKQV--LVSPDKDMLTRSLKFFNSLDVSKNGI-IYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLK-SQDNVEVFVDGLLGTVDNVKRDNQDNFYVAL----PTEDSYLLSFIHRYPLINYYVAWLIPKRVFNIFLKSKSRILKINNEGEIVLEISGNKVGM--DFITEAYETNGKILLGNLFNPYLDVLYLN 1213
             + RLF     GPES  +  +    YTG ADGK+  ++  +I       V        C S E    CGR LG++      L VADAY G++ +    +  T +V  LVS +K +  R L F N LDV+++G  +YFT SS +W   D ++  +E  + GRV  YD  T++++++  NL FPNG+ L  ++ S++VAE T  R+ ++++   ++  ++ F++ L G  DN++R +   ++VA+    P     +L F+ + P +   +  L  +     F+   S ++++ ++G  V     +  G+   + +EA+E +G + LG+  +PYL  L L+
Sbjct:   89 QAERLFEERLVGPESLAN--IGDVFYTGTADGKIVKIEGRNI------HVLATIGKPPCGSREHEHTCGRPLGIRVGPNGTLFVADAYLGLFEV----NPVTGEVKSLVSTEKRIAGRRLGFVNDLDVTQDGKKVYFTDSSSRWQRRDFMHLIMEATADGRVLEYDTETKEVNVMMENLRFPNGIQLFPDEESVLVAETTMARIKRVHVSGLNKGGMDTFIENLPGFPDNIRRSSSGGYWVAMSAVRPNPGFSMLDFLSQRPWLKKLIFKLFSQDTLLKFVPRYSLVVELQSDGTCVRSFH-DPQGLVSAYSSEAHEYSGHLYLGSFRSPYLCKLDLS 413          
BLAST of Adipocyte plasma membrane-associated protein vs. UniProt/SwissProt
Match: sp|Q9HDC9|APMAP_HUMAN (Adipocyte plasma membrane-associated protein OS=Homo sapiens OX=9606 GN=APMAP PE=1 SV=2)

HSP 1 Score: 151.754 bits (382), Expect = 6.446e-40
Identity = 104/391 (26.60%), Postives = 192/391 (49.10%), Query Frame = 2
Query:   71 YRILFMLIKFVIVVSL-GILIYWAAPKIETDPKLVIKKNTQLKFSSTFKRISWDNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKYVDKDKLIVADAYHGIYAIHLGRDMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGI-IYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKI---NLLKSQDNVEVFVDGLLGTVDNVKRDNQDNFYVAL----PTEDSYLLSFIHRYPLINYYVAWLIPKRVFNIFLKSKSRILKINNEGEIVLEI-SGNKVGMDFITEAYETNGKILLGNLFNPYLDVLYLN 1213
            +R+ F+++   + V L G ++   +P    DP+ +  K   L             + RLF     GPES  H  +   ++TG ADG++  L+  +I T  +        +  C++ +    CGR LG++      L VADAY G++ ++  +     ++L+S +  +  +++ F N L V+++G  IYFT SS KW   D L   +EG   GR+  YD VTR++ ++   L FPNG+ L+  +  ++VAE T  R+ ++    L+K     ++FV+ + G  DN++  +   ++V +    P     +L F+   P I   +  L  +     F+   S +L++++ G     +   + +   +I+E +E +G + LG+  +P+L  L L 
Sbjct:   39 FRVTFLMLAVSLTVPLLGAMMLLESP---IDPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAH--IGDVMFTGTADGRVVKLENGEIETIARF------GSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREV--KLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGLMKG--GADLFVENMPGFPDNIRPSSSGGYWVGMSTIRPNPGFSMLDFLSERPWIKRMIFKLFSQETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYLGSFRSPFLCRLSLQ 414          
BLAST of Adipocyte plasma membrane-associated protein vs. UniProt/SwissProt
Match: sp|Q5ZIF1|APMAP_CHICK (Adipocyte plasma membrane-associated protein OS=Gallus gallus OX=9031 GN=APMAP PE=2 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 2.912e-39
Identity = 109/392 (27.81%), Postives = 190/392 (48.47%), Query Frame = 2
Query:   71 YRILFMLIKFVIVVSL-GILIYWAAPKIETDPKLVIKKNTQLKFSSTFKRISWDNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKYVDKDKLIVADAYHGIYAIHLGRDMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGI-IYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKI---NLLKSQDNVEVFVDGLLGTVDNVKRDNQDNFYVALPTEDS----YLLSFIHRYPLINYYVAWLIPKRVFNIFLKSKSRILKINNEGEIVLEI-SGNKVGMDFITEAYETNGKILLGNLFNPYLDVLYLNH 1216
            +R+ F+ +   + V L G  +    P    DP+ +  K   L             + RL+     GPES  +  +   ++TG ADGK  IL I D    +++  RI   +  C + E    CGR LG++    + L VADAY+G+Y ++ G      ++LVS    +  + L F N L V+++G  IYFT SS KW   D L+  +EG   GR+  YD VT+++ ++   L FPNG+ L+  +  ++V E    R+ +     L+K     ++FV+ + G  DN++  +   ++VA+P         +L F+   P I   +  L+ +      L  +S +++++  G           + + +++EA+E NG + LG+  +P++  L L H
Sbjct:   38 FRVTFLTLAASLAVPLLGATVLLDCP---IDPQPISLKEPPLLTGVLEPNNKLQKAERLWENQLVGPESIVN--IGDVLFTGTADGK--ILKIED--GEVQTVARI--GHGPCGTPEDEPTCGRPLGIRVGPNNTLFVADAYYGLYEVNPG--TGETKMLVSTKTLIEGQKLSFLNDLTVTQDGRKIYFTDSSSKWQRRDFLFLVMEGTDDGRLLEYDTVTKEVKVLMVGLRFPNGVQLSPAEDFVLVLETAMARIRRYYVSGLMKG--GADMFVENMPGLPDNIRLSSSGGYWVAMPVVRPNPGFSMLDFLSEKPWIKRMIFKLLSQETVTKLLPKRSLVVELSETGSYRRSFHDPTGLTVPYVSEAHEHNGYLYLGSFRSPFICRLNLQH 414          
BLAST of Adipocyte plasma membrane-associated protein vs. UniProt/SwissProt
Match: sp|B5X3B2|APMAP_SALSA (Adipocyte plasma membrane-associated protein OS=Salmo salar OX=8030 GN=apmap PE=2 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 5.138e-39
Identity = 104/339 (30.68%), Postives = 176/339 (51.92%), Query Frame = 2
Query:  230 NSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCE-SNEFGKACGRILGLKYVDKDKLIVADAYHGIYAIHLGRDMATKQV--LVSPDKDMLTRSLKFFNSLDVSKNGI-IYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLK-SQDNVEVFVDGLLGTVDNVKRDNQDNFYVAL----PTEDSYLLSFIHRYPLINYYVAWLIPKRVFNIFLKSKSRILKINNEGEIVLEISGNKVGM--DFITEAYETNGKILLGNLFNPYLDVLYLN 1213
             + RLF     GPES  +      IYTG ADGK+  ++   I+   +           C+ S E   +CGR LG++      L VADAY G++ +    +  T +V  LVS  + +  R L F N LDV+++G  +YFT SS +W   D L+  +E  + GRV  YD  T+++ ++  NL F NG+ L  ++ S++VAE T  R+ ++++   ++  ++ FVD L G  DN++R +   ++VA+    P     +L F+ + P I   +  L  + V   F+   S ++++   G  +     +  GM   +++EA+E +G + LG+  +PYL  L L+
Sbjct:   89 EAQRLFEDQLVGPESIAN--FGDLIYTGTADGKIVKIEGKSITVIARL------GKPPCDGSREQEPSCGRPLGIRVGPNGTLFVADAYLGLFKV----NPVTGEVTNLVSAGQMVGGRRLSFVNDLDVTQDGRKVYFTDSSSRWQRRDYLHLIMEATADGRVLEYDTETKEVTVLMENLRFANGIQLFPDEESVLVAETTMARIRRVHVSGLNKGGMDTFVDNLPGFPDNIRRSSSGGYWVAMSAVRPNPGFSMLDFLSQKPWIKKLIFKLFSQDVLMKFVPRYSLVIELQESGACMRSFH-DPHGMVAAYVSEAHEHDGHLYLGSFRSPYLCKLDLS 414          
BLAST of Adipocyte plasma membrane-associated protein vs. UniProt/SwissProt
Match: sp|Q3T0E5|APMAP_BOVIN (Adipocyte plasma membrane-associated protein OS=Bos taurus OX=9913 GN=APMAP PE=2 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 4.048e-37
Identity = 103/390 (26.41%), Postives = 188/390 (48.21%), Query Frame = 2
Query:   68 FYRILFMLIKFVIVVSLGILIYWAAPKIETDPKLVIKKNTQLKFSSTFKRISWDNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKYVDKDKLIVADAYHGIYAIHLGRDMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGI-IYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKI---NLLKSQDNVEVFVDGLLGTVDNVKRDNQDNFYVALPTEDS----YLLSFIHRYPLINYYVAWLIPKRVFNIFLKSKSRILKINNEGEIVLEISGNKVG-MDFITEAYETNGKILLGNLFNPYLDVLYL 1210
            F     ML  F+ +  LG L+   +P    DP+ +  K   L             + RLF     GPES  +  +   ++TG ADG++  L+  ++ T  +        +  C++ +   ACGR LG++      L V DAY G++ ++  +     ++L+S +  +  R + F N L V+++G  IYFT SS KW   D L   +EG   GR+  YD  T+++ ++  +L FPNG+ L+  +  ++V EL   R+ +     L+K     +VFV+ L G  DN++  +   ++V++    +     +L F+   P +   +  L  +     F+   S +L++++ G  +  +   +   + +++EA+E +G + LG+   PYL  L L
Sbjct:   38 FRATFLMLAAFLTIPLLGALVLLDSP---IDPEPLSFKEPPLFLGVLQPNTKLQQAERLFENQLVGPESIAN--IGDVMFTGTADGRVVKLENGEVETIARF------GSGPCKTRDDEPACGRPLGIRAGPNGTLFVVDAYKGLFEVNPWKREV--KLLLSSETPIEGRKMSFLNDLTVTRDGRKIYFTDSSSKWQRRDYLLLLMEGTDDGRLLEYDTQTKEVKVLLDHLRFPNGVQLSPAEDFVLVVELAMVRIRRFYVSGLMKG--GADVFVENLPGFPDNIRASSSGGYWVSMAAIRANPGFSMLDFLSERPFLKKVIFKLFSQETVMKFVPRYSLVLELSDSGTFLRSLHDPEGQVVTYVSEAHEHSGHLYLGSFRAPYLCRLRL 412          
BLAST of Adipocyte plasma membrane-associated protein vs. TrEMBL
Match: A0A099ZUY0 (Adipocyte plasma membrane-associated protein (Fragment) OS=Tinamus guttatus OX=94827 GN=N309_00305 PE=4 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 1.096e-44
Identity = 118/392 (30.10%), Postives = 196/392 (50.00%), Query Frame = 2
Query:   71 YRILFMLIKFVIVVSL-GILIYWAAPKIETDPKLVIKKNTQLKFSSTFKRISWDNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKYVDKDKLIVADAYHGIYAIHLGRDMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGI-IYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKI---NLLKSQDNVEVFVDGLLGTVDNVKRDNQDNFYVAL----PTEDSYLLSFIHRYPLINYYVAWLIPKRVFNIFLKSKSRILKINNEGEIVLEI-SGNKVGMDFITEAYETNGKILLGNLFNPYLDVLYLNH 1216
            +R+ F+ +   +++ L G ++    P    DP+ +  K   L        I    + RL+ G   GPES  +  +   +YTG ADGK  IL I D    L++  RI   +  C   E    CGR LG++    + L VADAYHG+Y I+   D    ++LVS    +  + L F N L V+++G  IYFT SS KW   D ++  +EG   GR+  YD VT+++ ++   L FPNG+ L+Q +  ++V E T  R+ +     L+K     ++FV+ + G  DN++  +   ++VA+    P     +L F+   P I   +  L+ +     F+   S +++++  G         N V + +I+EA+E NG + LG+  +P++  L L H
Sbjct:    8 FRVTFLTLAVSLIIPLLGAIVLLDCP---IDPQPISLKEPPLLTGVLEPNIKLRKAERLWEGQLVGPESIVN--IDDVLYTGTADGK--ILKIED--GELQTIARI--GHGPCGRPEDEPTCGRPLGIRVGPNNTLFVADAYHGLYEIN--PDTGETKMLVSTKTLIEGQKLSFLNDLTVTQDGRKIYFTDSSSKWQRRDYMFLVMEGTDDGRLLEYDTVTKEVKVLMTGLQFPNGVQLSQAEDFVLVQETTMARIRRYYVSGLMKG--GADIFVENMPGFPDNIRLSSSGGYWVAMSTIRPNPGFSMLDFLSEKPWIKRIIFKLLSQETLMKFVPRYSLVVELSETGSYRRSFHDPNGVTVPYISEAHEHNGYLYLGSFRSPFIGRLNLQH 384          
BLAST of Adipocyte plasma membrane-associated protein vs. TrEMBL
Match: T2M5K2 (Adipocyte plasma membrane-associated protein (Fragment) OS=Hydra vulgaris OX=6087 GN=APMAP PE=2 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 4.484e-44
Identity = 123/384 (32.03%), Postives = 192/384 (50.00%), Query Frame = 2
Query:   74 RILFMLIKFVIVVSLGILIYWAAPKIETDPKLVIKKNTQLKFSSTFKRISW-DNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLY-ILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKYVDKDK-LIVADAYHGIYAIHLGRDMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGIIYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLKSQDNV-EVFVDGLLGTVDNVKRDNQDNFYVALPTEDSYLLSF---IHRYPLINYYVAWLIPKRVFNIFLKSKSRILKINNEGEIV---LEISGNKVGMDFITEAYETNGKILLGNLFNPYL 1195
            +I   +I  V+ +SL  ++    P    DP  VI   +   F    +  +  +   ++  G   GPES   D   G +YTG  DG++  IL     S  +K   R  EN+ NC  +     CGR LG++   K++ L + D Y G+ +++L  +  T   LV   K +     KF N L V+ NG IYFT SS +W      Y  LEG   GRV SYD  T +  L+ + L FPNG++L+ ++  L++ E    R+L++ +  SQ  + +VF D L G  DN++   +  ++VALP    +  SF   +  YP I   +A L+PK   + FLK     +KI+  G+I+    + SG  +G  FI+E +E  G + LG+  N ++
Sbjct:   47 KISMQVIGAVLSLSLLFVVIVPCP---IDPVPVITPGSLPYFEGVMEENNLLEGIVKIGEGKLQGPESIQVD-RNGDVYTGLHDGRIVKILK----SGEIKELARTGENHKNCGEDTMEHICGRPLGIQLDKKEENLFICDGYFGLMSLNLASERLT--TLVPASKGIKNVPFKFLNHLTVASNGKIYFTDSSWRWDRKSYAYMLLEGGGKGRVLSYDTKTGETELLLSGLFFPNGITLSPDEDFLLICETASSRILRLFISGSQKGIYDVFQDNLPGFPDNIRTSLEGGYWVALPGIRKWPFSFLDIVGPYPKIKSLIAKLVPKVHIDGFLKPYGLFIKIDEYGDIIKSYHDPSGATIG--FISEVFEDKGVLYLGSFKNNFM 418          
BLAST of Adipocyte plasma membrane-associated protein vs. TrEMBL
Match: V3ZMC1 (Str_synth domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_197037 PE=4 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 8.356e-44
Identity = 122/401 (30.42%), Postives = 204/401 (50.87%), Query Frame = 2
Query:   26 KFNLISD*NT*HLEFYRILFMLIKFVIVVSLGILIYWAAPKIETDPKLVIKKNTQLKFSSTFKRISWDNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKYVDKDKLIVADAYHGIYAIHLGRDMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGIIYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLKSQ-DNVEVFVDGLLGTVDNVKRDNQDNFYVALPT----EDSYLLSF---IHRYPLINYYVAWLIPKRVFNIFLKSKSRILKINNEGEIVL---EISGNKVGMDFITEAYETNGKILLGNLFNPYL 1195
            KFNLIS      + +     +LI  VIV       Y+    I+  P L      QLK      + + +   +LF     GPESFT D   G +YTG+ADGK++          L+   R   NN +C S E    CGR  G+K      L++ DAY G+  ++L       +VLV PD D L   L+F N L ++ +G+I+FT SS KW   +  Y  +E +S GR+ S++  T ++ ++   L   NGL L+Q+++ L++ E+T  R++K +L  S+    EVF++ L G  DN++ ++  N++V + +      S L  F   I  YP    ++A + P+ +F++FL   + +++I+ +G+I     + +G+ V    + E Y+    I +G+   P++
Sbjct:   12 KFNLIS------VPYLSCCVLLIAVVIV-------YFIPSPIDPKPFLYKHPLPQLKGPLAVNQ-ALERVDKLFENQVIGPESFTAD-QNGFVYTGSADGKIWRFK----DGQLEMLARTGINNSHCGSFELEPECGRPKGMKIDKNGDLVLVDAYKGLLKVNL--QNKNIEVLVRPDTDQLREPLRFLNGLAITSDGMIFFTDSSTKWDRRNYRYEVIETNSYGRLLSFNPTTDQVKVVLEGLYLANGLVLSQDESYLLIVEMTVSRIIKYHLTGSRAGEREVFIENLPGYPDNIQLNSAGNYFVGMGSVKFEGSSRLGPFLDNIGPYPWFKRFLAKVTPRPLFDVFLPRHAMLVEISPKGKIAASYHDPTGSVV--RGVGEGYQHGVYIYIGHFSMPFV 389          
BLAST of Adipocyte plasma membrane-associated protein vs. TrEMBL
Match: A0A2J6KMM5 (Str_synth domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_5X158440 PE=4 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 3.074e-43
Identity = 116/330 (35.15%), Postives = 184/330 (55.76%), Query Frame = 2
Query:  251 GDFAGPESFTHDPVTG-AIYTGAADGKLYILDINDISTTLK--SFVRIMENNLNCESNEFGKACGRILGLKYVD-KDKLIVADAYHGIYAIHLGRDMATKQVLVSPDKDMLTRSLKFFNSLDVSK-NGIIYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLKSQ-DNVEVFVDGLLGTVDNVKRDNQDNFYVALPTEDSYLLSFIHRYPLINYYVAWLIPKRVFNIFLKSKSRILKINNEG------------EIVLEISGNKVGMDFITEAYETNGKILLGNLFN 1186
            G   GPESF  +PV G   YTG +DG++    I  I+T  +   F     N   C   E    CGR LGLK+ + + KL++ADAY G+ ++     +AT   LVS D+ +    L F NSLD+ + NG++YFT SS ++T  D +   L  + SGR+  YD+ +RK+ +I  NL+FPNG++L+Q+   L+VAE T  R+++  L  S+   +EVF + L G  DN+KR+ +  F+VA+ +++S +L ++H  P I Y ++ +IP      F++  S I K   EG            EI+ ++ G K    + +E  E +G + +G++ N
Sbjct:   44 GGAIGPESFDFNPVDGTGPYTGVSDGRI----IKWIATEGRWTDFAITSPNRKGCGGPEMEHICGRPLGLKFDNSRGKLLIADAYFGLLSLGPNGGLATS--LVSKDQGL---PLMFTNSLDIDQTNGVVYFTDSSQRYTRRDHMLVVLTDEKSGRLLKYDIESRKVTVILDNLTFPNGVTLSQDGNFLLVAETTICRIMRFWLKTSKAGTLEVFAN-LPGYPDNIKRNQKGEFWVAIYSKESKILRWVHSKPWIVYVLSKIIPIN----FVRVSSHIAKGKGEGLAIKLGVNGEILEILEDVHGKK--WKYASEVMERDGNLWIGSVEN 357          
BLAST of Adipocyte plasma membrane-associated protein vs. TrEMBL
Match: A0A1L8GUK7 (Str_synth domain-containing protein OS=Xenopus laevis OX=8355 GN=XELAEV_18021193mg PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 4.106e-43
Identity = 113/376 (30.05%), Postives = 188/376 (50.00%), Query Frame = 2
Query:  101 VIVVSLGILIYWAAPKIETDPKLVIKKNTQLKFSSTFKRISWDNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLN-CESNEFGKACGRILGLKYVDKDKLIVADAYHGIYAIHLGRDMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGIIYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLKSQDNV-EVFVDGLLGTVDNVKRDNQDNFYVAL-----PTEDSYLLSFIHRYPLINYYVAWLIPKRVFNIFLKSKSRILKINNEGEIVLEISGNKVGMDF-ITEAYETNGKILLGNLFNPYLDVL 1204
            + ++++ + +Y     I+ +P    K    L  S    R       R+F G   GPESFT D   G IYTG  DGKL+++    +      F+  M  N++ C + E+   CGR  G++      LIVAD+Y G+Y +H       K +L+S +  +     +F N L+VSKNG IYFT SS KW      Y  LE +  GR+  YD VT+K   +  NL   NG++L+  +  ++VAE +  R+++  L  ++  + EVFVD L G  DN++  +   + V L     P   +  L  I  YP++   +  +IP  +++I L+     L++ ++G+I+         + + I++ +E    + +GN   P+L +L
Sbjct:   16 IALLAVAVGVYLLPSPIDPEPFTFEKPPPPLVGSLAVNR-KLQQGRRIFYGQLKGPESFTTD-NEGDIYTGTVDGKLWVIRGEQLF-----FITQMGQNVSECGTPEYEPICGRPHGIRMAPDGYLIVADSYFGLYRVH--PQTGEKSLLISNEDGLDKIPFRFLNGLEVSKNGTIYFTDSSSKWGRRHHRYEVLETNHLGRLIQYDPVTQKARSLLDNLYMANGIALSPEEDFILVAETSICRIVRYWLTGTKAGMKEVFVDNLPGYPDNIRISSMGTYRVGLSTTRFPGRFTPFLDAIAPYPVLKRLIVKVIPLSLYSILLRKHGLFLEVGDDGKILASFHDPDGTVTWAISDVFEHGENLYIGNTELPFLVIL 382          
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Cavefish
Match: apmap (adipocyte plasma membrane associated protein [Source:NCBI gene;Acc:103045944])

HSP 1 Score: 155.992 bits (393), Expect = 2.184e-42
Identity = 107/336 (31.85%), Postives = 175/336 (52.08%), Query Frame = 2
Query:  230 NSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKYVDKDKLIVADAYHGIYAIHLGRDMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGI-IYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLK-SQDNVEVFVDGLLGTVDNVKRDNQDNFYVAL----PTEDSYLLSFIHRYPLINYYVAWLIPKRVFNIFLKSKSRILKINNEGEIVLEISGNKVGM--DFITEAYETNGKILLGNLFNPYLDVLYLN 1213
             + RL      GPES  +  +   +YTG +DGK+  +D   I T L +          C S E    CGR LG+K      L VADAY G++ ++     +T  +LVS  K +  R L F N LDV+++G  +YFT SS +W   D L   +E  + GRV  YD  T+++ ++  NL FPNG+ L  ++ S++VAE T  R+ ++++   ++  ++ F+D L G  DN++R +   ++VA+    P     +L F+ + P I   +  L  + +   F+   S ++++ + G  V     +  GM    I+EA+E NG + LG+  +PYL  L L+
Sbjct:   89 QAERLLEDQLVGPESIAN--IGDVLYTGTSDGKIVKIDGRKI-TVLATL-----GQPPCGSREQEHVCGRPLGIKVGPNGTLFVADAYLGLFEVNPVTGEST--LLVSTRKMVGGRRLSFVNDLDVTQDGKKLYFTDSSSRWQRRDYLNLIMEATADGRVLEYDFETKEVTVMMENLRFPNGIQLFPDEESVLVAETTMARIRRVHVAGLNKGGMDTFIDNLPGFPDNIRRSSSGGYWVAMSAVRPNPGFSMLDFLSQRPWIKKLIFKLFSQDMLMKFVPRYSLVVELQDGGTCVRSFH-DPHGMVAAHISEAHEHNGHLYLGSFRSPYLCKLDLS 413          
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Cavefish
Match: zgc:194209 (adipocyte plasma membrane-associated protein-like [Source:NCBI gene;Acc:111192870])

HSP 1 Score: 115.931 bits (289), Expect = 2.808e-28
Identity = 75/240 (31.25%), Postives = 122/240 (50.83%), Query Frame = 2
Query:  239 RLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNC-ESNEFGKACGRILGLKYVDKDKLIVADAYHGIYAIHLGRDMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGIIYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLKSQDNV-EVFVDGLLGTVDNVKRDNQDNFYVALPT 952
            RLF G   GPESFT D   G +YTG  DGKL+ ++    + TL    ++ +N   C  S ++   CGR  GL+     +LIVAD+Y G++ +        K +L S  +        F N L++SKNG ++FT SS +W      Y  LE +  GR+ SYD  +  +  +  +L  PNG + + ++  L++AE + G + +  L   +    E  ++ ++G  DN++  +   F V + T
Sbjct:   54 RLFAGQLKGPESFTAD-QNGNVYTGTVDGKLWRIN----NETLTFITQMGQNLPECGTSTDYEPVCGRPHGLRLDRHGQLIVADSYFGLFKVDPW--TGQKTLLHSSKEGADGIPFGFLNGLEISKNGTVFFTDSSSRWGRRHVRYEVLETNRLGRLLSYDPESGSVRTLLDSLYMPNGFAFSADEDFLLLAETSIGHISRFWLKGHKAGTKETAMNNMVGYPDNIRISDHGTFLVGINT 286          
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Cavefish
Match: zgc:194209 (zgc:194209 [Source:ZFIN;Acc:ZDB-GENE-081022-75])

HSP 1 Score: 73.9442 bits (180), Expect = 4.234e-14
Identity = 74/294 (25.17%), Postives = 122/294 (41.50%), Query Frame = 2
Query:  239 RLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNC-ESNEFGKACGRILGLKYVDKDKLIVADAYHGIYAIHLGRDMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGIIYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLKSQDNV-EVFVDGLLGTVDNVKRDNQDNFYVALPTED------SYLLSFIHRYPLINYYVAWLIPKRVFNIFLKSKSRILKINNEGEIV 1096
            RLF G   GPESFT D   G +YTG  DGKL+ ++    + TL    ++ +N   C  S ++   CGR  GL+     +LIVAD+Y G++ +    D  T Q  +                L  SK G +         TL DSLY                              PNG + + ++  LV+AE + G + +  L   +    E  ++ ++G  DN++  +   F V + T           L  +  YP +  +V  +IP   ++  L S   +L++  + +++
Sbjct:   64 RLFAGQLKGPESFTAD-QNGNVYTGTVDGKLWRIN----NETLTFITQMGQNLPECGTSTDYEPVCGRPHGLRLDRHGQLIVADSYFGLFKV----DPWTGQKTL----------------LHSSKEGFVR--------TLLDSLY-----------------------------MPNGFAFSADEDFLVLAETSIGHISRFWLKGHKAGTKETAMNNMVGYPDNIRISDHGTFLVGINTVRFRGRLLPPFLDLLAPYPALKCFV--VIPLGWYDALLPSYGLVLELGPDRQLL 293          
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Cavefish
Match: ENSAMXT00000047164.1 (pep primary_assembly:Astyanax_mexicanus-2.0:22:30628974:30637974:1 gene:ENSAMXG00000043132.1 transcript:ENSAMXT00000047164.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.0846 bits (157), Expect = 2.724e-11
Identity = 36/96 (37.50%), Postives = 52/96 (54.17%), Query Frame = 2
Query:  227 DNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCE--SNEFGKACGRILGLKYVDKDKLIVADAYHGIYA 508
                RLF G   GPESFT D   G +YTG  DGKL+ ++ N+  T +    RI +N +  +    ++   CGR  GL+     +LIVAD+Y G++ 
Sbjct:   44 QRGRRLFAGQLKGPESFTAD-QNGNVYTGTVDGKLWRIN-NETLTFITQMARIFQNVVRNQILRTDYEPVCGRPHGLRLDRHGQLIVADSYFGLFV 137          
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Sea Lamprey
Match: apmap (adipocyte plasma membrane associated protein [Source:NCBI gene;Acc:266637])

HSP 1 Score: 100.138 bits (248), Expect = 1.699e-24
Identity = 62/218 (28.44%), Postives = 110/218 (50.46%), Query Frame = 2
Query:  581 LKFFNSLDVSKNGI-IYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLKSQDNV-EVFVDGLLGTVDNVKRDNQDNFYVAL----PTEDSYLLSFIHRYPLINYYVAWLIPKRVFNIFLKSKSRILKINNEGEIVLEISGNKVGM-DFITEAYETNGKILLGNLFNPYLDVLYLN 1213
            + F N L V+ +G  IYFT SS KW   ++ Y  +E  + GR++ Y++V   L L+   L FPNG+ LT N+ +L+VAE T  R+LK  L        E+F D L G  DN++      +++A+    P      + F+   P +   +  ++ + V   F+     +L++  +G +   +      M   ++EA+E +G + LG+   P++  + L+
Sbjct:    9 MGFINDLTVTSDGTRIYFTDSSSKWQRRNNRYLVMEATADGRLFEYNMVQDSLRLLMDGLRFPNGVQLTPNEDALLVAETTMARVLKYRLSGQLAGASEIFADNLPGFPDNIRASGTGGYWLAMAGVRPNPGFSFVDFLAPRPWLKSLIFKVLSQEVIMQFVPRHGLLLELGPDGAVWRSLHDPAGTMVPSVSEAHEHDGWLYLGSYHAPFISRIRLS 226          
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Nematostella
Match: EDO43012 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZV5])

HSP 1 Score: 133.65 bits (335), Expect = 3.772e-35
Identity = 99/343 (28.86%), Postives = 166/343 (48.40%), Query Frame = 2
Query:  170 VIKKNTQLKFSSTFKRISWDNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKYVD-KDKLIVADAYHGIYAIHLGRDMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGIIYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLK-INLLKSQDNVEVFVDGLLGTVDNVKRDNQDNFYV--ALPTEDSY-LLSFIHRYPLINYYVAWLIPKRVFNIFLKSKSRILKINNEGEI--VLEISGNKVGMDFITEAYETNGKILLGN 1177
            V+  NT+L+            S +LF G   GPES   D  +G IYTG ADG++    +  +   +   VR   +N  C   E    CGR LG+++     KLIV DAY G+  +       +  V   P  D     ++F N LD++++G IYFT SS KW       A LEGD++GR+ ++   T +L ++ ++L F NG+ L+     ++V EL   R+L+     +++  +EVF + L G  DN++      ++V  A P      LL  +   P +   +A  +   + ++       I+K++  G +   L     +V ++ ++E +E NG + LG+
Sbjct:   32 VLAPNTKLQ-----------ESEQLFKGQVVGPESIAVD-SSGIIYTGLADGRI----VKFVGDKVVDVVRTGTHNDGCGRPELEHVCGRPLGMRFNRYGTKLIVVDAYFGLLEVDTKSSSISTLVPCQPGVD--GEPIRFMNDLDIAQDGTIYFTDSSTKWQRMHFSNALLEGDNTGRLLAFHPKTGELEVLMSDLHFANGVQLSPEGDFVLVVELLTARILRYYTRGENEGKMEVFAENLPGHPDNIRPSFGGGYWVGMAAPRRPGLSLLDTLSTRPWLRSLLAKFVTPEMLHVLAPRYGLIVKLSKGGSVQRTLHDPTGQV-INGVSEVHEENGVLYLGS 355          
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Medaka
Match: zgc:194209 (adipocyte plasma membrane-associated protein-like [Source:NCBI gene;Acc:101166676])

HSP 1 Score: 144.05 bits (362), Expect = 8.221e-38
Identity = 104/334 (31.14%), Postives = 174/334 (52.10%), Query Frame = 2
Query:  239 RLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNL-NCE-SNEFGKACGRILGLKYVDKDKLIVADAYHGIYAIHLGRDMATKQVLVSPDKDMLTR-SLKFFNSLDVS-KNGIIYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLKSQD--NVEVFVDGLLGTVDNVKRDNQDNFYVALPTE-----DSYLLSFIHRYPLINYYVAWLIPKRVFNIFLKSKSRILKINNEGEIVLEISGNKVGMDF-ITEAYETNGKILLGNLFNPYLDVL 1204
            RLF G   GPESFT D   G +YTG  DGKL+ +  +D  T    F+  M  NL  C  S ++   CGR  GL+    ++LIVAD+Y G++A+        ++ L+ P+ +        F N L++S + G IYFT SS +W         +E +S GR+ SYD  +  + ++  +L  PNG++L+ ++  L++AE + GR+ +   LK Q     EV +D ++G  DN++  +   F V + T          L  I  YP +  ++A ++P   +NI L   + +L++  +G IV  +   +  + + I++ ++  G+  LG+   P+L VL
Sbjct:  111 RLFTGKLHGPESFTAD-EDGNVYTGTVDGKLWRISPDDNLT----FITQMGQNLPECGFSTDYEPVCGRPHGLRMDRHNRLIVADSYLGLFAVD---PQTGEKTLLRPNAEGADGVPFAFLNGLEISAQTGTIYFTDSSSRWGRRHVKLEVIELNSLGRLLSYDPRSGAVSVLLDSLYMPNGIALSPDEDFLLLAETSIGRIHRF-WLKGQKAGTGEVVLDNMIGYPDNIRLSDHGTFLVGITTPRFRRLTPPFLDAIAPYPAVKRFLAKVVPLSWYNILLPRYALVLELGLDGRIVGSLHDPEGRLTWAISDVFQHRGRTYLGSTDLPFLAVL 435          
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Medaka
Match: apmap (adipocyte plasma membrane associated protein [Source:NCBI gene;Acc:101173572])

HSP 1 Score: 138.272 bits (347), Expect = 5.999e-36
Identity = 97/335 (28.96%), Postives = 170/335 (50.75%), Query Frame = 2
Query:  230 NSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKYVDKDKLIVADAYHGIYAIHLGRDMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGI-IYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLK-SQDNVEVFVDGLLGTVDNVKRDNQDNFYVALPTEDS----YLLSFIHRYPLINYYVAWLIPKRVFNIFLKSKSRILKINNEGEIVLEI-SGNKVGMDFITEAYETNGKILLGNLFNPYLDVLYLN 1213
             S RLF     GPES T+  +   +YTG ADG++  L    I   + +  R+      C S E    CGR LG++      L VADAY G++ ++      T+  LV+  + +  R L F N + V+++G  +YFT SS +W   + +   +E  + GRV  +D  T++L +I  NL FPNG+ L  ++ S++VAE T  R+ ++++   ++  ++ FV+ L G  DN++  +   ++VA+    +     LL F+ + P I   +  L    V   F+   S + ++++ G         N + + +++E +E  G + LG+  +PY+  L L 
Sbjct:   89 ESQRLFEDQILGPESITN--IGDVLYTGTADGQILKL----IGRRILTVTRL--GKPPCGSKEDEPVCGRPLGIRVGPNGTLFVADAYLGLFEVNPSTGEKTR--LVAGGEVVGGRKLSFINDVTVTRDGKKLYFTDSSSRWQRRNYMQLIMEATADGRVLEFDTETKELTVIMDNLRFPNGIHLLPDEESVLVAETTMARIRRVHVAGLNKGGMDTFVENLPGFPDNIRPSSSGGYWVAMSAVRANPGFSLLDFLSQRPWIKKLIFKLFSPDVLVKFVPRYSLVAELHDGGICTRSFHDPNGLVVAYVSEVHEHAGSLYLGSFRSPYIAKLDLE 413          
BLAST of Adipocyte plasma membrane-associated protein vs. Planmine SMEST
Match: SMESG000052602.1 (SMESG000052602.1)

HSP 1 Score: 755.747 bits (1950), Expect = 0.000e+0
Identity = 373/377 (98.94%), Postives = 375/377 (99.47%), Query Frame = 2
Query:   86 MLIKFVIVVSLGILIYWAAPKIETDPKLVIKKNTQLKFSSTFKRISWDNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKYVDKDKLIVADAYHGIYAIHLGRDMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGIIYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLKSQDNVEVFVDGLLGTVDNVKRDNQDNFYVALPTEDSYLLSFIHRYPLINYYVAWLIPKRVFNIFLKSKSRILKINNEGEIVLEISGNKVGMDFITEAYETNGKILLGNLFNPYLDVLYLNH 1216
            MLIKFVIVVSLGILIYWAAPKIETDPKLVIKKNTQLKFSSTFKRISWDNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKYVDKDKLIVADAY+GIYAIHLG DMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGIIYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLKSQDNVEVFVDGLLGTVDNVKRDNQDNFYVALPTEDSYLLSFIHRYPLINYYVAWLIPKR FNIFLKSKSRILKINNEGEI+LEISGNKVGMDFITEAYETNGKILLGNLFNPYLDVLYLNH
Sbjct:    1 MLIKFVIVVSLGILIYWAAPKIETDPKLVIKKNTQLKFSSTFKRISWDNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKYVDKDKLIVADAYNGIYAIHLGMDMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGIIYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLKSQDNVEVFVDGLLGTVDNVKRDNQDNFYVALPTEDSYLLSFIHRYPLINYYVAWLIPKRFFNIFLKSKSRILKINNEGEIILEISGNKVGMDFITEAYETNGKILLGNLFNPYLDVLYLNH 377          
BLAST of Adipocyte plasma membrane-associated protein vs. Planmine SMEST
Match: SMESG000052602.1 (SMESG000052602.1)

HSP 1 Score: 714.531 bits (1843), Expect = 0.000e+0
Identity = 357/377 (94.69%), Postives = 359/377 (95.23%), Query Frame = 2
Query:   86 MLIKFVIVVSLGILIYWAAPKIETDPKLVIKKNTQLKFSSTFKRISWDNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKYVDKDKLIVADAYHGIYAIHLGRDMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGIIYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLKSQDNVEVFVDGLLGTVDNVKRDNQDNFYVALPTEDSYLLSFIHRYPLINYYVAWLIPKRVFNIFLKSKSRILKINNEGEIVLEISGNKVGMDFITEAYETNGKILLGNLFNPYLDVLYLNH 1216
            MLIKFVIVVSLGILIYWAAPKIETDPKLVIKKNTQLKFSSTFKRISWDNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKYVDKDKLIVADAY+GIYAIHLG DMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGIIYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLKSQDNVEVFVDGLLGTVDNVKRDNQDNFYVALPTEDSYLLSFIHRYPLINYYVAWLIPKR FNIFLK                +ISGNKVGMDFITEAYETNGKILLGNLFNPYLDVLYLNH
Sbjct:    1 MLIKFVIVVSLGILIYWAAPKIETDPKLVIKKNTQLKFSSTFKRISWDNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKYVDKDKLIVADAYNGIYAIHLGMDMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGIIYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLKSQDNVEVFVDGLLGTVDNVKRDNQDNFYVALPTEDSYLLSFIHRYPLINYYVAWLIPKRFFNIFLK----------------KISGNKVGMDFITEAYETNGKILLGNLFNPYLDVLYLNH 361          
BLAST of Adipocyte plasma membrane-associated protein vs. Planmine SMEST
Match: SMESG000052600.1 (SMESG000052600.1)

HSP 1 Score: 316.62 bits (810), Expect = 1.017e-104
Identity = 162/373 (43.43%), Postives = 248/373 (66.49%), Query Frame = 2
Query:   89 LIKFVIVVSLGILIYWAAPKIETDPKLVIKKNTQLKFSSTFKRISWDNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKYVDKDKLIVADAYHGIYAIHLGRDMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGIIYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLKSQDNVEVFVDGLLGTVDNVKRDNQDNFYVALP-TEDSYLLSFIHRYPLINYYVAWLIPKRVFNIFLKSKSRILKINNEGEIVLEISGNKVGMDFITEAYETNGKILLGNLFNPYLDVL 1204
            LI  + +V + + ++  APK+  D K+ +         +  KR+SW+   R F     GPE+FT D +TG IYTG A+G ++ L  N   TT++  +R+ E++ NC S      CGR+LGLK  + + LIVAD+Y GI +I+L   +  K++LV  DK  +T+SLK FNSLD+S NG+IYFT+SS+KW+L D +Y+ LEGD+SGR+YS+ + T++L ++A++L  P+GL+L  +  SL+V+E+ K RL+K++L K  +N+EV +D L G   NV+ D ++N+Y+A+P T     LSF+++YP+INY +A+L+PK      + S S+I K ++ G I+  I G   G DF+TEAYE + KILLG+L +PYLDV+
Sbjct:    3 LINSLSIVGISVFLFLLAPKVIIDSKVKVINEEVSAPPNEVKRLSWNEVDRKFPNQLIGPEAFTIDAITGDIYTGTAEGMIWKL--NRELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKI--KEILVEKDKSEMTKSLKLFNSLDISTNGVIYFTISSLKWSLKDFIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSKQSNNIEVIMDKLNGFPANVRGDLRNNYYLAMPMTGIIETLSFLYKYPIINYSIAYLVPKWAILKLIGSDSKIYKFDDHGRIIAIIDGTHPGTDFVTEAYEADSKILLGSLSHPYLDVI 371          
BLAST of Adipocyte plasma membrane-associated protein vs. Planmine SMEST
Match: SMESG000009666.1 (SMESG000009666.1)

HSP 1 Score: 101.679 bits (252), Expect = 2.327e-23
Identity = 89/310 (28.71%), Postives = 152/310 (49.03%), Query Frame = 2
Query:  302 IYTGAADGKLYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKY-VDKDKLIVADAYHGIYAIHLGRDMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGIIYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQN-QTSLVVAELTKGRLLKINL-LKSQDNV--EVFVDGLLGTVDNV-----KRDNQDNFYVALPTEDSYLLSFIHRYPLINYYVAWLIPKRVFNIFLK-SKSRILKINNEGEIVLEISGNK-VGMDFITEAYETNGKILLGNLFNPYL 1195
            IY    DGK  I+  ND    L +        LN    +  + CGR LG++Y    ++L++ DAY G++ + L    A +       KD     + FFN LD+  NG +  + SS K+ L + +    E   +GRV   +  T + H++  NL FPNG+ L +N   +++VAE  K R+L IN+  KS  +V  +VFVD L G  DN+     K+    NF     +++S++   I   P +   +  L+   + ++ ++ S   +++++  G ++  +  +K V +   +E  E    + LGN + PYL
Sbjct:   87 IYGTTQDGK--IIKFNDTHIELLTL-------LNPSFCKTIQECGRPLGIRYDAVNNRLMIVDAYFGLFEVDLLTGKANRLF----PKDNSGFKVTFFNDLDILPNGDVIISESSTKYQLHNMISIIFESKPNGRVLRVNPNTGEYHILIDNLYFPNGVQLYRNDDETVLVAETLKLRVLAINVKPKSAISVRSKVFVDFLPGFPDNIRPSFSKQGYWINFASIRHSQNSFVTDIIASSPFLKNSIKKLLSDSILHMLMRTSHGIVVRVDELGNLIESLHDSKGVNVSTSSETLEVGNHLYLGNYYLPYL 383          
The following BLAST results are available for this feature:
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
APMAP1.342e-4026.60adipocyte plasma membrane associated protein [Sour... [more]
APMAP3.661e-3826.07adipocyte plasma membrane associated protein [Sour... [more]
back to top
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F57C2.54.446e-2526.69pep chromosome:WBcel235:II:14526213:14528296:-1 ge... [more]
F57C2.54.446e-2526.69pep chromosome:WBcel235:II:14526213:14528239:-1 ge... [more]
F57C2.51.748e-2326.81pep chromosome:WBcel235:II:14526213:14528207:-1 ge... [more]
T12G3.41.101e-2123.21pep chromosome:WBcel235:IV:12048268:12049943:1 gen... [more]
T12G3.41.101e-2123.21pep chromosome:WBcel235:IV:12048256:12049928:1 gen... [more]
back to top
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Hmu2.967e-2826.27gene:FBgn0015737 transcript:FBtr0085164[more]
Ssl25.893e-2327.65gene:FBgn0041780 transcript:FBtr0345060[more]
back to top
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
apmap7.881e-4130.55adipocyte plasma membrane associated protein [Sour... [more]
zgc:1942096.257e-3628.23zgc:194209 [Source:ZFIN;Acc:ZDB-GENE-081022-75][more]
back to top
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSXETT00000037041.13.061e-4329.29adipocyte plasma membrane associated protein LIKE ... [more]
ENSXETT00000024163.14.356e-4228.57adipocyte plasma membrane associated protein LIKE ... [more]
edem22.184e-3128.36ER degradation enhancer, mannosidase alpha-like 2 ... [more]
edem22.344e-3128.44ER degradation enhancer, mannosidase alpha-like 2 ... [more]
back to top
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Apmap1.595e-3725.51adipocyte plasma membrane associated protein [Sour... [more]
back to top
BLAST of Adipocyte plasma membrane-associated protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q803F5|APMAP_DANRE5.264e-4029.88Adipocyte plasma membrane-associated protein OS=Da... [more]
sp|Q9HDC9|APMAP_HUMAN6.446e-4026.60Adipocyte plasma membrane-associated protein OS=Ho... [more]
sp|Q5ZIF1|APMAP_CHICK2.912e-3927.81Adipocyte plasma membrane-associated protein OS=Ga... [more]
sp|B5X3B2|APMAP_SALSA5.138e-3930.68Adipocyte plasma membrane-associated protein OS=Sa... [more]
sp|Q3T0E5|APMAP_BOVIN4.048e-3726.41Adipocyte plasma membrane-associated protein OS=Bo... [more]
back to top
BLAST of Adipocyte plasma membrane-associated protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A099ZUY01.096e-4430.10Adipocyte plasma membrane-associated protein (Frag... [more]
T2M5K24.484e-4432.03Adipocyte plasma membrane-associated protein (Frag... [more]
V3ZMC18.356e-4430.42Str_synth domain-containing protein OS=Lottia giga... [more]
A0A2J6KMM53.074e-4335.15Str_synth domain-containing protein OS=Lactuca sat... [more]
A0A1L8GUK74.106e-4330.05Str_synth domain-containing protein OS=Xenopus lae... [more]
back to top
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
apmap2.184e-4231.85adipocyte plasma membrane associated protein [Sour... [more]
zgc:1942092.808e-2831.25adipocyte plasma membrane-associated protein-like ... [more]
zgc:1942094.234e-1425.17zgc:194209 [Source:ZFIN;Acc:ZDB-GENE-081022-75][more]
ENSAMXT00000047164.12.724e-1137.50pep primary_assembly:Astyanax_mexicanus-2.0:22:306... [more]
back to top
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
apmap1.699e-2428.44adipocyte plasma membrane associated protein [Sour... [more]
back to top
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO430123.772e-3528.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Adipocyte plasma membrane-associated protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
zgc:1942098.221e-3831.14adipocyte plasma membrane-associated protein-like ... [more]
apmap5.999e-3628.96adipocyte plasma membrane associated protein [Sour... [more]
back to top
BLAST of Adipocyte plasma membrane-associated protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000052602.10.000e+098.94SMESG000052602.1[more]
SMESG000052602.10.000e+094.69SMESG000052602.1[more]
SMESG000052600.11.017e-10443.43SMESG000052600.1[more]
SMESG000009666.12.327e-2328.71SMESG000009666.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032436 ID=SMED30032436|Name=Adipocyte plasma membrane-associated protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1393bp
CTTTTCAACCAATCAAATCAGCATAAAATTTAATCTCATTTCAGATTAAA
ATACTTGACATTTAGAGTTTTATAGAATTTTGTTCATGCTTATAAAATTT
GTAATAGTTGTGAGTTTAGGAATTCTCATTTATTGGGCCGCCCCGAAAAT
TGAAACTGATCCGAAACTGGTGATAAAAAAGAATACTCAATTGAAATTTT
CAAGTACTTTCAAACGAATTTCATGGGATAATTCTAGCAGATTATTTGTG
GGGGATTTTGCGGGACCTGAATCATTTACCCATGATCCGGTCACAGGGGC
AATTTACACAGGAGCAGCGGATGGAAAGCTTTATATTTTGGATATAAATG
ATATTTCTACTACATTGAAATCCTTCGTAAGAATAATGGAAAATAATCTG
AATTGTGAATCAAATGAATTCGGCAAAGCATGTGGAAGGATTTTGGGATT
GAAATATGTTGATAAAGACAAATTAATTGTTGCAGATGCCTACCATGGTA
TATATGCCATTCATCTGGGCAGGGACATGGCCACTAAGCAAGTACTTGTG
AGTCCGGATAAGGATATGCTTACACGATCACTAAAGTTTTTCAATTCATT
AGATGTTTCAAAGAACGGAATCATATATTTCACGGTATCATCAATGAAAT
GGACCTTGGACGATTCTTTATATGCTTTTTTAGAAGGTGACTCTTCTGGC
AGAGTCTACAGTTATGATTTAGTGACCCGAAAACTACATTTAATCGCTGC
CAATTTATCATTTCCGAATGGTTTATCCCTCACTCAAAATCAAACAAGTC
TCGTAGTTGCCGAGTTGACTAAAGGAAGATTGCTAAAAATTAATCTCCTC
AAATCTCAGGACAATGTCGAAGTTTTTGTTGATGGTCTTCTGGGAACAGT
TGATAATGTAAAACGAGATAATCAGGACAACTTTTATGTTGCCCTTCCAA
CAGAGGACTCTTACTTGTTGTCTTTTATTCACAGATATCCGTTGATAAAT
TATTACGTAGCCTGGCTTATACCTAAAAGAGTTTTCAACATATTTTTGAA
AAGTAAAAGTCGGATTTTGAAAATAAATAATGAGGGTGAAATTGTTTTAG
AGATTAGTGGAAATAAGGTGGGCATGGATTTTATTACTGAAGCTTATGAA
ACAAACGGGAAGATTTTATTGGGGAATTTGTTCAATCCTTATCTTGATGT
GCTGTATTTGAATCATTGACCCAATCGCATTGTTGACTTTTTGGAGGAGT
CATGAAAAATTTACTAAGGAAAATTTAGTGATTATTTTATTATTAATAAA
TTATTATCTTCATTAACTATATAAATCATTTATTTTGAAATGCAGTAAGT
AACAGGCTATAAATCGTTCGGTCTGCAACAAACAGGACAATGG
back to top

protein sequence of SMED30032436-orf-1

>SMED30032436-orf-1 ID=SMED30032436-orf-1|Name=SMED30032436-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=378bp
MLIKFVIVVSLGILIYWAAPKIETDPKLVIKKNTQLKFSSTFKRISWDNS
SRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRI
MENNLNCESNEFGKACGRILGLKYVDKDKLIVADAYHGIYAIHLGRDMAT
KQVLVSPDKDMLTRSLKFFNSLDVSKNGIIYFTVSSMKWTLDDSLYAFLE
GDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLL
KINLLKSQDNVEVFVDGLLGTVDNVKRDNQDNFYVALPTEDSYLLSFIHR
YPLINYYVAWLIPKRVFNIFLKSKSRILKINNEGEIVLEISGNKVGMDFI
TEAYETNGKILLGNLFNPYLDVLYLNH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR0110426-blade_b-propeller_TolB-like
IPR018119Strictosidine_synth_cons-reg
Vocabulary: biological process
TermDefinition
GO:0009058biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0016844strictosidine synthase activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011042Six-bladed beta-propeller, TolB-likeGENE3DG3DSA:2.120.10.30coord: 46..377
e-value: 7.9E-58
score: 197.7
IPR018119Strictosidine synthase, conserved regionPFAMPF03088Str_synthcoord: 170..251
e-value: 2.4E-21
score: 75.6
NoneNo IPR availablePANTHERPTHR10426STRICTOSIDINE SYNTHASE-RELATEDcoord: 30..370
NoneNo IPR availablePANTHERPTHR10426:SF65FI18644P1-RELATEDcoord: 30..370
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.629
NoneNo IPR availableSUPERFAMILYSSF63829Calcium-dependent phosphotriesterasecoord: 47..345