Inositol phosphoceramide mannosyltransferase 3

Overview
NameInositol phosphoceramide mannosyltransferase 3
Smed IDSMED30032429
Uniprot Best hitMannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1 (E=3.22057e-17)
Length (bp)1065
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Inositol phosphoceramide mannosyltransferase 3 (SMED30032429) t-SNE clustered cells

Violin plots show distribution of expression levels for Inositol phosphoceramide mannosyltransferase 3 (SMED30032429) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Inositol phosphoceramide mannosyltransferase 3 (SMED30032429) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Inositol phosphoceramide mannosyltransferase 3 (SMED30032429) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032429

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30032429SMESG000065897.1 SMESG000065885.1 SMESG000065880.1 SMESG000065849.1 dd_Smed_v4_7249_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30032429SMESG000065897.1 SMESG000065885.1 SMESG000065880.1 SMESG000065849.1 dd_Smed_v6_7249_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032429SMESG000065897.1 SMESG000065885.1 SMESG000065880.1 SMESG000065849.1 dd_Smed_v4_7249_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30032429SMESG000065897.1 SMESG000065885.1 SMESG000065880.1 SMESG000065849.1 dd_Smed_v4_7249_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ventral epidermis progenitor cellSMED30032429SMESG000065897.1 SMESG000065885.1 SMESG000065880.1 SMESG000065849.1 dd_Smed_v4_7249_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. UniProt
Match: sp|P33300|SUR1_YEAST (Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 3.221e-17
Identity = 51/179 (28.49%), Postives = 84/179 (46.93%), Query Frame = 1
Query:  247 VPKIIHYVYKTAYIPSQYSPHVKNCLEINKGAKFILWSDFTAYGLVLKHFQQNAKLFNSYFSKSVDSLKISDVIRYFILFKFGGIYMDLDTQCQKPLEEAMKNGSCILSQEINEQTRILWNAPYLAMNSFMATIPDHEFFQYLIGKLTVADS------SKIVYQTGPFFMTNALESYNK 765
            +PKIIH  YKT  IP  +    + CL+++   K+ILW+D  AY  + + +      F +Y       ++ +D IRYFIL  +GG+Y+DLD  C++ L+  +   + +              +P    N  M ++P H FF   +  L   D         I+  TGP F++   + Y +
Sbjct:   55 IPKIIHQTYKTEDIPEHWKEGRQKCLDLHPDYKYILWTDEMAYEFIKEEYPWFLDTFENYKY----PIERADAIRYFILSHYGGVYIDLDDGCERKLDPLLAFPAFLRK-----------TSPLGVSNDVMGSVPRHPFFLKALKSLKHYDKYWFIPYMTIMGSTGPLFLSVIWKQYKR 218          
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. UniProt
Match: sp|Q10323|IMT3_SCHPO (Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.027e-16
Identity = 55/220 (25.00%), Postives = 100/220 (45.45%), Query Frame = 1
Query:  145 FSCGQLINFSNGECQTLSTSDILSYGKVQQYANGVPKIIHYVYKTAYIPSQYSPHVKNCLEINKGAKFILWSDFTAYGLVLKHFQQNAKLFNSYFSKSVDSLKISDVIRYFILFKFGGIYMDLDTQCQKPLEEAMKNGSCILSQEINEQTRILWNAPYLAMNSFMATIPDHEF------------FQYLIGKLTVADSSKIVYQTGPFFMTNALESYNKL 768
            F    ++ F N +   L   D+ ++      +  +PKIIH  +KT  IP ++    K+C++++   +++LW+D +    +   +      ++SY      +++ +DV+RYFIL+K+GGIY+DLD  C + L+  +   + +              +P    N+ M     H F            F Y    LTV      +Y TGP F++    ++ KL
Sbjct:   23 FGGPMMLFFINYKTDLLKVDDVYNHEIYSNQSAAIPKIIHQTWKTNEIPEKWVGAQKSCIDLHPDYEYVLWTDESMREFIATDYPWFLTQYDSY----PYNIERADVVRYFILYKYGGIYLDLDVGCNRTLDPLLHYPAWVRR-----------TSPSGISNNVMGFAKGHPFLLQVVRNLPRFAFNYHFPYLTV------MYSTGPLFLSIIWSAWRKL 221          
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. UniProt
Match: sp|P38287|CSH1_YEAST (Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.825e-16
Identity = 51/179 (28.49%), Postives = 85/179 (47.49%), Query Frame = 1
Query:  247 VPKIIHYVYKTAYIPSQYSPHVKNCLEINKGAKFILWSDFTAYGLVLKHFQQNAKLFNSYFSKSVDSLKISDVIRYFILFKFGGIYMDLDTQCQKPLEEAMKNGSCILSQEINEQTRILWNAPYLAMNSFMATIPDHEFFQYLIGKLTVADSS------KIVYQTGPFFMTNALESYNK 765
            +PKIIH  YKT  IP Q+    + C++++    +ILW+D  +   + + +      F SY       ++ +D IRYFIL  +GGIY+DLD  C++ L+  +K  + +              +P    N  M ++P H FF  +I  L     +       I+  TGP F++   + Y +
Sbjct:   62 IPKIIHQTYKTNDIPEQWVKGRQKCIDLHPDYTYILWTDEMSDTFIKQEYPWFLDTFRSYEY----PIERADAIRYFILSHYGGIYIDLDDGCERRLDPLLKVPAFLRK-----------TSPTGVSNDVMGSVPRHPFFLKVIKSLKHYKKNWYIPYMTIMGSTGPLFISVVWKQYKR 225          
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. UniProt
Match: sp|O14084|IMT1_SCHPO (Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2)

HSP 1 Score: 80.8777 bits (198), Expect = 6.860e-16
Identity = 53/196 (27.04%), Postives = 84/196 (42.86%), Query Frame = 1
Query:  181 ECQTLSTSDILSYGKVQQYANGVPKIIHYVYKTAYIPSQYSPHVKNCLEINK---GAKFILWSDFTAYGLVLKHFQQNAKLFNSYFSKSVDSLKISDVIRYFILFKFGGIYMDLDTQCQKPLEEAMKNGSCILSQEINEQTRILWNAPYLAMNSFMATIPDHEFFQYLIGKLT------VADSSKIVYQTGPFFMT 741
            E  TLS SD+            +P++IH ++K   IP ++S  V +C   +    G +FILW+D      ++    +N   F   F     +++  D  RYFIL+ +GG+YMDLD  C+KP++  +   + IL              P    N + A  P H F    I  L+            +    GP F++
Sbjct:   42 EPFTLSLSDVSDDTSAPGEMEKIPRVIHQLWKDENIPERWSNTVNSCRRQHPDENGWQFILWTDEK----IMSFMNENYSWFMPVFHSYPYNIQKFDAARYFILYHYGGVYMDLDIGCKKPMDPLLSKATFILPS----------TEPIGYSNDWFAATPKHPFLYQAIHNLSKFNHRYFTKYPTVFLSAGPLFLS 223          
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. UniProt
Match: sp|Q9UT67|IMT2_SCHPO (Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.182e-15
Identity = 48/183 (26.23%), Postives = 87/183 (47.54%), Query Frame = 1
Query:  247 VPKIIHYVYKTAYIPSQYSPHVKNCLEINKGAKFILWSDFTAYGLVLKHFQQNAKLFNSYFSKSVDSLKISDVIRYFILFKFGGIYMDLDTQCQKPLEEAMKNGSCILSQEINEQTRILWNAPYLAMNSFMATIPDHEFFQYLIGKLTVADSS------KIVYQTGPFFMTNALESYNKLVRN 777
            +PKIIH  +KT  +P  +    ++C++++   ++ILW+D  +   +      N   F  YF     +++ +DVIRYF+L+ +GG Y+DLD  C++ L+  +     +   +           P    N  M ++P H +F+ +I  L     S       I+  TGP  ++   E Y + + N
Sbjct:   82 IPKIIHQTWKTTEVPEGWKGAQQSCIDLHPDYEYILWTDEMSRNFI----ADNYPWFLPYFDAYPFNVQRADVIRYFVLYHYGGNYIDLDDGCRQRLDSLLYYPVWVRRTD-----------PVGVSNDVMGSVPHHPYFELIIQNLEKNAKSYWLPYLTIMLSTGPLSISFLWEKYKRQLPN 249          
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. TrEMBL
Match: gnl|BL_ORD_ID|18193689 (tr|A0A267FUE4|A0A267FUE4_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019369g1 PE=4 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 2.561e-37
Identity = 80/252 (31.75%), Postives = 125/252 (49.60%), Query Frame = 1
Query:  247 VPKIIHYVYKTAYIPSQYSPHVKNCLEINKGAKFILWSDFTAYGLVLKHFQQNAKLFNSYFSKSVDSLKISDVIRYFILFKFGGIYMDLDTQCQKPLEEAMKNGSCILSQEINEQTRILWNAPYLAMNSFMATIPDHEFFQYLIGKLTVADSSKIVY-QTGPFFMTNALESYNKLVRNVTDQSKLVTLADPFLYSPFTEHYLEGR--CGGNPVGVWKVKGCKSLAEYRNQQKIRTKDAFVIHLFMHLGYNFA 993
            +P I+H+ + +  +   Y P + +CL++N    + LW D  A  L+  H+ Q  K +  +     D+L+ SD IRY IL +FGGIY+D+D +C +P   A+   +  L QE  EQTRI W   + AMNS M ++P H+FFQ +  ++ +       Y  TGP  +T   + +     +    +  V L  P + SP  +     R  C     G W  +GC+ L   + +   R      +H F+HLGY FA
Sbjct:   62 IPHILHHTFASEMVYENYRPMISSCLKLNPNWTYYLWRDSDARALIFLHYPQYMKTYMRF----NDNLQRSDAIRYIILHRFGGIYLDMDVECVRPFHPALTRQAAFLDQERVEQTRIAWGRQFSAMNSLMGSVPGHKFFQAMSDRVLLRKLPGDAYSSTGPNVLTQVFQRFRN---SPAIWNWPVHLLPPSVASPLMDPNRNWRQLCRYARYG-WGSRGCRMLRAKKWRMDDRNGGTVAVHRFLHLGYGFA 305          
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. TrEMBL
Match: gnl|BL_ORD_ID|15796774 (tr|A0A267DWU8|A0A267DWU8_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000101g1 PE=4 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 1.672e-35
Identity = 79/255 (30.98%), Postives = 129/255 (50.59%), Query Frame = 1
Query:  247 VPKIIHYVYKTAYIPSQYSPHVKNCLEINKGAKFILWSDFTAYGLVLKHFQQNAKLFNSYFSKSVDSLKISDVIRYFILFKFGGIYMDLDTQCQKPLEEAMKNGSCILSQEINEQTRILWNAPYLAMNSFMATIPDHEFFQYLIGKLTVADSSKIVYQ-TGPFFMTNALESYNKLVRNVTDQSKLVTLADPFLYSPFTEHY-------LEGRCGGNPVGVWKVKGCKSLAEYRNQQKIRTKDAFVIHLFMHLGYN 987
            +P I+H+ + +  +   Y P + +CL++N    + LW D  A  L+ K + +  K + S+     D+L+ SD IRY IL +FGGIY+D+D +C +P    + + +  + QE  EQTRILW   + AMNS M ++P H F++ +  ++      +  +Q TGP  +T   + Y     +   +S  VTL  P + SP  ++         + +  G+P   W  KGC  L           K   V+H F+HLGY+
Sbjct:  163 IPHILHHTFASEMVYKNYRPMISSCLKLNPNWTYYLWRDSDAIALISKEYPEYLKTYLSF----KDNLQRSDAIRYVILHRFGGIYLDMDVECLQPFHPGLTHLAAFIDQERLEQTRILWRRDFSAMNSVMGSVPGHPFYKAMADRVLKKYPGRYAFQSTGPLALTKFFQEYKG---SSEAKSWPVTLLPPSVASPLMDNQKNWKWLCRKAKRRGSPRLSWFDKGCHMLESKNWHLGSTDKSTIVVHRFLHLGYD 410          
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. TrEMBL
Match: gnl|BL_ORD_ID|15770976 (tr|A0A1I8GMC1|A0A1I8GMC1_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031525g2 PE=4 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 2.159e-35
Identity = 81/255 (31.76%), Postives = 133/255 (52.16%), Query Frame = 1
Query:  247 VPKIIHYVYKTAYIPSQYSPHVKNCLEINKGAKFILWSDFTAYGLVLKHFQQNAKLFNSYFSKSVDSLKISDVIRYFILFKFGGIYMDLDTQCQKPLEEAMKNGSCILSQEINEQTRILWNAPYLAMNSFMATIPDHEFFQYLIGKLTVADSSK-IVYQTGPFFMTNALESYNKLVRNVTDQSKLVTLADPFLYSPFTEH--YLEGRCG---GNPVG---VWKVKGCKSLAEYRNQQKIRTKDAFVIHLFMHLGY 984
            +P+I+H V ++  + ++YS  +++C  +N    +ILW D  A  L+ + F      + + ++K  + LK SD IRY IL+ FGG+Y DLD +C KP    +   +C L QE   Q+ I WN    AMNS M   P H F   L+ ++  + S++ ++  TGP  +T AL+ +     +  D +  V L DP ++SP  ++   L   C    G P     +W  +GC+ L ++   +   T+    +H FMHLG+
Sbjct:   38 IPRILHQVGESELVFAEYSFAIESCRRLNPNWTYILWRDKDAELLIKEFF---PDFYRTQYAKYTNRLKKSDSIRYIILYLFGGLYADLDVECMKPFSPDLDEEACFLDQENPAQSHIFWNKERSAMNSVMGCRPGHPFMLDLVSRMAESPSNQAVMLSTGPLMLTKALDEWTAQG-SQRDWADSVRLMDPDIFSPHVDNADILMDACRKRFGQPANDGELWVDRGCRDL-QFGGLKDNFTERTVAVHWFMHLGW 287          
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. TrEMBL
Match: gnl|BL_ORD_ID|15766129 (tr|A0A1I8I557|A0A1I8I557_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031525g1 PE=4 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 2.396e-35
Identity = 81/255 (31.76%), Postives = 133/255 (52.16%), Query Frame = 1
Query:  247 VPKIIHYVYKTAYIPSQYSPHVKNCLEINKGAKFILWSDFTAYGLVLKHFQQNAKLFNSYFSKSVDSLKISDVIRYFILFKFGGIYMDLDTQCQKPLEEAMKNGSCILSQEINEQTRILWNAPYLAMNSFMATIPDHEFFQYLIGKLTVADSSK-IVYQTGPFFMTNALESYNKLVRNVTDQSKLVTLADPFLYSPFTEH--YLEGRCG---GNPVG---VWKVKGCKSLAEYRNQQKIRTKDAFVIHLFMHLGY 984
            +P+I+H V ++  + ++YS  +++C  +N    +ILW D  A  L+ + F      + + ++K  + LK SD IRY IL+ FGG+Y DLD +C KP    +   +C L QE   Q+ I WN    AMNS M   P H F   L+ ++  + S++ ++  TGP  +T AL+ +     +  D +  V L DP ++SP  ++   L   C    G P     +W  +GC+ L ++   +   T+    +H FMHLG+
Sbjct:   38 IPRILHQVGESELVFAEYSFAIESCRRLNPNWTYILWRDKDAELLIKEFF---PDFYRTQYAKYTNRLKKSDSIRYIILYLFGGLYADLDVECMKPFSPDLDEEACFLDQENPAQSHIFWNKERSAMNSVMGCRPGHPFMLDLVSRMAKSPSNQAVMLSTGPLMLTKALDEWTAQG-SQRDWADSVRLMDPDIFSPHVDNADILMDACRKRFGQPANDGELWVDRGCRDL-QFGGLKDNFTERTVAVHWFMHLGW 287          
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. TrEMBL
Match: gnl|BL_ORD_ID|18319491 (tr|A0A1I8IW34|A0A1I8IW34_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.261e-34
Identity = 82/272 (30.15%), Postives = 135/272 (49.63%), Query Frame = 1
Query:  238 ANGVPKIIHYVYKTAYIPSQYSPHVKNCLEINKGAKFILWSDFTAYGLVLKHFQQNAKLFNSYFSKSVDSLKISDVIRYFILFKFGGIYMDLDTQCQKPLEEAMKNGSCILSQEINEQTRILWNAPYLAMNSFMATIPDHEFFQYLIGKLTVAD-SSKIVYQTGPFFMTNALESYNKLVRN-VTDQSKLVTLADPFLYSP--------------FTEHYLEGRCGGNPVGVWKVKGCKSLAEYRNQQKIRTKDAFVIHLFMHLGY--NFAKH 999
             N +P ++H +Y +  +P  Y   +  CL +N    ++LW+D  A   +  H+ Q   LFNSY       L+ SD +RYFIL +FGG+Y+D+D  C +P++  +   +C   QE  EQ+RIL    +  MNS +  +  H F + ++  L  A  ++ I+  TGP ++T+ L+ +    RN +  Q   + +  P+++SP               T+H L  R   +     K+  C+ L E  +   I T     IH F+HLGY  + A+H
Sbjct:  223 GNRIPPLLHQIYSSDKLPVDYRASISACLRLNPQFSYMLWTDEDAKQFMRTHYAQFIGLFNSY----KQPLQRSDALRYFILHQFGGVYLDMDVHCLRPMDSLVSKETCFFDQERPEQSRILHGVDFAVMNSAIGCVRRHPFLEQVLRNLQAARHNADIIRTTGPLYLTSQLKLFQ---RNYLISQRGGLRVLQPYVFSPLPDRSAGLRDICSRLTKHQLTARQPPSTSAQLKLDACQQLVEANSSAWI-TDRTLAIHRFLHLGYAGHSARH 486          
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. Ensembl Yeast
Match: SUR1 (Mannosylinositol phosphorylceramide (MIPC) synthase catalytic subunit; forms a complex with regulatory subunit Csg2p; function in sphingolipid biosynthesis is overlapping with that of Csh1p; SUR1 has a paralog, CSH1, that arose from the whole genome duplication [Source:SGD;Acc:S000005978])

HSP 1 Score: 85.5001 bits (210), Expect = 4.638e-19
Identity = 51/179 (28.49%), Postives = 84/179 (46.93%), Query Frame = 1
Query:  247 VPKIIHYVYKTAYIPSQYSPHVKNCLEINKGAKFILWSDFTAYGLVLKHFQQNAKLFNSYFSKSVDSLKISDVIRYFILFKFGGIYMDLDTQCQKPLEEAMKNGSCILSQEINEQTRILWNAPYLAMNSFMATIPDHEFFQYLIGKLTVADS------SKIVYQTGPFFMTNALESYNK 765
            +PKIIH  YKT  IP  +    + CL+++   K+ILW+D  AY  + + +      F +Y       ++ +D IRYFIL  +GG+Y+DLD  C++ L+  +   + +              +P    N  M ++P H FF   +  L   D         I+  TGP F++   + Y +
Sbjct:   55 IPKIIHQTYKTEDIPEHWKEGRQKCLDLHPDYKYILWTDEMAYEFIKEEYPWFLDTFENYKY----PIERADAIRYFILSHYGGVYIDLDDGCERKLDPLLAFPAFLRK-----------TSPLGVSNDVMGSVPRHPFFLKALKSLKHYDKYWFIPYMTIMGSTGPLFLSVIWKQYKR 218          
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. Ensembl Yeast
Match: CSH1 (Mannosylinositol phosphorylceramide (MIPC) synthase catalytic subunit; forms a complex with regulatory subunit Csg2p; function in sphingolipid biosynthesis is overlapping with that of Sur1p; CSH1 has a paralog, SUR1, that arose from the whole genome duplication [Source:SGD;Acc:S000000365])

HSP 1 Score: 82.8037 bits (203), Expect = 4.068e-18
Identity = 51/179 (28.49%), Postives = 85/179 (47.49%), Query Frame = 1
Query:  247 VPKIIHYVYKTAYIPSQYSPHVKNCLEINKGAKFILWSDFTAYGLVLKHFQQNAKLFNSYFSKSVDSLKISDVIRYFILFKFGGIYMDLDTQCQKPLEEAMKNGSCILSQEINEQTRILWNAPYLAMNSFMATIPDHEFFQYLIGKLTVADSS------KIVYQTGPFFMTNALESYNK 765
            +PKIIH  YKT  IP Q+    + C++++    +ILW+D  +   + + +      F SY       ++ +D IRYFIL  +GGIY+DLD  C++ L+  +K  + +              +P    N  M ++P H FF  +I  L     +       I+  TGP F++   + Y +
Sbjct:   62 IPKIIHQTYKTNDIPEQWVKGRQKCIDLHPDYTYILWTDEMSDTFIKQEYPWFLDTFRSYEY----PIERADAIRYFILSHYGGIYIDLDDGCERRLDPLLKVPAFLRK-----------TSPTGVSNDVMGSVPRHPFFLKVIKSLKHYKKNWYIPYMTIMGSTGPLFISVVWKQYKR 225          
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. Planmine SMEST
Match: SMESG000065880.1 (SMESG000065880.1)

HSP 1 Score: 633.254 bits (1632), Expect = 0.000e+0
Identity = 301/320 (94.06%), Postives = 309/320 (96.56%), Query Frame = 1
Query:  100 MKNIFIYFAVLIQCKFSCGQLINFSNGECQTLSTSDILSYGKVQQYANGVPKIIHYVYKTAYIPSQYSPHVKNCLEINKGAKFILWSDFTAYGLVLKHFQQNAKLFNSYFSKSVDSLKISDVIRYFILFKFGGIYMDLDTQCQKPLEEAMKNGSCILSQEINEQTRILWNAPYLAMNSFMATIPDHEFFQYLIGKLTVADSSKIVYQTGPFFMTNALESYNKLVRNVTDQSKLVTLADPFLYSPFTEHYLEGRCGGNPVGVWKVKGCKSLAEYRNQQKIRTKDAFVIHLFMHLGYNFAKHAVINLDYACKTFKNITIVWL 1059
            MKNIFIYFAVLIQCKFSCGQLINFSNGECQT+STSDILSYGKVQQYANGVPKIIHYVYKTAYIPSQYSPHVKNCLEINKG KFI WSDFT YG VLKHFQQNAKLF+SYFSKSV+SLKISDVIRYFILFKFGGIYMDLDTQCQKPLEEAMKNGSCILSQEINEQTRILWNAPYLAMNSFMATIPDHEFFQYLIGKLTVADS+ I+YQTGPFFMTNALESYNKLVRNVTDQSKLV LAD +LYSPFTE YLEG CGGNPVGVWKVKGCK+LAE+R QQKIRTKDAFVIHLFMHLGYNFAKHAVINLDY CKTFKNITIVWL
Sbjct:    1 MKNIFIYFAVLIQCKFSCGQLINFSNGECQTMSTSDILSYGKVQQYANGVPKIIHYVYKTAYIPSQYSPHVKNCLEINKGVKFIFWSDFTTYGFVLKHFQQNAKLFSSYFSKSVESLKISDVIRYFILFKFGGIYMDLDTQCQKPLEEAMKNGSCILSQEINEQTRILWNAPYLAMNSFMATIPDHEFFQYLIGKLTVADSAHILYQTGPFFMTNALESYNKLVRNVTDQSKLVILADSYLYSPFTERYLEGHCGGNPVGVWKVKGCKTLAEHRKQQKIRTKDAFVIHLFMHLGYNFAKHAVINLDYVCKTFKNITIVWL 320          
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. Planmine SMEST
Match: SMESG000065849.1 (SMESG000065849.1)

HSP 1 Score: 624.78 bits (1610), Expect = 0.000e+0
Identity = 299/320 (93.44%), Postives = 308/320 (96.25%), Query Frame = 1
Query:  100 MKNIFIYFAVLIQCKFSCGQLINFSNGECQTLSTSDILSYGKVQQYANGVPKIIHYVYKTAYIPSQYSPHVKNCLEINKGAKFILWSDFTAYGLVLKHFQQNAKLFNSYFSKSVDSLKISDVIRYFILFKFGGIYMDLDTQCQKPLEEAMKNGSCILSQEINEQTRILWNAPYLAMNSFMATIPDHEFFQYLIGKLTVADSSKIVYQTGPFFMTNALESYNKLVRNVTDQSKLVTLADPFLYSPFTEHYLEGRCGGNPVGVWKVKGCKSLAEYRNQQKIRTKDAFVIHLFMHLGYNFAKHAVINLDYACKTFKNITIVWL 1059
            MKNIFIYFAVLIQCKFSCGQLINF NGECQT+STSDILSYGKVQQYANGVPKIIHYVYKTAYIPSQYSPHVKNCLEINKGAKFILWSDFTAYG VLKHFQQNAKLF+SYFSKSV+SLKISDVIRYFILFKFGGIYMDLDTQCQKPLEEAMK GSCILSQEINEQTRILWNAPY AMNSFMATIPDHEFF+YLIGKLTVA+S +IVYQTGPFFMTNALESYNKLVRNVTDQSKLV LAD +LYSPFTEHYLEG C GNPVG WKVKGCK+LAE+R QQKIRTKDAFVIHLFMHLGYNFAKHAVINLDYACKT KNITIVWL
Sbjct:    1 MKNIFIYFAVLIQCKFSCGQLINFPNGECQTMSTSDILSYGKVQQYANGVPKIIHYVYKTAYIPSQYSPHVKNCLEINKGAKFILWSDFTAYGFVLKHFQQNAKLFSSYFSKSVESLKISDVIRYFILFKFGGIYMDLDTQCQKPLEEAMKKGSCILSQEINEQTRILWNAPYAAMNSFMATIPDHEFFKYLIGKLTVANSFEIVYQTGPFFMTNALESYNKLVRNVTDQSKLVILADSYLYSPFTEHYLEGHCYGNPVGDWKVKGCKTLAEHRKQQKIRTKDAFVIHLFMHLGYNFAKHAVINLDYACKTLKNITIVWL 320          
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. Planmine SMEST
Match: SMESG000054245.1 (SMESG000054245.1)

HSP 1 Score: 418.698 bits (1075), Expect = 3.491e-147
Identity = 188/294 (63.95%), Postives = 236/294 (80.27%), Query Frame = 1
Query:  175 NGECQTLSTSDILSYGKVQQYANGVPKIIHYVYKTAYIPSQYSPHVKNCLEINKGAKFILWSDFTAYGLVLKHFQQNAKLFNSYFSKSVDSLKISDVIRYFILFKFGGIYMDLDTQCQKPLEEAMKNGSCILSQEINEQTRILWNAPYLAMNSFMATIPDHEFFQYLIGKLTVADSSKIVYQTGPFFMTNALESYNKLVRNVTDQSKLVTLADPFLYSPFTEHYLEGRCGGNPVGVWKVKGCKSLAEYRNQQKIRTKDAFVIHLFMHLGYNFAKHAVINLDYACKTFKNITIVW 1056
            NG C+  ST+ ++ +G+  QYANG+PKIIHY+YKTA+IP+QYSPHVKNC++INK AKF+ W+DFTAY  ++ +F    KL++SYFSKS  SLKISDVIRYFIL+KFGGIYMD DT+CQKP + AM NGSCILSQE++EQ RI+WN PYLAMNSFMA IPDH+FF+YLIGKLT+ADSS I+ QTGPF ++N+L++Y K+V N  D  K VTLADP+ YSP TE+YLE  C  +P G WK++GCK L  +R QQK++  DA V+HLFMHLGY FAK  +  LD  C+TF N+TI+W
Sbjct:   32 NGVCEIFSTNLLMEFGRRHQYANGIPKIIHYIYKTAFIPTQYSPHVKNCMDINKDAKFVFWADFTAYRFIINNFHNYVKLYSSYFSKSTHSLKISDVIRYFILYKFGGIYMDFDTRCQKPFDMAMLNGSCILSQEVHEQKRIMWNLPYLAMNSFMAAIPDHDFFKYLIGKLTLADSSFILSQTGPFLLSNSLDAYKKIVTNTKDVKKSVTLADPYFYSPHTENYLESLC-RSPSGFWKIQGCKDLGSHRQQQKLKMNDAVVVHLFMHLGYEFAKGNIKLLDNVCRTFTNMTIIW 324          
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. Planmine SMEST
Match: SMESG000052405.1 (SMESG000052405.1)

HSP 1 Score: 418.313 bits (1074), Expect = 5.008e-147
Identity = 189/294 (64.29%), Postives = 235/294 (79.93%), Query Frame = 1
Query:  175 NGECQTLSTSDILSYGKVQQYANGVPKIIHYVYKTAYIPSQYSPHVKNCLEINKGAKFILWSDFTAYGLVLKHFQQNAKLFNSYFSKSVDSLKISDVIRYFILFKFGGIYMDLDTQCQKPLEEAMKNGSCILSQEINEQTRILWNAPYLAMNSFMATIPDHEFFQYLIGKLTVADSSKIVYQTGPFFMTNALESYNKLVRNVTDQSKLVTLADPFLYSPFTEHYLEGRCGGNPVGVWKVKGCKSLAEYRNQQKIRTKDAFVIHLFMHLGYNFAKHAVINLDYACKTFKNITIVW 1056
            NG C+  ST+ ++ +G+  QYANG+PKIIHYVYKTAYIP+QYSPHVKNC++INK AKF+ W+DFTAY  ++ +F    KL++SYFSKS  SLKISDVIRYFIL+KFGGIYMD DT+CQKP   AM NGSCILSQE+ EQTRILWN PYLAMNSFMA IPDH+FF++LIGKLT+ADSS I+ QTGPF ++N+L++Y K++ N  D  K VTLADP+ YSP TE+YLE  C  +P G WK++GCK L  +R QQK++  +A V+HLFMHLGY FAK  +  LD  C+TF N+TI+W
Sbjct:   32 NGVCEIFSTNSLMEFGRRHQYANGIPKIIHYVYKTAYIPTQYSPHVKNCMDINKDAKFVFWADFTAYRFIINNFHNYVKLYSSYFSKSTHSLKISDVIRYFILYKFGGIYMDFDTRCQKPFNIAMLNGSCILSQEVLEQTRILWNLPYLAMNSFMAAIPDHDFFKFLIGKLTLADSSFILSQTGPFLLSNSLDAYKKIITNTKDVKKSVTLADPYFYSPHTENYLESLC-KSPSGFWKIQGCKDLGSHRQQQKLKMNEAVVVHLFMHLGYEFAKGNIKLLDNVCRTFTNMTIIW 324          
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. Planmine SMEST
Match: SMESG000054422.1 (SMESG000054422.1)

HSP 1 Score: 415.231 bits (1066), Expect = 1.069e-145
Identity = 187/294 (63.61%), Postives = 234/294 (79.59%), Query Frame = 1
Query:  175 NGECQTLSTSDILSYGKVQQYANGVPKIIHYVYKTAYIPSQYSPHVKNCLEINKGAKFILWSDFTAYGLVLKHFQQNAKLFNSYFSKSVDSLKISDVIRYFILFKFGGIYMDLDTQCQKPLEEAMKNGSCILSQEINEQTRILWNAPYLAMNSFMATIPDHEFFQYLIGKLTVADSSKIVYQTGPFFMTNALESYNKLVRNVTDQSKLVTLADPFLYSPFTEHYLEGRCGGNPVGVWKVKGCKSLAEYRNQQKIRTKDAFVIHLFMHLGYNFAKHAVINLDYACKTFKNITIVW 1056
            NG C+  ST+ ++ +G+  QY NG+PKIIHYVYKTA+IP+QYSPHVKNC++INK AKF+ W+DFTAY  ++ +F    KL++SYFSKS  SLKISDVIRYFIL+KFGGIYMD DT+CQK  + AM NGSCILSQE++EQTRILWN PYLAMNSFMA IPDH+FF+YLIGKLT+ADSS I+ QTGPF ++N+L++Y  +V N  D  K VTLADP+ YSP TE+YLE  C  +P G WK++GCK L  +R QQK++  +A V+HLFMHLGY FAK  +  LD  C+TF N+TI+W
Sbjct:   32 NGVCEIFSTNSLMEFGRRHQYVNGIPKIIHYVYKTAFIPTQYSPHVKNCMDINKDAKFVFWADFTAYRFIINNFHNYVKLYSSYFSKSTHSLKISDVIRYFILYKFGGIYMDFDTRCQKSFDMAMLNGSCILSQEVHEQTRILWNLPYLAMNSFMAAIPDHDFFKYLIGKLTLADSSFILSQTGPFLLSNSLDAYKNIVTNTKDVKKSVTLADPYFYSPHTENYLESLC-RSPSGFWKIQGCKDLGSHRQQQKLKMNEAVVVHLFMHLGYEFAKGNIKLLDNVCRTFTNMTIIW 324          
The following BLAST results are available for this feature:
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P33300|SUR1_YEAST3.221e-1728.49Mannosyl phosphorylinositol ceramide synthase SUR1... [more]
sp|Q10323|IMT3_SCHPO1.027e-1625.00Inositol phosphoceramide mannosyltransferase 3 OS=... [more]
sp|P38287|CSH1_YEAST2.825e-1628.49Mannosyl phosphorylinositol ceramide synthase CSH1... [more]
sp|O14084|IMT1_SCHPO6.860e-1627.04Inositol phosphoceramide mannosyltransferase 1 OS=... [more]
sp|Q9UT67|IMT2_SCHPO1.182e-1526.23Inositol phosphoceramide mannosyltransferase 2 OS=... [more]
back to top
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|181936892.561e-3731.75tr|A0A267FUE4|A0A267FUE4_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|157967741.672e-3530.98tr|A0A267DWU8|A0A267DWU8_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|157709762.159e-3531.76tr|A0A1I8GMC1|A0A1I8GMC1_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|157661292.396e-3531.76tr|A0A1I8I557|A0A1I8I557_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|183194911.261e-3430.15tr|A0A1I8IW34|A0A1I8IW34_9PLAT Uncharacterized pro... [more]
back to top
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SUR14.638e-1928.49Mannosylinositol phosphorylceramide (MIPC) synthas... [more]
CSH14.068e-1828.49Mannosylinositol phosphorylceramide (MIPC) synthas... [more]
back to top
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Inositol phosphoceramide mannosyltransferase 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065880.10.000e+094.06SMESG000065880.1[more]
SMESG000065849.10.000e+093.44SMESG000065849.1[more]
SMESG000054245.13.491e-14763.95SMESG000054245.1[more]
SMESG000052405.15.008e-14764.29SMESG000052405.1[more]
SMESG000054422.11.069e-14563.61SMESG000054422.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032429 ID=SMED30032429|Name=Inositol phosphoceramide mannosyltransferase 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1065bp
GGTATTTTACGGTTATGATTTTATTCAACTTTCCAATGCATTTTCACGCT
TCATTGAATTTTTGTTATATATTTGTCAATATTTGTCACTATTAAAATTA
TGAAAAATATTTTCATATATTTTGCAGTTCTTATTCAGTGTAAATTTTCA
TGTGGACAATTAATAAATTTTTCCAATGGGGAATGCCAGACATTGTCTAC
GAGTGACATTTTGAGTTATGGAAAAGTGCAACAATACGCAAACGGAGTGC
CGAAAATTATTCATTATGTATACAAAACAGCTTACATCCCCTCTCAATAT
TCTCCCCACGTGAAAAATTGTTTGGAAATTAATAAAGGAGCTAAATTTAT
TCTTTGGTCAGATTTTACGGCTTACGGATTGGTTTTGAAACATTTTCAGC
AAAATGCCAAATTGTTCAATTCATATTTTTCTAAATCTGTAGACTCTTTG
AAAATATCAGACGTGATTAGATATTTTATTTTATTCAAATTCGGCGGTAT
TTATATGGACCTCGATACTCAATGTCAGAAACCACTTGAGGAGGCTATGA
AGAATGGCAGTTGTATTCTTAGTCAAGAAATTAATGAGCAAACGAGGATT
TTATGGAATGCTCCTTATTTGGCCATGAATAGCTTTATGGCAACAATACC
CGATCATGAATTCTTTCAATATCTGATTGGGAAATTGACAGTTGCGGATT
CTTCGAAAATAGTGTATCAAACAGGCCCATTTTTCATGACAAATGCCTTG
GAATCCTACAATAAACTTGTCAGAAATGTAACTGACCAATCAAAATTAGT
AACTTTGGCGGATCCATTTTTGTATTCACCATTCACGGAACATTATCTCG
AAGGACGTTGTGGCGGTAACCCAGTTGGAGTTTGGAAAGTGAAAGGATGC
AAGAGTTTAGCAGAATATCGAAACCAGCAAAAGATCCGAACGAAAGATGC
TTTTGTCATTCACCTATTTATGCACTTAGGATACAATTTTGCAAAACATG
CTGTAATAAATTTGGATTATGCTTGCAAAACATTTAAGAACATCACAATA
GTTTGGCTGTAAATG
back to top

protein sequence of SMED30032429-orf-1

>SMED30032429-orf-1 ID=SMED30032429-orf-1|Name=SMED30032429-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=321bp
MKNIFIYFAVLIQCKFSCGQLINFSNGECQTLSTSDILSYGKVQQYANGV
PKIIHYVYKTAYIPSQYSPHVKNCLEINKGAKFILWSDFTAYGLVLKHFQ
QNAKLFNSYFSKSVDSLKISDVIRYFILFKFGGIYMDLDTQCQKPLEEAM
KNGSCILSQEINEQTRILWNAPYLAMNSFMATIPDHEFFQYLIGKLTVAD
SSKIVYQTGPFFMTNALESYNKLVRNVTDQSKLVTLADPFLYSPFTEHYL
EGRCGGNPVGVWKVKGCKSLAEYRNQQKIRTKDAFVIHLFMHLGYNFAKH
AVINLDYACKTFKNITIVWL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000096ventral epidermis
PLANA:0002032epidermal cell
PLANA:0003503ventral epidermis progenitor cell
Vocabulary: INTERPRO
TermDefinition
IPR007577GlycoTrfase_DXD_sugar-bd_CS
IPR029044Nucleotide-diphossugar_trans
Vocabulary: molecular function
TermDefinition
GO:0000030mannosyltransferase activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0016021integral component of membrane
GO:0032588trans-Golgi network membrane
GO:0033106cis-Golgi network membrane
Vocabulary: biological process
TermDefinition
GO:0051999mannosyl-inositol phosphorylceramide biosynthetic process
GO:0097502mannosylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007577Glycosyltransferase, DXD sugar-binding motifPFAMPF04488Gly_transf_sugcoord: 70..148
e-value: 1.9E-12
score: 47.6
NoneNo IPR availableGENE3DG3DSA:3.90.550.20coord: 50..238
e-value: 2.0E-14
score: 56.4
NoneNo IPR availablePANTHERPTHR32385FAMILY NOT NAMEDcoord: 42..260
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.594
IPR029044Nucleotide-diphospho-sugar transferasesSUPERFAMILYSSF53448Nucleotide-diphospho-sugar transferasescoord: 44..229