Protocadherin-9

Overview
NameProtocadherin-9
Smed IDSMED30032428
Length (bp)3642
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin-9 (SMED30032428) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin-9 (SMED30032428) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin-9 (SMED30032428) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin-9 (SMED30032428) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032428

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30032428SMESG000005371.1 SMESG000005372.1 dd_Smed_v4_14613_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30032428SMESG000005371.1 SMESG000005372.1 SmedASXL_016073SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30032428SMESG000005371.1 SMESG000005372.1 dd_Smed_v4_14613_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032428SMESG000005371.1 SMESG000005372.1 dd_Smed_v4_14613_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30032428SMESG000005371.1 SMESG000005372.1 dd_Smed_v4_14613_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30032428SMESG000005371.1 SMESG000005372.1 dd_Smed_v4_14613_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30032428SMESG000005371.1 SMESG000005372.1 dd_Smed_v4_14613_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032428SMESG000005371.1 Contig55419newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032428SMESG000005371.1 Contig55419uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032428SMESG000005371.1 Contig49876newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032428SMESG000005371.1 Contig49876uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30032428SMESG000005371.1 SMESG000005372.1 dd_Smed_v6_14613_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30032428SMESG000005371.1 OX_Smed_1.0.10382ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30032428SMESG000005371.1 SMESG000005372.1 dd_Smed_v4_14613_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 257.684 bits (657), Expect = 2.456e-70
Identity = 214/764 (28.01%), Postives = 357/764 (46.73%), Query Frame = 1
Query:  583 SDLFKIDSKGN--LTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNS----ISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNE-----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFV-IYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEK---SPNR----ISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNS---FIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTP-SLST--NVYFYVNITSASS 2799
            + L K+ S      TT   IDR+ +C   S  +++ C  ++  V+I PN     I  +II  +KD NDN P F SP+  I+IPE+  + S + +P A D D+  NG+  Y L +  + F   ++        P + + + LDRE  + Y + + V +      S++   QV VSD NDN+P F               E  V ++I EN  +   +   HA D D G N++I Y   ++ +       TK      + T  I ++ +LD E +   H + V+ +  +  P R+   ++TIN+ D+NDN P I  +   SP      +SE D   T + +  VSDKD      + C +  E +  F L   + + Y L      DYE ++  + +++  D  +P L QT   ++++ DENDN P + Q    ++V E +    ++  ++ATD DS K   + + +         +F  +D + G +  +   DRE   + ++ +T  DN               ++  + + + D NDNSP++      F + ENLP  S V  +   D D   +  VTL  +       D  N+     +  I      +RE +++ T  ++A D G P R +   +   ++DVNDNSP++ SPP+N+    +P + +  S     ++A++ A D D G+N+ L Y I+  N  NK  FRI      +T  E      +G+  L ++I D G P SL T   V+ YVN T+ ++
Sbjct:   73 APLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFEL-EVVILPNDFFRLIKIKII--VKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVF--------------KEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVA-----PATKRLFALNNTTGLITVQRSLDRE-ETAIHKVTVLASDGSSTPARA---TVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFI--EREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLG-----PNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDN---------GTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILN------DNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGS-----VVAEVFAVDVDTGMNAELKYTIVSGN--NKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHTLVLVFLYVNDTAGNA 781          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 257.684 bits (657), Expect = 9.754e-70
Identity = 214/762 (28.08%), Postives = 356/762 (46.72%), Query Frame = 1
Query:  589 LFKIDSKGN--LTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNS----ISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNE-----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFV-IYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEK---SPNR----ISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNS---FIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTP-SLST--NVYFYVNITSASS 2799
            L K+ S      TT   IDR+ +C   S  +++ C  ++  V+I PN     I  +II  +KD NDN P F SP+  I+IPE+  + S + +P A D D+  NG+  Y L +  + F   ++        P + + + LDRE  + Y + + V +      S++   QV VSD NDN+P F               E  V ++I EN  +   +   HA D D G N++I Y   ++ +       TK      + T  I ++ +LD E +   H + V+ +  +  P R+   ++TIN+ D+NDN P I  +   SP      +SE D   T + +  VSDKD      + C +  E +  F L   + + Y L      DYE ++  + +++  D  +P L QT   ++++ DENDN P + Q    ++V E +    ++  ++ATD DS K   + + +         +F  +D + G +  +   DRE   + ++ +T  DN               ++  + + + D NDNSP++      F + ENLP  S V  +   D D   +  VTL  +       D  N+     +  I      +RE +++ T  ++A D G P R +   +   ++DVNDNSP++ SPP+N+    +P + +  S     ++A++ A D D G+N+ L Y I+  N  NK  FRI      +T  E      +G+  L ++I D G P SL T   V+ YVN T+ ++
Sbjct:   75 LVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFEL-EVVILPNDFFRLIKIKII--VKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVF--------------KEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVA-----PATKRLFALNNTTGLITVQRSLDRE-ETAIHKVTVLASDGSSTPARA---TVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFI--EREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLG-----PNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDN---------GTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILN------DNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGS-----VVAEVFAVDVDTGMNAELKYTIVSGN--NKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHTLVLVFLYVNDTAGNA 781          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 258.07 bits (658), Expect = 9.962e-70
Identity = 214/762 (28.08%), Postives = 356/762 (46.72%), Query Frame = 1
Query:  589 LFKIDSKGN--LTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNS----ISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNE-----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFV-IYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEK---SPNR----ISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNS---FIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTP-SLST--NVYFYVNITSASS 2799
            L K+ S      TT   IDR+ +C   S  +++ C  ++  V+I PN     I  +II  +KD NDN P F SP+  I+IPE+  + S + +P A D D+  NG+  Y L +  + F   ++        P + + + LDRE  + Y + + V +      S++   QV VSD NDN+P F               E  V ++I EN  +   +   HA D D G N++I Y   ++ +       TK      + T  I ++ +LD E +   H + V+ +  +  P R+   ++TIN+ D+NDN P I  +   SP      +SE D   T + +  VSDKD      + C +  E +  F L   + + Y L      DYE ++  + +++  D  +P L QT   ++++ DENDN P + Q    ++V E +    ++  ++ATD DS K   + + +         +F  +D + G +  +   DRE   + ++ +T  DN               ++  + + + D NDNSP++      F + ENLP  S V  +   D D   +  VTL  +       D  N+     +  I      +RE +++ T  ++A D G P R +   +   ++DVNDNSP++ SPP+N+    +P + +  S     ++A++ A D D G+N+ L Y I+  N  NK  FRI      +T  E      +G+  L ++I D G P SL T   V+ YVN T+ ++
Sbjct:   75 LVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFEL-EVVILPNDFFRLIKIKII--VKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVF--------------KEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVA-----PATKRLFALNNTTGLITVQRSLDRE-ETAIHKVTVLASDGSSTPARA---TVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFI--EREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLG-----PNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDN---------GTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILN------DNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGS-----VVAEVFAVDVDTGMNAELKYTIVSGN--NKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHTLVLVFLYVNDTAGNA 781          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 257.299 bits (656), Expect = 1.234e-69
Identity = 214/762 (28.08%), Postives = 356/762 (46.72%), Query Frame = 1
Query:  589 LFKIDSKGN--LTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNS----ISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNE-----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFV-IYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEK---SPNR----ISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNS---FIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTP-SLST--NVYFYVNITSASS 2799
            L K+ S      TT   IDR+ +C   S  +++ C  ++  V+I PN     I  +II  +KD NDN P F SP+  I+IPE+  + S + +P A D D+  NG+  Y L +  + F   ++        P + + + LDRE  + Y + + V +      S++   QV VSD NDN+P F               E  V ++I EN  +   +   HA D D G N++I Y   ++ +       TK      + T  I ++ +LD E +   H + V+ +  +  P R+   ++TIN+ D+NDN P I  +   SP      +SE D   T + +  VSDKD      + C +  E +  F L   + + Y L      DYE ++  + +++  D  +P L QT   ++++ DENDN P + Q    ++V E +    ++  ++ATD DS K   + + +         +F  +D + G +  +   DRE   + ++ +T  DN               ++  + + + D NDNSP++      F + ENLP  S V  +   D D   +  VTL  +       D  N+     +  I      +RE +++ T  ++A D G P R +   +   ++DVNDNSP++ SPP+N+    +P + +  S     ++A++ A D D G+N+ L Y I+  N  NK  FRI      +T  E      +G+  L ++I D G P SL T   V+ YVN T+ ++
Sbjct:   75 LVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFEL-EVVILPNDFFRLIKIKII--VKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVF--------------KEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVA-----PATKRLFALNNTTGLITVQRSLDRE-ETAIHKVTVLASDGSSTPARA---TVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFI--EREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLG-----PNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDN---------GTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILN------DNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGS-----VVAEVFAVDVDTGMNAELKYTIVSGN--NKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHTLVLVFLYVNDTAGNA 781          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 253.832 bits (647), Expect = 6.262e-69
Identity = 236/798 (29.57%), Postives = 371/798 (46.49%), Query Frame = 1
Query:  442 VFLKKTNQIEFNLIDVTPKETIIGSLLQSEN-------SQNTKISFNNVVLRSYSDLFKI--DSKGNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSI--SYEIILNIKDENDNRPTFVSPLTVINI--PESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNE-----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNG-KPQRSASVSLTINLLDINDNFPQITEK-------SPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFI-ESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTEL-FASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRI-QKTGEILTNWESYETLKIGIFYLHISIYDSGTP 2748
            VF     +  + + +  P+  +IG+LL+  N       S  T + F  V       L +I  D+    TT   IDR+ +C  +   +D  C  ++  V I P+ I    +I   I+D NDN P F  P TVINI  PE++ + S Y LP AVD D   NG+  Y L    N F   +I        P + + K LDRE  + Y + + V +      S++   QV V+D NDN P F       K   I  S      I EN  +   +   HA D D GEN+KI +S S+  S   N+    F + +   T  I ++  LD E        L++LA+D G  P R+    + +N+ D+NDN P I  +           +SEN    T + +  V+DKD      ++C    E    F+L   F + + L N    DYE ++   ++L+  D  +P L Q+    I++ DENDN P +TQ    V++ E ++    ++KV+ATD+DS    ++ + +   D P  F+   +D + G + +   +DRE+  + ++ I   DN    P   +N+T F       + I D NDNSP +   +  F +PENLP +  V  +   D D   ++ VTL  + E++  T D      G++   I      +RE + + T  ++AED G   R +   +   ++DVNDN P+   PP N    + EL   ST    ++ ++ A D D G+N+ + Y I+  N   +  F I Q+TG I T  E  +   +G+  + +   D G P
Sbjct:   39 VFHSGAQEKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIP--RDEHCFYEV-EVAILPDEIFRLVKIRFLIEDINDNAPLF--PATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVF-------KETEIEVS------IPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVS---NIARRLFHLNA--TTGLITIKEPLDREETPNHK--LLVLASDGGLMPARAM---VLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIP--FRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINY-LLGPDAPPEFS---LDRRTGMLTVVKKLDREKEDKYLFTILAKDN--GVPPLTSNVTVF-------VSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQT---GVIRPNI----SFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNY---SYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGN--TRDLFAIDQETGNI-TLMEKCDVTDLGLHRVLVKANDLGQP 780          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 160.999 bits (406), Expect = 1.978e-39
Identity = 193/765 (25.23%), Postives = 333/765 (43.53%), Query Frame = 1
Query:  490 TPKETIIGSLLQSENSQNTKISFNNVVLR--SYSDLFKIDS-KGNLTTLTHIDRDDICIRLSCCKDSICTIKMTAV-LIFPN-SISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQ-ITEKSPNRISENDK-RETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLT-NKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLST 2760
            TP ETII S+ ++ ++ +  + ++ V  +     +LF +D+  G +     +DR+ +   +         +K+TA   + P  S S  +++++ D  DN P F        I E A + +      A D DS  NG   YSL + +     ++      +    PLDRET+ +  L +   +K      ++   ++ V D NDN P F              S+S+ + I EN T+   I +  A D D G N K+ YS++S        +T  +S      T ++ LR  +D +N     I  VI A D  +P  S++V LTIN++DIND+ P  I  +    + EN    E V +++ + D+D  S  N     S E    F + +   D   +      D E +   ++++   D   P L  +T   + + D NDN P + +KEY+V + E       II + A D+D ++  K+ + I EAD  + F+ + I  Q   + ++  + R+   ++   I+ TD                 +  + + I D+N ++P +       KIPE+ PI   V  L+  D D   +  +      S+    D S       +  I V ++L+RE +   ++ + A D+ SP   T   +   + D+NDNSP   S    + I       ++       ++ A D D G N  ++Y +  S+ + +   FR+ +T   L      +  +  +  L I   D GTPSLS 
Sbjct:  178 TPIETIIASV-KASHASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHI---------LKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFA-------------SDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGI--GGLTIDYS------TGEVTLRERIDAKNSP---ITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAI-DED--SGPNGIIKYSMEGSEDFIIDE---DSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEAD-REVFSILDIGDQGAILSVSGELKRQDH-KVRVEISATDQ-----------GGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPS-------SGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTS-----FLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSA 874          

HSP 2 Score: 144.05 bits (362), Expect = 3.170e-34
Identity = 168/685 (24.53%), Postives = 291/685 (42.48%), Query Frame = 1
Query:  739 IILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILV-ILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLK-FIESESQTFD--ESNYWFGIVNNTIFVKNELNREHK-NNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYV 2778
            + +N+ D ND+ PT ++   +I + E+  +        A+D+DS  NGI +YS+     + ++ +  +   +   K LDRET   Y+L +   +      + S    V + D NDN P F               + + + I E      +I +  A+DNDE  + KI Y I   D          FSI    +   I   L++  E + + H + V I ATD G  Q    V++ I+  D+N + P   +  P  +   +       +  +  +D    DN     S +S + F++     D+   +++   D E     +V +   D A P L  +T  ++ + D NDN PQ+T   Y   + E        ++V+A D+D    G + + + E+    +    R+D  +G + +++ +DRE+F  +V  I   D               S  +++T+ + D+NDN+P +        I EN P+ S V  +   D DE  +  ++ + F  ++++ FD  E     G+V   I  + E + E K N     LQA    S +  + V +   + DVNDN P LK      F+     F + +  + I  I A DPD   N+TL Y +  ++L     +    TG+IL   E    + +        + D      ST  + +V
Sbjct:  465 LTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME---GSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTF-------------DKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADR-------EVFSILDIGDQGAI---LSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFID--DVN-SAPYFNDH-PFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSGDISVSSDL---DREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDR---------GTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVR--ILTRAEFDYEAKANKFFFELQAS---SGQLSSTVPVRIHVSDVNDNKPALK-----DFVILMNRFDNVQMARQIGFIPAFDPDQ--NATLEYFLEENDLIEAEKY----TGKILVKQEWKRNMDVS---FKTCVSDGANTECSTCRFIHV 1086          

HSP 3 Score: 142.51 bits (358), Expect = 1.013e-33
Identity = 161/682 (23.61%), Postives = 295/682 (43.26%), Query Frame = 1
Query:  589 LFKIDSK-GNLTTLTHIDRDDI-CIRLSCCKDSICTIKMTAVLIFPNSISYEII-LNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPN-RISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHE---TVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKIL 2613
            L  I++K G + T   +DR+ +  IRL    D I + K T     P   S  ++ + + D NDN P F S    + I E+  + ++     A D+D   NG   YS++  S     ++ ++   +TL + +D +   I  + +   +  +   S+++   + V D ND+ P  +                 +I ++EN  + +E+   +A+D D G N  I YS+   +          F I+   ++  I+    LD E        L + A D G P  + S ++ + L DINDN P   +K  N  ISE   R + +      D D      I+  + E  +  F +     D+ +   I+    E  R +    V++   D+   +     N  I   D+ ++ P +    + V + E S     +I + A D D     ++ ++I  +       F RID  +G++ +++ +DRE   +  +++ VT +    P  NT+       T++ + + DINDNSP++ S      I E++P+ +   ++  +D D  P+ +V   F+   S +     +     + T+ V ++L+RE    I L + A D G+P       +   + DVNDN+P  +    + +I       ST     +  I A D D G N+ ++++I 
Sbjct:  317 LLAINAKSGVIQTAAPLDRETLSLIRL----DVIASDKGT-----PKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAV-IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQK-------------MITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSE---------DFIID--EDSGLIKTTKLLDRETTARYS--LKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSIL----DIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFI---DDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS------QFFRIDPSSGDISVSSDLDRED--RATFSVIVTASDHASPPLNTS-------TQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDY-FLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGST-----VGTIVARDADEGDNADISFRIF 932          

HSP 4 Score: 132.109 bits (331), Expect = 1.259e-30
Identity = 158/637 (24.80%), Postives = 273/637 (42.86%), Query Frame = 1
Query:  892 YSLSDPSNTFN---YSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPN-RISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNRE-HKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKI---IAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYV 2778
            YS+  P ++ +   ++L      + L K +DRE ++ + L +  YE+     S S    V V D  DN P F               +S+   I+E+  +   + S  A D D GEN +I YS+   +      +  K  +        I+    LD E      I L ++A+D G P+R ++  + I ++D+NDN P     S N  I EN     V+     +D+D  +   +  +++  S        +      L   I     K+   T  +   D A+P L+ T    I + D ND+ P     +  + +EE     + + +V A D DS   G + +++  ++     +FI ID  +G +  T  +DRE   +  Y++ VT      P  NT+       T + + +KDINDN+P +  ++ +  I E +P  S +  L+ VD+DE     +T +  E++ + F  S    G     + V  EL R+ HK  + + + A D G  + R  VN+  +  DVN ++P     P +  IP        E + I   +  ++A+D D G N+ + Y I  S       FRI  +   ++     +      F + ++  D  +P L+T+    V
Sbjct:  199 YSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIF-------------EKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGV--------IQTAAPLDRETLS--LIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERID---AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSE-----DFI-IDEDSGLIKTTKLLDRETTAR--YSLKVTARDMGTPSLNTS-------TTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADREVF--SILDIGDQGAILSVSGELKRQDHK--VRVEISATDQGGLQGRCVVNVFID--DVN-SAPYFNDHPFSVKIP--------EHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQF-----FRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEV 772          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 144.05 bits (362), Expect = 3.442e-34
Identity = 168/685 (24.53%), Postives = 291/685 (42.48%), Query Frame = 1
Query:  739 IILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILV-ILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLK-FIESESQTFD--ESNYWFGIVNNTIFVKNELNREHK-NNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYV 2778
            + +N+ D ND+ PT ++   +I + E+  +        A+D+DS  NGI +YS+     + ++ +  +   +   K LDRET   Y+L +   +      + S    V + D NDN P F               + + + I E      +I +  A+DNDE  + KI Y I   D          FSI    +   I   L++  E + + H + V I ATD G  Q    V++ I+  D+N + P   +  P  +   +       +  +  +D    DN     S +S + F++     D+   +++   D E     +V +   D A P L  +T  ++ + D NDN PQ+T   Y   + E        ++V+A D+D    G + + + E+    +    R+D  +G + +++ +DRE+F  +V  I   D               S  +++T+ + D+NDN+P +        I EN P+ S V  +   D DE  +  ++ + F  ++++ FD  E     G+V   I  + E + E K N     LQA    S +  + V +   + DVNDN P LK      F+     F + +  + I  I A DPD   N+TL Y +  ++L     +    TG+IL   E    + +        + D      ST  + +V
Sbjct:  106 LTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME---GSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTF-------------DKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADR-------EVFSILDIGDQGAI---LSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFID--DVN-SAPYFNDH-PFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSGDISVSSDL---DREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDR---------GTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVR--ILTRAEFDYEAKANKFFFELQAS---SGQLSSTVPVRIHVSDVNDNKPALK-----DFVILMNRFDNVQMARQIGFIPAFDPDQ--NATLEYFLEENDLIEAEKY----TGKILVKQEWKRNMDVS---FKTCVSDGANTECSTCRFIHV 727          

HSP 2 Score: 140.198 bits (352), Expect = 4.030e-33
Identity = 145/627 (23.13%), Postives = 270/627 (43.06%), Query Frame = 1
Query:  745 LNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPN-RISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHE---TVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKIL 2613
            + + D NDN P F S    + I E+  + ++     A D+D   NG   YS++  S     ++ ++   +TL + +D +   I  + +   +  +   S+++   + V D ND+ P  +                 +I ++EN  + +E+   +A+D D G N  I YS+   +          F I+   ++  I+    LD E        L + A D G P  + S ++ + L DINDN P   +K  N  ISE   R + +      D D      I+  + E  +  F +     D+ +   I+    E  R +    V++   D+   +     N  I   D+ ++ P +    + V + E S     +I + A D D     ++ ++I  +       F RID  +G++ +++ +DRE   +  +++ VT +    P  NT+       T++ + + DINDNSP++ S      I E++P+ +   ++  +D D  P+ +V   F+   S +     +     + T+ V ++L+RE    I L + A D G+P       +   + DVNDN+P  +    + +I       ST     +  I A D D G N+ ++++I 
Sbjct:    4 ITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAV-IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQK-------------MITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSE---------DFIID--EDSGLIKTTKLLDRETTARYS--LKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSIL----DIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFI---DDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS------QFFRIDPSSGDISVSSDLDRED--RATFSVIVTASDHASPPLNTS-------TQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDY-FLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGST-----VGTIVARDADEGDNADISFRIF 573          

HSP 3 Score: 83.9593 bits (206), Expect = 7.063e-16
Identity = 74/281 (26.33%), Postives = 121/281 (43.06%), Query Frame = 1
Query: 1759 KIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSP----------ILKSPPNNSFIPNTELFASTEKNKIIAKIEADD 2571
            +I + D NDN P +    Y+V + E       I  V ATD D    GK+++++  +        + ID+  G V L   ID +  P +   I   D     P         S+   LTI++ DIND++P   + +    + EN+ I   V ++  +D+D  P+ ++      SE    DE +   G++  T      L+RE     +L++ A D G+P   T   +   + D+NDN+P          I +  P  S I   +   + E  KI  +IE  D
Sbjct:    3 EITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASS---SGIGGLTIDYSTGEVTLRERIDAKNSP-ITAVIRAKDG--AQP-------ALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDS---GLIKTTKL----LDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEAD 263          

HSP 4 Score: 76.2554 bits (186), Expect = 1.336e-13
Identity = 83/307 (27.04%), Postives = 134/307 (43.65%), Query Frame = 1
Query:  583 SDLFKID-SKGNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFN---YSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSE---TAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQI 1482
            S  F+ID S G+++  + +DR+D   R +     I T    A      S   E+IL+  D NDN P F S      I E   + + +    A+D D   NGI  Y L++ S++ +   + L      + +   LDRE   +  L ++  ++     S +    + +SD NDN P F  L+ D             +YI EN  +   + +  A D DEG+N+ I++ I              F IE  +E     +I  R   DYE +  +      L   +G  Q S++V + I++ D+NDN P +
Sbjct:  365 SQFFRIDPSSGDISVSSDLDRED---RAT--FSVIVTASDHASPPLNTSTQIEVILD--DINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYD-------------LYIAENSPVGSTVGTIVARDADEGDNADISFRIFG------GADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANK--FFFELQASSG--QLSSTVPVRIHVSDVNDNKPAL 641          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 114.775 bits (286), Expect = 2.612e-25
Identity = 161/757 (21.27%), Postives = 313/757 (41.35%), Query Frame = 1
Query:  583 SDLFKIDSK-GNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSL--SDPSNTFNYS--LIHNEPHMTLI--KPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQ-----ITEKSPNRISENDKRETVLKIFHVSDK------DLISKDNISCNLSEESKRKFKLTKHFWDVYNLN-NIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNK---IIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQK-TGEILTNWESYETLKIGIFYLHISIYDSGTPSL--STNVYFYV 2778
            S   K+D + G ++T+ H+D +                 + AV +  +  + +I++ + DENDN P+F   +  + I E A+L + + LP   D D P   + R+ +   + +N F  +   ++ +    L+    LDRE  + Y L +   +  +      L   +++ D NDN P F                 +   +  N ++   + +  A D D GENS+I+Y I  + S P N   + F+I   S++  I    +L   +  +    ++++A+D+G P  S+S  +TI +L    + P      + E +   + EN    +++    ++ +       LI    +    ++++     L     D    + + + F  EK     ++        P+L       + I D NDN PQW   + H+++      ++    + A D D  + G + +++ + ++      + ID + G +++  +ID     ++ + +   D     P  +T++       ++  D+ D     P++       +IPE+ PI + + K+  V ++    N    K I    Q  DE +     ++ T+ ++   + E + +    + A +  S    + +++  +  DVNDN PI        F PN       E  K    +  + A D D G    ++Y I    L+   SF I   TGE+       + L  G F+L +S  D G  S   S N++  V
Sbjct:   66 SKFLKVDERSGEISTIAHLDYE-----------KRSKFDIVAVKVEESGETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVF-------------SRSRYTASVSANISIGSHLITVQATDADIGENSRISYDI-KKTSAPSN---SNFAI---SQSGVITTTASLLPASTHD----VIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDGQIIIE-------HPQL-------LTIGDINDNAPQWHSSQIHISLNRTQGGSR---TLTAKDPDLGQNGWIRYSVLDTEL------VSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDG--GSPALSTDL-------QVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKV--VANNSQCGNS---KRIRYSLQNQDE-HLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSLISIRLK--DVNDNWPI--------FYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHI----LSESSSFSINPVTGEVFAQ----KPLARGRFHLVVSAKDGGGQSSENSANIHITV 731          

HSP 2 Score: 106.301 bits (264), Expect = 1.090e-22
Identity = 173/773 (22.38%), Postives = 307/773 (39.72%), Query Frame = 1
Query:  604 SKGNLTTLTHIDRD---DICIRLSCCKDSICTI-KMTAVLIFPNSI----SYEIILNIKDENDNRPTFVSPLTVI-------NIPESAELQSLYKLPMAVDKDSP-GNGIDRY----SLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSL-----------FFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSI-SSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQL---ICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVN--NTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKI-LHSNLTNKHSFRIQKTGEILTNWE---SYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNITSASS 2799
            ++G   TLT  D D   +  IR S     + +I K T  +  PN+I      EI   ++ E+   P   + L V+       + P   E ++L++  + + +D+P G  + +     S    S    YSL + + H+T+    D  +  +     + +EKQ+   +  +              +++ D NDN P F             Y   + + ++E     + +    A D D G   +++Y I S   S+  N VT +   + P    +  L                V+ A D G      S ++ I ++D +   PQ +        E    E +L    +     +SK   S   S +    F + +    +Y    +     +   H+TV L     +   E   TQ   F   I D NDN PQ++     +++ E    ++    V A+D D +K G++ ++I  +      + I ID   G +   + +D E        +  TD     P  ++N+T F       I + D+NDN+P +       ++ EN P  +IV K+   D D   +  +  +            + +FGI      ++ K  ++RE  +++ + + AED G P R +  +    +LDVNDN      PP+   I    + A +  +  I  I A DPD GLN ++ Y+  L S+L     F ++  G++    +   S E  +     L + + D G P  S   +  V I+  S+
Sbjct:  453 TQGGSRTLTAKDPDLGQNGWIRYSVLDTELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFE-KALWQ--VEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTV----DTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSLISIRLKDVNDNWPIF-------------YPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSINPVTGEVFAQKPLARGRFHL----------------VVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSK----YEIRTTEDILPGIAIGSVGAMSKVKYSI-YSGDQDHNFSIDEDTGKIYVTRYL-----DADVHDTVLLNIQATLPSGESNQTQVVIF---IEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISS---HPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDL--GIPPRSSNMTLF-------IHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNG--------SEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDN------PPSCLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQSSL-----FVVKSNGDVYLRRQLNASDERHQ----RLSVIVSDQGVPRKSVVCHVPVRISKGSA 1141          

HSP 3 Score: 92.4337 bits (228), Expect = 1.668e-18
Identity = 130/509 (25.54%), Postives = 218/509 (42.83%), Query Frame = 1
Query: 1294 KFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNR--ISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIP-----QWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLK-FIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQ-KTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNITSA 2793
            KFSI S + +  +   L LD E  +E H++++IL TD G   R+ S ++ + + D NDN PQ+   +P+   I+E+ +   VL  F  SD D+      S  L E+S     L     D+  L  +      K     ++L  +D   P L    N  +EI + N         ++ ++ Y   ++E     +FI K+        +   L ++I E +I   F+   +D + G +     +DRE   +  Y++ V           T   Q    T++ + + ++NDN P +P  K   ++PENL + S V  +   D D    N+  L+ F+ S+S     +++       TI +   L+ E     TL ++A D       TF NL   + D+NDN+P    P        T   A+    +  AKIEA D D      L Y +      +   FR+  ++G +          +   + + ++  D+G PS ST+V   V I  A
Sbjct: 1672 KFSINSTTGSISV---LPLDREASQE-HLLIIIL-TDGGS--RNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLEDSSGSLDLVPETGDLV-LRRLSSLQSWK-----IKLRVVDHGVPGLYVEKN--LEISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKLQP------ELAGLTYSIVEGNIDSAFS---VDSE-GVIRTNLELDREILER--YSLKV---------IGTGSGQ-QIGTRVDVRVNNLNDNVPSFPMSKPR-RVPENLRVGSYVATVGAKDVD----NLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDG---SFDTFTNLTIFVSDINDNAPTFSKP----LYQTTVSPATFSPGQPFAKIEAHDLDA--RGALTYSLGQG---SSSIFRVAPESGALFMKVLPPAGER---YLVTVTATDNGVPSFSTSVPVSVIIGEA 2123          

HSP 4 Score: 77.411 bits (189), Expect = 6.567e-14
Identity = 89/386 (23.06%), Postives = 156/386 (40.41%), Query Frame = 1
Query:  736 EIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSL--SDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDS 1887
            ++++ I+D NDN P F S L  I+I E  +L   + +  A DKD   NG  RYS+  S P ++        +  ++    LD E    Y L +   +      S+++   + V D NDN P F                 + + + EN      +    A D D  EN +I Y I++   Y        F I+   +   +  + ++D E     H+ + I+A D G P RS++ S  I++LD+NDN P     +P  +       T +      D D     N S     + +    + K   DVY    +   +    RH+ + +I  D+  P  +   +  + I   + +I      + ++ + +   +   +  +NAT   S
Sbjct:  822 QVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQ--LSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEF-------------EKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEY--------FGID--EKLGNVYTKRSIDREVIS--HVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLSTAIGTIVAMDPD--KGLNGSVLYRAQLQSSLFVVKSNGDVYLRRQL---NASDERHQRLSVIVSDQGVPRKSVVCHVPVRISKGSADIQIQEPFQKYIEIPKSCPTGCRLTTLNATGVSS 1175          

HSP 5 Score: 66.6254 bits (161), Expect = 1.377e-10
Identity = 159/743 (21.40%), Postives = 295/743 (39.70%), Query Frame = 1
Query:  592 FKIDSKGNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVIN-IPESAELQSLYKLPMAVDKD--SPGNGIDRYSLSDPSNT----FNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFK--IEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRE--RFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNT--IFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVN 2781
            F +DS+G + T   +DR+ I  R S        +K+         I   + + + + NDN P+F  P++    +PE+  + S      A D D  +P   +  + +SD S      FN        H+T   PLD E +  + L++   +     F+N   F   VSD NDN P F          P  +S              Q      A D D      + YS+    S       + F +    E+  + +++        ER+++ V  ATDNG P  S SV +++ + +         EK+  R    +  +  L+I ++S ++  S++        E+ + F + K F  ++      P D E+      Q + ID  E   +Q    K  + + DENDN+P +T   Y++++++     + I ++ A+D DS + G++ + I   +     N + ++   G++ L    D +   FP   + I V      HP           K ++++ +   + ++P +        + E+  + ++++K+         SN + ++  +    +  E     GI   T  + +K  L+ E +  I++ L   D     R   V L   +  V++ +P+         IP      ST   + + +++A D D G++  + Y I     T K     + TG I           + I  + +  Y S T    T VY  + 
Sbjct: 1874 FSVDSEGVIRTNLELDRE-ILERYS--------LKVIGTG-SGQQIGTRVDVRVNNLNDNVPSF--PMSKPRRVPENLRVGSYVATVGAKDVDNLAP---LRYFLVSDSSGQTPTHFNIDQFTGTIHLT--APLDFEVLPEHTLTIKATDGSFDTFTNLTIF---VSDINDNAPTFSKPLYQTTVSPATFSPG------------QPFAKIEAHDLDA--RGALTYSLGQGSS-------SIFRVAP--ESGALFMKV---LPPAGERYLVTVT-ATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGEE--SREFHYRIQDPEASKIFSIDK-FGRLFVAG---PIDREQRATHEFQ-VEIDN-EMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGN---DLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHP-----ARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIR-------ASNRLGMRN-DGLLYSLKEHQGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSDGNG--RSAVVPLKIVVEPVDEFAPVFTKSSYTLQIP-----ISTPAGESVGQMQAIDEDGGVHGVVKYSISDRQSTVKIE---EHTGIIRLQKPLVSRRNLTIEQITVVAYSSPTKQSKTTVYLEIG 2535          

HSP 6 Score: 65.0846 bits (157), Expect = 3.692e-10
Identity = 146/622 (23.47%), Postives = 256/622 (41.16%), Query Frame = 1
Query:  952 MTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKS--PNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNII----PFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPEN-LPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNT--IFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRI-QKTGEILTN-WESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNI 2784
            + L   LDRET   ++L  ++ EK  Q+        + + D NDN P +                S  I+I  N+T      +  A D D G+N  I YS+         + T   SI+   ET +I +   +D     E  I   + A D G P  S  + +  +LLD     PQ  EK+     I E+    T L          +  +N  C  S+  +   +       V  ++  +     FD+EK +     +I  + A  E T T+   I + D NDN P +   EYH+ V E     + ++ V+A+D DS  FG++ ++I    + ++ +F  I+   G V+    + R RF  LV  ++  D   +  + + NI          I + D +  +P++   K   +  E+ LP  +I              +V  +  ++    + D+ ++ F I  +T  I+V   L+ +  + + L +QA        +T V +  E  D NDN P       +S +    +    + ++    ++A D D   N  + Y I+ S+  +  S  I Q TG++ T     YE  +   + L +   D G P  S+N+  ++++
Sbjct:  395 LLLCGILDRETASEHHLK-FLLEKDGQIIIEHPQL-LTIGDINDNAPQW---------------HSSQIHISLNRTQGGS-RTLTAKDPDLGQNGWIRYSV---------LDTELVSIDK--ETGRIFVPNTIDCNIGSE--IKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQF-EKALWQVEIPEDTPIGTCLV--------KVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATN-ANSE-TSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHI----LSESSSF-SINPVTGEVFAQKPLARGRF-HLV--VSAKDGGGQSSENSANI---------HITVIDKDTKTPQFSRSKYEIRTTEDILPGIAI-------------GSVGAMSKVKYSIYSGDQ-DHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQTQVVIFIE--DHNDNPPQF-----SSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGS--SIEIDQFTGQLSTGSLLDYEATR--NYKLRVKATDLGIPPRSSNMTLFIHV 932          

HSP 7 Score: 61.2326 bits (147), Expect = 5.252e-9
Identity = 117/538 (21.75%), Postives = 214/538 (39.78%), Query Frame = 1
Query: 1276 PNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPN-RISENDKRETVLKIFHVSDKD---------LISKDNISCNLSEESKRKF------------KLTKHFWDVYNLNNIIPFDYEKSRHETVQLI-CIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPR----YPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESES---QTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEIL---DVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLT--NKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNI 2784
            P+  T+KF ++    + +I    +LDYE + +  I+ V +       +   ++ + + + D NDN P   ++     ISE  +  T   +  V+D D         +I + N++ N+ + + RK             +L + F D Y L                 LI   D  +P         IEI D NDN P +++  Y  +V    +    +I V ATD+D  +  ++ ++I +   P   NF     Q+G +  T S+     P   +++ V  +    P         S+   +TI +     +SP     +  +     + EN  + SIV ++      +Y      L+ I S +   Q  D+++ +       + +   L+RE  +   L+   E +G       +  H ++L   D+NDN+P   S   +  +  T+  + T        + A DPD G N  + Y +L + L   +K + RI     I  N  S            +   D G+P+LST++    ++
Sbjct:   61 PDEQTSKF-LKVDERSGEISTIAHLDYEKRSKFDIVAVKVE------ESGETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVN-NVFKLASRKVNEQLQADLVVNGQLDREFRDKYEL-----------------LIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAI--SQSGVITTTASL----LPASTHDVIVVASDHGSP-------SLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIA--QQYRDT--KLRLIGSSALCPQQTDQAHVYL------LLLCGILDRETASEHHLKFLLEKDGQ-----IIIEHPQLLTIGDINDNAPQWHSSQIHISLNRTQGGSRT--------LTAKDPDLGQNGWIRYSVLDTELVSIDKETGRIFVPNTIDCNIGSE-------IKFRVRAEDGGSPALSTDLQVVADL 530          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 110.923 bits (276), Expect = 4.608e-24
Identity = 165/685 (24.09%), Postives = 295/685 (43.07%), Query Frame = 1
Query:  760 ENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTL-----IKPLDRETIEIYNLSLYV--YEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQ-ITEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFD--ENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGK---LYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNV---VTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNW-----ESYETLKIGIFYLHISIYDSGTPS 2751
            EN + P F S   ++ + E A + ++     A D+D+  NG  RY + D + + +  L  +E    +     +  L +E +E+ ++ L V   +    + S+    ++++ D N++ P F  +             S+ + I EN+   ++I+   A D D G N KI +S+ +         ++  SI+  ++T  ++L  +LD E+Q+       I+A+D G P R +  +LTI++ D+NDN P+ + + S  RI E+      +      D+D+     +   L+ E K  F++  H   ++      P DY K+    + +   D  +P L+ + +  +E+ D   N    ++       +V E S     +I + A ++  E+  K   L + I   D    F+   ID Q G V  T  +DRE   +  Y ITV +  D   D   +  +  +   + I I D ND+ P          + EN P N ++ K+E  D D+  ++    +  K    + Q+F   +   G +  +   +  L+RE ++   L +   D G P+  + V +   +LD NDNSP      ++  + +   FA       + +I A D D G N+ L Y I   +      F I   G I+ +      ESY         L +   D GTP 
Sbjct:  601 ENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEV-------------SYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEK-----SSVISID--AKTGIVKLLKSLDREDQDVH--TFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNSE-KVPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPHFS---ID-QKGTVRTTHLLDRET--KSAYWITV-EARDSKTDLYKD-PRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSFFRIDLTSGYITTSGIRR--LDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFTQAIHHYSVRSK--FAGK-----LCRIFAVDADEGENARLTYNITEGDA----RFSIDNNGNIIASEAIHGDESYA--------LTVQATDHGTPG 1233          

HSP 2 Score: 92.4337 bits (228), Expect = 1.890e-18
Identity = 168/725 (23.17%), Postives = 296/725 (40.83%), Query Frame = 1
Query:  736 EIILNIKDENDNRPTFVSPL---TVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDR-----ETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHII---LVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPN-RISENDKRETVLKIFHVSDKDLISKDNISCNLS----EESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTS---IDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIES-ESQTFDESNYWFGIVNN------------TIFVKNELNREHKNNITLRLQAEDNGS-----PKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNST---LNYKILHSNLTNKHSFRIQKTGEILT--NWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNI 2784
            ++ + I D ND+ P F +     T I I +  ++  L K+  A D+D   NG   Y  +   +     +  N   +TL++   +      T+   +L L +    R    N +F++         KP  +   S+ K+ P+  S   ++ + E+  +   +    A D D G N  I Y I         V+T         ++ +I +  +L    +E+  ++   L + A D G P +S+  ++ + + D+N++ PQ  E S   RISEN+K      IF V+  D    +N     S    +E      +      V  L ++   D E     T  +I  D+  P     TN  I + D NDN P+   +     + E      F+  + A D D  +  KL F +    +P      RIDH +G +++      +D  + P    +I V D+ D  P  +T+         L +++ DI  N         H  I      + + ++    ++ E  + V+ ++  E+ + Q     N  + I+              T+   + L+RE K+   + ++A D+ +     P+RR  +++   ILD ND+ P+ K P    +I +  +  ++  N +I K+EA D D   N     L +KI   +   +  FRI  T   +T       +  K     L +SI D G P L +NV   VN+
Sbjct:  477 DVSIEILDSNDHAPVFSAKWMRQTPIVIGKPGDV--LVKVD-ATDQDEGENGKIVYKFT---SELPLEINANTGEITLVEVPKKGNSWPATVWAIDLGLPL---SRMSALNLMFYKNGTKIPAKPKPIIIQ-ESENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVD------EQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGK--DIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSL---DREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNSEKVP-----FRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGD--PILSTS-------CHLHVELVDIAHN---------HLAIE----FDDVAKEASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPHFSIDQKGTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKP---MYIAS--VAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGD--PQSFFRIDLTSGYITTSGIRRLDREKQSEHELWVSICDGGEPQLCSNVIVIVNV 1146          

HSP 3 Score: 84.7297 bits (208), Expect = 4.027e-16
Identity = 118/526 (22.43%), Postives = 215/526 (40.87%), Query Frame = 1
Query:  739 IILNIKDENDNRPTFVSPLTVI----NIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQI-TEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNII---PFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSN-VVTLKFIESESQT 2289
            I + I++ NDNRP  +  L  +    N+P S + +      +A D D   + I    + D    F    I+    +T++KPLD E +  +NL++   + +   F +     V V D NDN P F                ++ + + E++++  E+  F A   D+  N  I Y +       P+ VT+  ++ +  +T  + L   LD+E      + L ++A D+G P       + I+++D NDN P+   EK   ++ EN K    +      D D      +S  L   S+         + + +  +++     DYEK +   +++I  D   P L      +I + DEND+ P +        V+E       ++K + +D D  K G  +    + D  K+F        N  + L T+   E   +  Y +TV            ++   +    LTI I+  + ++P     K      +N     I+ +L+  D+DE   N ++    +E   Q+
Sbjct: 2997 ITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDADF--DEIKFRMVDDFGGLFQIDDINGV--VTVVKPLDSEILGFFNLTVVASDGE---FEDKATILVTVIDQNDNAPTF-------------EKSTYSMKVMESESIGYELAHFRASGGDQ--NETIEYYLK------PSDVTSFVNLNA--QTGILTLAKPLDFETLSA--LKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIGHRLLKFSVSDLDGPKNGAPFTVEIQGDGAKSFKV------NEKLELLTAKKLEYRKKDKYLLTV---------IAKDVKGKTTDCPLTIFIRQTSRHAPTMKPMKIQINTLQNELPEGIIGRLKASDEDEEDQNGLLRFGLVEGSIQS 3475          

HSP 4 Score: 82.4185 bits (202), Expect = 2.155e-15
Identity = 136/606 (22.44%), Postives = 257/606 (42.41%), Query Frame = 1
Query:  736 EIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDR------YSLSDPSNT-FNYSLIHNEPHMTLIKPLDRE------TIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSES-FVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQ-ITEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNII----PFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNIT----EADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFD--ESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEIL--DVNDNSP 2472
            E I+ I+D ND  P F+       I +SA       +  A D D+  N +D       Y + D   T FN S    E  ++L +P++++      T ++ N+S+        MF+      V++      +P            P  + +S +V    EN  +++      A+   +G    + +S++   S   +     + +    +T +I +   L+Y ++++R+ I +++    G   R A  +LT++++DIND  P  +       ISE+ K    + +   +D D    D I  +L + S+ +F      + V+     I      +++     ++ +   D A P    TT  ++ I  E+  +P+++   Y  +V E ++    I +V   +++     ++ F I     E+D   +F    ++   G + + +S+DRER  Q    I        H             T +T+DI D+NDN+P +      F I E+  + + V     +D D+ PS  +    +E E+  FD  E++ W       + V ++L+RE  ++  L  +A D G        +L F I+  DVND+ P
Sbjct: 2270 EFIVLIEDVNDEMPEFIRSDVSAKISDSAITGQFITIMSATDMDTT-NSLDEESQKLLYKIVDGDETLFNISPATGE--LSLARPVEQDDLVNEDTKKVLNVSV-----TDGMFTAYAKLVVEILRSGSMQP------------PPRFEQSHYVANALENTIVNKSALLTVAV---KGGVPPLQFSLAPTTSSNSSTSKEAWPVAIDRKTGRIHVSRVLNY-HRDKRYQIPLVVEDATG---RRAFSTLTLSVIDINDKPPFFVLPFYSTSISESAKEGDTVMMVSATDDD--ENDTIEYSLLDGSESQF------FSVHPRQGTITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRFSNSHYLFSVMEDADVGNVIGRVQQMETE---IDEIRFTIVPGSEESD---SFLPFSVERSTGKIIVKSSLDRERKNQWKMTIRADAAGGVHA-----------ITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVE-ENPYFDLNENSGW-------LTVASQLDREKIDHYKLIARATDEGGFN----TDLPFTIVVSDVNDSPP 2811          

HSP 5 Score: 68.5514 bits (166), Expect = 4.010e-11
Identity = 121/598 (20.23%), Postives = 237/598 (39.63%), Query Frame = 1
Query:  739 IILNIKDENDNRPTFVSPLTVINIPESA-------ELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERH----IILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEI-------FDENDNI----------PQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGK--LYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHF 2442
            + + I D ND+RP    P+ + ++ E++       ++++     +  D  +P   + +    DP + F   L       + I+ LDRE    + L + + +       +++   V V D+NDN P F                  + +       + ++    A+D DEGEN+++ Y+I+  D+        +FSI++           N +    E  H      L + ATD+G P +  + +  +   +     P+ ++ SP  IS   K + V+ I   SD D +         S+    +      +W + + +    FD    R +T QL+   K E  L +    ++ I       +D +  I          P+++   Y  +V E       I  + A+    E  G   L FN+   D     + IR++  +GNV +   +D E   ++   + V            N+  F+     +++I D NDNSP +        + E+  ++ ++  +   D D   + +VT   +    ++  + +   G V     +  EL  +H  +I LR++A D+ +   +  ++LH 
Sbjct: 1032 VFIRILDRNDHRPVAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPL--MFKIERGDPQSFFRIDLTSGYITTSGIRRLDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFTQA---------------IHHYSVRSKFAGKLCRIFAVDADEGENARLTYNITEGDA--------RFSIDN-----------NGNIIASEAIHGDESYALTVQATDHGTPGQQFAATRVVLTANSAGQKPRKSKNSPPEIS-GKKSDYVIPI---SDADQVGLTVGKLEASDADGDEL-----WWSISSGDPDSVFDV---RQDTGQLLLAKKVE--LLKRGELRLNISVTDGQAWDHSTVIIQVSRQISQRPKFSASHYQTDVSERVAVGTQIYTLKAS---GESLGTKPLVFNLFSVDDVAMEDKIRVEPSSGNVIVMEPLDYEAARRIRAVVQVQ---------QANMKSFAT---FSVNINDENDNSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIVSGNEESLFKIDAKSGEVRLAKPLDPEL--QHVESI-LRIRAIDSAANSLKDEMSLHI 1561          

HSP 6 Score: 67.781 bits (164), Expect = 5.477e-11
Identity = 78/360 (21.67%), Postives = 146/360 (40.56%), Query Frame = 1
Query: 1438 LTINLLDINDNFPQITEK------SPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNI-------IPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKF-IESESQTFDESNYWFGI-VNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSP 2472
            +T+ + ++NDN P+I EK        N  +  D R+ + +I    D D    D I          KF++   F  ++ +++I        P D E      + ++  D    E        + + D+NDN P + +  Y + V E  +    +    A+  D  +  + Y   ++       +F+ ++ Q G + L   +D E    L   +   D         + +     + ++ I + D NDN+P++  +K   K+ EN      V  ++ +D D      V+ +  I SE+ T D     F I  N  + +   ++ E      L++ A+D G P  R+   L   + D ND++P
Sbjct: 2997 ITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIV-AEDADF---DEI----------KFRMVDDFGGLFQIDDINGVVTVVKPLDSEILGFFNLTVVASDG---EFEDKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQNETIEYYLKPSDVT-----SFVNLNAQTGILTLAKPLDFETLSALKLTVVAKD---------SGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTT-DTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAP 3324          

HSP 7 Score: 64.6994 bits (156), Expect = 5.457e-10
Identity = 124/516 (24.03%), Postives = 204/516 (39.53%), Query Frame = 1
Query:  529 ENSQNTKISFNNVVLRSYSDLFKIDSK-GNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSISYE-IILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYS------LIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSK---IAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGK-----PQRSASVSLTINLLDINDNFPQITEKSP---NRISENDKRETVLKIFHVSDKDLISKDNISCNL------SEESKRKFKLTKHFWDVYNLNNIIPFDYEK-SRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSI 1998
            +   N KI F+    +  S +  ID+K G +  L  +DR+D        +D      + +   FP  +S   + ++++D NDN P  V   +   IPE     +      A D+D   N   ++ L+     F          IH   +     PLD      +NLS+ V +    + S S    V++ D   N      L  +F  +    S      + EN  +  E+    A +  + +  K   + Y I   D +P       FSI+   +   +R    LD E +    I   + A D+       P+R   + + I +LD ND+ P    K P     ++EN     V+     +D D +  D  +  +        +S  +  LT  +      + I   D EK S HE    IC D  EP+L       + + DENDN P +TQ  +H +V   S     + ++ A D+D  +  +L +NITE D   + +       NGN+  + +I
Sbjct:  748 DGGNNGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSLDRED--------QDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNSEKVPFRIDHHSGCIFIHAPEY-----PLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNH-----LAIEFDDVAKEAS------VYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWP------HFSID---QKGTVRTTHLLDRETKSAYWI--TVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRP--VAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSFFRIDLTSGY---ITTSGIRRLDREKQSEHELWVSIC-DGGEPQLCSNVIVIVNVLDENDNSPTFTQAIHHYSVR--SKFAGKLCRIFAVDADEGENARLTYNITEGDARFSID------NNGNIIASEAI 1214          

HSP 8 Score: 58.151 bits (139), Expect = 5.414e-8
Identity = 89/390 (22.82%), Postives = 154/390 (39.49%), Query Frame = 1
Query: 1672 FDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDS-----EKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERF----PQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEK---LEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNT--IFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGI-FYLHISIYDSGTPSLSTNVYFYVNITSAS 2796
             DYEK++   ++L+     + +++    F + I D ND +P++ + +    + + + + +FI  ++ATD D+     E+  KL + I + D    FN   I    G + L   ++++       + V N++VTD              F+   KL ++I       P    +++H+    N   N+IV K   L        P    +L    S + +  +  +   I   T  I V   LN        + L  ED  +  RR F  L   ++D+ND  P    P       +T +  S ++   +  + A D D   N T+ Y +L    +    F +      +T  +  E  K G+   L I   DS  P         VNI S S
Sbjct: 2244 LDYEKTQKYDLKLVATSSGK-QVSSEAEFIVLIEDVNDEMPEFIRSDVSAKISDSAITGQFITIMSATDMDTTNSLDEESQKLLYKIVDGD-ETLFN---ISPATGELSLARPVEQDDLVNEDTKKVLNVSVTDGM------------FTAYAKLVVEILRSGSMQPPPRFEQSHYV--ANALENTIVNKSALLTVAVKGGVPPLQFSLAPTTSSNSSTSKEAWPVAIDRKTGRIHVSRVLNYHRDKRYQIPLVVED--ATGRRAFSTLTLSVIDINDKPPFFVLP-----FYSTSISESAKEGDTVMMVSATDDDE--NDTIEYSLLDG--SESQFFSVHPRQGTITVAKKLEH-KAGVTLSLTIKATDSANPPHHATTTVEVNIASES 2602          

HSP 9 Score: 54.299 bits (129), Expect = 8.563e-7
Identity = 149/633 (23.54%), Postives = 260/633 (41.07%), Query Frame = 1
Query:  739 IILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSI----SSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQI-TEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKH-FWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADI-PKTFN--FIRIDHQNGNVYLTTSID-RERFPQLV-----YNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITL---RLQAEDNGSPKRRTFVNLHFEILDVNDNSP-ILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDY 2580
            + L++ D ND  P FV P    +I ESA+      +  A D D   N    YSL D S +  +S+   +  +T+ K L+ +     +L++   +        +   +V ++ ++   P F              +  ++  + E+  +   I     +   E E  +I ++I       DS+ P      FS+E    T KI ++ +LD E + +    + I A   G     A  ++T+++ D+NDN P    +     ISE+    T + IF   D+D      I  +L EE+   F L ++  W    L      D EK  H   +LI     E        F I + D ND+ PQ+ ++E+++++   S S                   L+F+I + D+ P   +  FI   ++ G  ++ ++ D   + P++V     Y + VT  FD           F   TK+ I++K   D+  R P       + EN    ++V     + +       VT K  +++   F   N+  GIV     VK     +++ N  L   RL  +DN S   +  + +  E  ++NDN P I++     S   N  L  S +  + I +I A+D D+
Sbjct: 2491 LTLSVIDINDKPPFFVLPFYSTSISESAKEGDTVMMVSATDDDE--NDTIEYSLLDGSESQFFSVHPRQGTITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRF-------------SNSHYLFSVMEDADVGNVIGRVQQM---ETEIDEIRFTIVPGSEESDSFLP------FSVER--STGKIIVKSSLDRERKNQWK--MTIRADAAGGVH--AITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEENPY-FDLNENSGW----LTVASQLDREKIDH--YKLIARATDEGGFNTDLPFTIVVSDVNDSPPQFEKEEFNIDLHLPSTSP-----------------ILHFSIKDDDLSPNNVSQFFIPKGNEEGVFWIDSNNDLLLKRPEIVENKMQYQLKVT-AFD---------GVFETSTKVKINLKSSKDSDIRCPEANKTVILAENSKKGTVV-----LGESSLLGPNVTFKLSDNDGNVF-VVNFRNGIVK----VKESDQIDYEKNQQLEFHRLTIQDN-SEVCKELITVVIE--NLNDNRPKIIEKLLKVSIDEN--LPTSEDARQYITRIVAEDADF 3044          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 103.219 bits (256), Expect = 1.050e-21
Identity = 163/729 (22.36%), Postives = 303/729 (41.56%), Query Frame = 1
Query:  736 EIILNIKDENDNRPTFVSPLTVINIPESAEL-QSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIE----IYNLSLYVYEKQRQM-FSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGK----PQRSAS--VSLTINLLDINDNFPQITEKSP----NRISENDKR---ETVLKIFHVSDKDLISKDNISCNL---SEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFN---------FIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQ-FSNKTKLTIDIKDINDNSPRY---PSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIES-------ESQ-----TFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGS--PKRRTFVNLHFEILDVNDNSP-----ILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKIL-HSNLTNKHSFRIQK-TGEILTNWESYETLKIGIFYLHISIYDSGTPSL 2754
            ++ + I D NDN PTF  PL    + E   L Q++ K+  AVDKD+  N    YS+    +  N+S+  N      ++ LD + +     +Y  ++   +    +  S+S    ++  + ND    F+             +  +  ++ E+      +    A D D  E   + YS   ++      +   FSI+  +   K+R  ++     + E  I L ++  D+G     P ++ +   +L I + D+N+N P+  + +      +I E   +    T++K+   +D D  +  +I  +L     ES++ F + +    V   +  + FD E    E V +   D+ +  L     F +E+ D NDN PQ+ +  Y  +V         +I V A D+D+    ++ +++   +I  T           F  ++ ++G + L   I   +  + ++N+   DN          I +   +  ++T+++ D    +P++   P  K    + EN+ +N ++ +   V   +  ++ V  K   S       ES+      F+  N W  +V     +   L+ E  NN TL L A D  S     +TFV    E+ DVND  P     +     +    PN  L  +  K  +  K    D D G  + ++Y+I+  +N      FRI + TGEI  N E ++  KI ++ L +   D    +L
Sbjct:  627 DLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKV-TAVDKDTGDNSRITYSV----DNHNFSINSNGEISAKVR-LDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLP------------TSQYTAFVAEDAQGGTPVIQIQARDADRDE---VTYSFMDKNGRSTQKMNL-FSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKV-EATDDDSSANGDIVYSLYYTQSESRKAFVIDRQT-GVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSL---EIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPM-KTQKFIFNVIADDN---------GIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVV-----IMEGLDYEQVNNYTLTLTATDMTSRVASTKTFV---VEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSD-GPQNEVHYRIVGEANGEETKHFRIDELTGEIFPN-EKFDREKIDMYILTVEASDRSVSAL 1308          

HSP 2 Score: 93.5893 bits (231), Expect = 8.204e-19
Identity = 131/556 (23.56%), Postives = 235/556 (42.27%), Query Frame = 1
Query:  952 MTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFV----TLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDND-EGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATD---------NGKPQRSASVSLTINLLDINDNFPQITE-KSPNRISENDKRETVLKIFHVSDKDLISKDNISCNL--SEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNV-EECSNSNKFIIKVNATDSDS-EKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRE---RFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKL-EFVDDDEYPSNVVTLKFIESESQTFDE-----SNYWFGIVNN----------------TIFVKNELNRE--HKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILK 2481
            + +++ LD E +  Y L+L   +   ++ S   F  V+V D ND  P F     T   D +  P  + E         +T  + I +  A+D D +G  +++ Y I    +      T  F I+  +      +  N  ++ ++    IL + A+D         NG  + +  V + IN  D+NDN P   E K   R+ E++       +  +   DL    N+  +L  +   +  F +      ++      P D+E S    + LI  D        TTN  I I D NDN PQ+ Q++Y   V EE  +  K +  V+ATD+D  EK  ++ + +      + F   RI   +G + L  ++DR+     P   + +   D      D    +  +++   + ++++DINDNSP +P                  E+L  +++++  P +   + F++ +++ FD+     +N  +GIV N                 IF    L+RE   +    + ++A D G P R  F N+  ++ D+NDN+P  +
Sbjct: 1164 VVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFV-VEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLE---------KTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEAN---GEETKHFRIDELTG----EIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVIN--DVNDNAPSFEEQKYIGRVKESEGEGH--DVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKE---PLDFEASDQYHLVLIASDGRH---NATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVF---RIGKYSGTIELVKALDRDPPAGVPSWNFVVQAID------DDGNGLVGYAD---VQVNVRDINDNSPIFP------------------ERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFE 1662          

HSP 3 Score: 73.559 bits (179), Expect = 9.818e-13
Identity = 106/432 (24.54%), Postives = 165/432 (38.19%), Query Frame = 1
Query:  952 MTLIKPLDRE---TIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQ--TLSQEIY--SFHALDNDE--GENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITE-KSPNRISENDKRETVLKIFHVSDKDLISKDNI-SCNLSEESKRKFKLT---KHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSI 2205
            + L+K LDR+    +  +N  +   +            QV V D NDN P F               E    YI+EN+    S  +Y     A D D+   EN+ I Y I         ++  +        T KI    +LD E   ER  I+ + A D G P R    ++TI + D+NDN P   + +    + E       +  F   D D  +KDN+ +  LSEES   +  T        V  L    P DYE         + I  ++          + + D ND+ P       H  V E       I +  ATD D+    +   N  ++D  + F       Q+G + +  ++DRE     VYN+ +        D + NI     +  + + ++D+NDN P   +        EN P+N +
Sbjct: 1495 IELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIF--------------PERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRN-----KLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATEH-RVREDVPRGTSIGRYTATDRDAGDTARFRIN-RQSDPKRQFTI----DQDGTLRVAHTLDREDI--AVYNLII-----EAYDNSNNI----GRQMVAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQL 1890          

HSP 4 Score: 65.855 bits (159), Expect = 2.539e-10
Identity = 135/646 (20.90%), Postives = 257/646 (39.78%), Query Frame = 1
Query:  592 FKIDS-KGNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPES-AELQSLYKLPMAVDKDSPGNGIDRYSL-SDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGE-NSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRISENDKRETV----LKIFHVSDKDLISKDNISCNLSEESKRK--------FKLTKHFWDVYNLNNIIPFDYEKS--RHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLY-FNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSP 2472
            F+ID   G +      DR+ I + +   + S  ++        PN  + ++ + I D NDN P+F     +  + ES  E   +  +  A D D   N   RY L         + +  +   + + +PLD E  + Y+L L   + +    +N     + + D NDN P F       KY            I+E+  + + +++ HA D D+ E +S+I Y +  + +         F I   S T ++   L+ D          +V    D+G         + +N+ DINDN P   E+    I EN  RE +    +    V  +D       + N+     R         F++ ++   ++ + ++   D E S  R   +++   D+  P      N  I++ D NDN P + +  Y  +VEE +     ++  +A D+D E    ++ + ++E       ++  +     +   +  + R + P    ++T  D F  H     +  +   +  + + + D ND++P       H ++ E++P  + + +    D D   +    +       + F          + T+ V + L+RE      L ++A DN +   R  V ++ +  DVNDN P
Sbjct: 1271 FRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITI-KAHDLDKHSN--LRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTN---VYIHIEDVNDNAPQF----EQQKYA--------TTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGA------DEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGN-GLVGYADVQVNVRDINDNSPIFPERLFGYIEEN--REPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSL---DREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEES-----DYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGF--HLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATEH-RVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQ------DGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVAVYLQ--DVNDNGP 1870          

HSP 5 Score: 52.373 bits (124), Expect = 2.517e-6
Identity = 74/285 (25.96%), Postives = 123/285 (43.16%), Query Frame = 1
Query: 1792 PQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNIT---EADIPK-TFNFIRIDHQNGNVYLTTSIDRE--RFPQLVYNITVT---DNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGI-VNNTIFVK-----NELNREH---KNNITLRLQAEDNGSP-KRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFA----STEKNKIIAKIEADDPD 2577
            PQ+ ++EY V V E +  +  ++ V A    S + G+    IT   E D P+    + RID   G ++LT  +D +    P+L + + VT   DN + H D             LTI I D+NDN P +       ++ E++P+N  + K+  VD D   ++ +          T+   N+ F I  N  I  K     ++LN  H   + N+T R    D+G P    +   +H    + ND S +        F+P ++  A      +    + +I+A D D
Sbjct:  528 PQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKL-HKLKVTAREDNRESHVD-------------LTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRI----------TYSVDNHNFSINSNGEISAKVRLDADQLNERHFVYRFNVTAR----DHGEPVSLSSSAMIHIRTENTNDESAV--------FLPTSQYTAFVAEDAQGGTPVIQIQARDAD 776          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304900)

HSP 1 Score: 177.178 bits (448), Expect = 2.974e-44
Identity = 201/787 (25.54%), Postives = 339/787 (43.07%), Query Frame = 1
Query:  520 LQSENSQNTKISFNNVVL---RSYSDLFKIDSK-GNLTTLTHIDRDDICI---RLSCCKDSICTIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEP---------HMTLIKPLDRETIEIYNL-----SLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQE---IYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQI-TEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLT---KHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLT--TSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESN-YWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKT-GEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNI 2784
            +++ + +++ + ++ V L   RS S LFK+DS+ G +TT   +DR+ + +   R+    DS            P S +  + +N+ D ND+ PTF +     +I E A + S      A D+D   N    Y +   ++    +     P          ++    LDRET + Y+L      L   + +R+  + S+  QVKV DDNDN P F                ++ + + E+Q    E   +    A D D+G N+ I Y+I   ++       ++FSI+S S    + L   LDYE+   R   LVI A D G P RS +  L +N++D NDN P+  T +    + EN      +      D D  +   I+ ++SE     F L    +  W    +  I P D E+      Q++  D   P  + +++  I + D NDN P +  K Y  NV E       +  V ATD D +   +L++ IT  +    F    I  QNG   +T   S+D ++  + +  +  TD+  R           S+   + I+I D N+ +P + +      + E+ P+ + V  +   D D   +  +T    E         + +        I     L+RE  +   L + A+D G+P      ++   + DVNDN+P  KSP   + I    L  ++     + ++ A DPD GLN  + Y +   ++ +  SF I  T G I TN +  +   + +F+L     D G+P LS+ V   + +
Sbjct:  381 VRARDPEDSPVVYSMVSLLDSRSQS-LFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSF----------PPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASV--QVKVLDDNDNYPQFS-------------ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNT------QSQFSIDSMS--GDVSLVKPLDYESV--RSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDD-NFPLAVDPRTGW----VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS--RLHYEITTGNTRGRFA---ITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGR-----------SDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTS-----VIQVAASDPDVGLNGRIKYLLSDRDIEDG-SFVIDPTSGTIRTN-KGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRL 1103          

HSP 2 Score: 155.992 bits (393), Expect = 9.208e-38
Identity = 174/677 (25.70%), Postives = 302/677 (44.61%), Query Frame = 1
Query:  736 EIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRIS--ENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNII---PFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNN------TIFVKNELNREH-KNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPN--TELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEIL-----TNWESYETLKIGI 2709
            ++++N+ D NDN P F +     ++ E+  +        A D D   N    YS+S+  + F  ++      +  IKPLDRE    +   +   +      S S    + V D NDN P F     + KY   N        + E+Q     + +  A D DE  +S++ Y I++ ++        +F+I S +    I +  +LDY  ++E+  +L + ATD+G   RS + ++ IN+ D N NF  I E +P   S  E+    T + +   +D D+     I+ +L+EES         F        I+   P D E +    + +   D   P L+ TT+ +I + D NDN P +    Y  ++ E +     +I+V A+D D    G++ + +++ DI +  +F+ ID  +G +     +DRE     V+++T        P  ++ +       ++ I ++D+ND+ P + S K    +PEN P+ S+V ++   D DE  + VV    I       D+SN  F +V         +    EL+ E  +    L ++A    SP  R   ++   + DVNDN+P+L+   +   I N   + F S E    I +I A D D  ++  L+Y+IL  N  N         G +L     TN   + T+++ +
Sbjct:  674 QLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF-----NPKYYEAN--------VGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNT------RGRFAITSQNGRGLITIAQSLDY--KQEKRFLLTVAATDSGG--RSDTATVHINITDAN-NFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDI-EDGSFV-IDPTSGTIRTNKGLDRESV--AVFHLTAIAVDKGSPPLSSTV-------EVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGG-----DDSNA-FSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVLR---DFQVIFNNFRDHFPSGE----IGRIPAFDAD--VSDKLHYRILSGNNANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSV 1295          

HSP 3 Score: 141.739 bits (356), Expect = 2.028e-33
Identity = 146/628 (23.25%), Postives = 259/628 (41.24%), Query Frame = 1
Query:  970 LDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSI----ESP-----SETAKIRLRLNLDYENQEERHIILVILATDNGKPQ---RSASVSLTINLLDINDNFPQITEKSPNRISENDKRETVL--KIFHVSDKDLISKDNISCN---LSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNF-IRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHS---FRI-QKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNIT 2787
            LDRE ++++   +   +      S +   QV V D ND+ P F              +E F   I+E  T+   + +  A D D G+N++I Y I +        VT    +    E P     S +  I  R +LD E  +  H  L++ A D    Q   R+A+ S+ + +LD NDN+PQ +E++       D+        + H+   D    +N +     +   ++ +F +     DV   + + P DYE  R   + +   D   P  + TT   + + D NDN P++   ++  +V E       II+V A DSD     ++ ++I+E D     NF + +D + G V     +DRE   +  + +   D           +   S  + + I ++D+NDN P +  +     + E+ P  + V  +   D DE       +    +  +    S    G++     +   L+ + +    L + A D+G   R     +H  I D N+ +PI ++ P ++ +     F        +  + A D D G+N+ + Y +   ++    S   F I  +TG I+TN         G + L ++  D G PSLS      + +T
Sbjct:  422 LDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTF-------------EAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEA--------VTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYH--LLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDV---SLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDD----NFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDG---------GVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLIT----IAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAPIFENAPYSASV-----FEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSG-YLLTVTAKDGGNPSLSDTTDVEIGVT 998          

HSP 4 Score: 78.5666 bits (192), Expect = 3.984e-14
Identity = 86/346 (24.86%), Postives = 144/346 (41.62%), Query Frame = 1
Query: 1792 PQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDD-------EYPSNVVTLKFIESESQTFDESNYWFGI--VNNTIFVKNELNREHKNNITLRLQAEDNGSPK--RRTF-VNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNITSA 2793
            P + Q  Y  +V E   +   +  V A D +      +Y  ++  D  ++ +  ++D + G V  + S+DRE      + +  TD+         +    S  T L +++ D ND+SP + +++    I E   + S V  L   D D       EY    VT    +      D+    F I   +  I  ++ L+RE  ++  L + A D  S +  RRT   ++  ++LD NDN P          +P  + +  TE N  +A I A D D G N+ + Y I+  N  ++ S         L     YE+++   + L I   D G+PS S      VN+  A
Sbjct:  357 PYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPV--VYSMVSLLD-SRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDD---------SFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVT----DGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQ-WGGTEDN-TVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRS--YRLVIRAQDGGSPSRSNTTQLLVNVIDA 682          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304899)

HSP 1 Score: 177.178 bits (448), Expect = 3.076e-44
Identity = 201/787 (25.54%), Postives = 339/787 (43.07%), Query Frame = 1
Query:  520 LQSENSQNTKISFNNVVL---RSYSDLFKIDSK-GNLTTLTHIDRDDICI---RLSCCKDSICTIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEP---------HMTLIKPLDRETIEIYNL-----SLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQE---IYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQI-TEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLT---KHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLT--TSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESN-YWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKT-GEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNI 2784
            +++ + +++ + ++ V L   RS S LFK+DS+ G +TT   +DR+ + +   R+    DS            P S +  + +N+ D ND+ PTF +     +I E A + S      A D+D   N    Y +   ++    +     P          ++    LDRET + Y+L      L   + +R+  + S+  QVKV DDNDN P F                ++ + + E+Q    E   +    A D D+G N+ I Y+I   ++       ++FSI+S S    + L   LDYE+   R   LVI A D G P RS +  L +N++D NDN P+  T +    + EN      +      D D  +   I+ ++SE     F L    +  W    +  I P D E+      Q++  D   P  + +++  I + D NDN P +  K Y  NV E       +  V ATD D +   +L++ IT  +    F    I  QNG   +T   S+D ++  + +  +  TD+  R           S+   + I+I D N+ +P + +      + E+ P+ + V  +   D D   +  +T    E         + +        I     L+RE  +   L + A+D G+P      ++   + DVNDN+P  KSP   + I    L  ++     + ++ A DPD GLN  + Y +   ++ +  SF I  T G I TN +  +   + +F+L     D G+P LS+ V   + +
Sbjct:  381 VRARDPEDSPVVYSMVSLLDSRSQS-LFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSF----------PPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASV--QVKVLDDNDNYPQFS-------------ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNT------QSQFSIDSMS--GDVSLVKPLDYESV--RSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDD-NFPLAVDPRTGW----VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS--RLHYEITTGNTRGRFA---ITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGR-----------SDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTS-----VIQVAASDPDVGLNGRIKYLLSDRDIEDG-SFVIDPTSGTIRTN-KGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRL 1103          

HSP 2 Score: 155.992 bits (393), Expect = 9.524e-38
Identity = 174/677 (25.70%), Postives = 302/677 (44.61%), Query Frame = 1
Query:  736 EIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRIS--ENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNII---PFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNN------TIFVKNELNREH-KNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPN--TELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEIL-----TNWESYETLKIGI 2709
            ++++N+ D NDN P F +     ++ E+  +        A D D   N    YS+S+  + F  ++      +  IKPLDRE    +   +   +      S S    + V D NDN P F     + KY   N        + E+Q     + +  A D DE  +S++ Y I++ ++        +F+I S +    I +  +LDY  ++E+  +L + ATD+G   RS + ++ IN+ D N NF  I E +P   S  E+    T + +   +D D+     I+ +L+EES         F        I+   P D E +    + +   D   P L+ TT+ +I + D NDN P +    Y  ++ E +     +I+V A+D D    G++ + +++ DI +  +F+ ID  +G +     +DRE     V+++T        P  ++ +       ++ I ++D+ND+ P + S K    +PEN P+ S+V ++   D DE  + VV    I       D+SN  F +V         +    EL+ E  +    L ++A    SP  R   ++   + DVNDN+P+L+   +   I N   + F S E    I +I A D D  ++  L+Y+IL  N  N         G +L     TN   + T+++ +
Sbjct:  674 QLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF-----NPKYYEAN--------VGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNT------RGRFAITSQNGRGLITIAQSLDY--KQEKRFLLTVAATDSGG--RSDTATVHINITDAN-NFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDI-EDGSFV-IDPTSGTIRTNKGLDRESV--AVFHLTAIAVDKGSPPLSSTV-------EVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGG-----DDSNA-FSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVLR---DFQVIFNNFRDHFPSGE----IGRIPAFDAD--VSDKLHYRILSGNNANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSV 1295          

HSP 3 Score: 141.739 bits (356), Expect = 2.170e-33
Identity = 146/628 (23.25%), Postives = 259/628 (41.24%), Query Frame = 1
Query:  970 LDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSI----ESP-----SETAKIRLRLNLDYENQEERHIILVILATDNGKPQ---RSASVSLTINLLDINDNFPQITEKSPNRISENDKRETVL--KIFHVSDKDLISKDNISCN---LSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNF-IRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHS---FRI-QKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNIT 2787
            LDRE ++++   +   +      S +   QV V D ND+ P F              +E F   I+E  T+   + +  A D D G+N++I Y I +        VT    +    E P     S +  I  R +LD E  +  H  L++ A D    Q   R+A+ S+ + +LD NDN+PQ +E++       D+        + H+   D    +N +     +   ++ +F +     DV   + + P DYE  R   + +   D   P  + TT   + + D NDN P++   ++  +V E       II+V A DSD     ++ ++I+E D     NF + +D + G V     +DRE   +  + +   D           +   S  + + I ++D+NDN P +  +     + E+ P  + V  +   D DE       +    +  +    S    G++     +   L+ + +    L + A D+G   R     +H  I D N+ +PI ++ P ++ +     F        +  + A D D G+N+ + Y +   ++    S   F I  +TG I+TN         G + L ++  D G PSLS      + +T
Sbjct:  422 LDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTF-------------EAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEA--------VTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYH--LLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDV---SLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDD----NFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDG---------GVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLIT----IAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAPIFENAPYSASV-----FEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSG-YLLTVTAKDGGNPSLSDTTDVEIGVT 998          

HSP 4 Score: 78.5666 bits (192), Expect = 4.226e-14
Identity = 86/346 (24.86%), Postives = 144/346 (41.62%), Query Frame = 1
Query: 1792 PQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDD-------EYPSNVVTLKFIESESQTFDESNYWFGI--VNNTIFVKNELNREHKNNITLRLQAEDNGSPK--RRTF-VNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNITSA 2793
            P + Q  Y  +V E   +   +  V A D +      +Y  ++  D  ++ +  ++D + G V  + S+DRE      + +  TD+         +    S  T L +++ D ND+SP + +++    I E   + S V  L   D D       EY    VT    +      D+    F I   +  I  ++ L+RE  ++  L + A D  S +  RRT   ++  ++LD NDN P          +P  + +  TE N  +A I A D D G N+ + Y I+  N  ++ S         L     YE+++   + L I   D G+PS S      VN+  A
Sbjct:  357 PYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPV--VYSMVSLLD-SRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDD---------SFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVT----DGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQ-WGGTEDN-TVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRS--YRLVIRAQDGGSPSRSNTTQLLVNVIDA 682          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0300578)

HSP 1 Score: 177.178 bits (448), Expect = 3.076e-44
Identity = 201/787 (25.54%), Postives = 339/787 (43.07%), Query Frame = 1
Query:  520 LQSENSQNTKISFNNVVL---RSYSDLFKIDSK-GNLTTLTHIDRDDICI---RLSCCKDSICTIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEP---------HMTLIKPLDRETIEIYNL-----SLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQE---IYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQI-TEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLT---KHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLT--TSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESN-YWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKT-GEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNI 2784
            +++ + +++ + ++ V L   RS S LFK+DS+ G +TT   +DR+ + +   R+    DS            P S +  + +N+ D ND+ PTF +     +I E A + S      A D+D   N    Y +   ++    +     P          ++    LDRET + Y+L      L   + +R+  + S+  QVKV DDNDN P F                ++ + + E+Q    E   +    A D D+G N+ I Y+I   ++       ++FSI+S S    + L   LDYE+   R   LVI A D G P RS +  L +N++D NDN P+  T +    + EN      +      D D  +   I+ ++SE     F L    +  W    +  I P D E+      Q++  D   P  + +++  I + D NDN P +  K Y  NV E       +  V ATD D +   +L++ IT  +    F    I  QNG   +T   S+D ++  + +  +  TD+  R           S+   + I+I D N+ +P + +      + E+ P+ + V  +   D D   +  +T    E         + +        I     L+RE  +   L + A+D G+P      ++   + DVNDN+P  KSP   + I    L  ++     + ++ A DPD GLN  + Y +   ++ +  SF I  T G I TN +  +   + +F+L     D G+P LS+ V   + +
Sbjct:  381 VRARDPEDSPVVYSMVSLLDSRSQS-LFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSF----------PPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASV--QVKVLDDNDNYPQFS-------------ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNT------QSQFSIDSMS--GDVSLVKPLDYESV--RSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDD-NFPLAVDPRTGW----VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS--RLHYEITTGNTRGRFA---ITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGR-----------SDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTS-----VIQVAASDPDVGLNGRIKYLLSDRDIEDG-SFVIDPTSGTIRTN-KGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRL 1103          

HSP 2 Score: 155.992 bits (393), Expect = 9.524e-38
Identity = 174/677 (25.70%), Postives = 302/677 (44.61%), Query Frame = 1
Query:  736 EIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRIS--ENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNII---PFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNN------TIFVKNELNREH-KNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPN--TELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEIL-----TNWESYETLKIGI 2709
            ++++N+ D NDN P F +     ++ E+  +        A D D   N    YS+S+  + F  ++      +  IKPLDRE    +   +   +      S S    + V D NDN P F     + KY   N        + E+Q     + +  A D DE  +S++ Y I++ ++        +F+I S +    I +  +LDY  ++E+  +L + ATD+G   RS + ++ IN+ D N NF  I E +P   S  E+    T + +   +D D+     I+ +L+EES         F        I+   P D E +    + +   D   P L+ TT+ +I + D NDN P +    Y  ++ E +     +I+V A+D D    G++ + +++ DI +  +F+ ID  +G +     +DRE     V+++T        P  ++ +       ++ I ++D+ND+ P + S K    +PEN P+ S+V ++   D DE  + VV    I       D+SN  F +V         +    EL+ E  +    L ++A    SP  R   ++   + DVNDN+P+L+   +   I N   + F S E    I +I A D D  ++  L+Y+IL  N  N         G +L     TN   + T+++ +
Sbjct:  674 QLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF-----NPKYYEAN--------VGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNT------RGRFAITSQNGRGLITIAQSLDY--KQEKRFLLTVAATDSGG--RSDTATVHINITDAN-NFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDI-EDGSFV-IDPTSGTIRTNKGLDRESV--AVFHLTAIAVDKGSPPLSSTV-------EVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGG-----DDSNA-FSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVLR---DFQVIFNNFRDHFPSGE----IGRIPAFDAD--VSDKLHYRILSGNNANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSV 1295          

HSP 3 Score: 141.739 bits (356), Expect = 2.170e-33
Identity = 146/628 (23.25%), Postives = 259/628 (41.24%), Query Frame = 1
Query:  970 LDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSI----ESP-----SETAKIRLRLNLDYENQEERHIILVILATDNGKPQ---RSASVSLTINLLDINDNFPQITEKSPNRISENDKRETVL--KIFHVSDKDLISKDNISCN---LSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNF-IRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHS---FRI-QKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNIT 2787
            LDRE ++++   +   +      S +   QV V D ND+ P F              +E F   I+E  T+   + +  A D D G+N++I Y I +        VT    +    E P     S +  I  R +LD E  +  H  L++ A D    Q   R+A+ S+ + +LD NDN+PQ +E++       D+        + H+   D    +N +     +   ++ +F +     DV   + + P DYE  R   + +   D   P  + TT   + + D NDN P++   ++  +V E       II+V A DSD     ++ ++I+E D     NF + +D + G V     +DRE   +  + +   D           +   S  + + I ++D+NDN P +  +     + E+ P  + V  +   D DE       +    +  +    S    G++     +   L+ + +    L + A D+G   R     +H  I D N+ +PI ++ P ++ +     F        +  + A D D G+N+ + Y +   ++    S   F I  +TG I+TN         G + L ++  D G PSLS      + +T
Sbjct:  422 LDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTF-------------EAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEA--------VTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYH--LLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDV---SLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDD----NFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDG---------GVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLIT----IAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAPIFENAPYSASV-----FEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSG-YLLTVTAKDGGNPSLSDTTDVEIGVT 998          

HSP 4 Score: 78.5666 bits (192), Expect = 4.226e-14
Identity = 86/346 (24.86%), Postives = 144/346 (41.62%), Query Frame = 1
Query: 1792 PQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDD-------EYPSNVVTLKFIESESQTFDESNYWFGI--VNNTIFVKNELNREHKNNITLRLQAEDNGSPK--RRTF-VNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNITSA 2793
            P + Q  Y  +V E   +   +  V A D +      +Y  ++  D  ++ +  ++D + G V  + S+DRE      + +  TD+         +    S  T L +++ D ND+SP + +++    I E   + S V  L   D D       EY    VT    +      D+    F I   +  I  ++ L+RE  ++  L + A D  S +  RRT   ++  ++LD NDN P          +P  + +  TE N  +A I A D D G N+ + Y I+  N  ++ S         L     YE+++   + L I   D G+PS S      VN+  A
Sbjct:  357 PYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPV--VYSMVSLLD-SRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDD---------SFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVT----DGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQ-WGGTEDN-TVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRS--YRLVIRAQDGGSPSRSNTTQLLVNVIDA 682          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0303223)

HSP 1 Score: 177.178 bits (448), Expect = 3.617e-44
Identity = 201/787 (25.54%), Postives = 339/787 (43.07%), Query Frame = 1
Query:  520 LQSENSQNTKISFNNVVL---RSYSDLFKIDSK-GNLTTLTHIDRDDICI---RLSCCKDSICTIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEP---------HMTLIKPLDRETIEIYNL-----SLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQE---IYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQI-TEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLT---KHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLT--TSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESN-YWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKT-GEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNI 2784
            +++ + +++ + ++ V L   RS S LFK+DS+ G +TT   +DR+ + +   R+    DS            P S +  + +N+ D ND+ PTF +     +I E A + S      A D+D   N    Y +   ++    +     P          ++    LDRET + Y+L      L   + +R+  + S+  QVKV DDNDN P F                ++ + + E+Q    E   +    A D D+G N+ I Y+I   ++       ++FSI+S S    + L   LDYE+   R   LVI A D G P RS +  L +N++D NDN P+  T +    + EN      +      D D  +   I+ ++SE     F L    +  W    +  I P D E+      Q++  D   P  + +++  I + D NDN P +  K Y  NV E       +  V ATD D +   +L++ IT  +    F    I  QNG   +T   S+D ++  + +  +  TD+  R           S+   + I+I D N+ +P + +      + E+ P+ + V  +   D D   +  +T    E         + +        I     L+RE  +   L + A+D G+P      ++   + DVNDN+P  KSP   + I    L  ++     + ++ A DPD GLN  + Y +   ++ +  SF I  T G I TN +  +   + +F+L     D G+P LS+ V   + +
Sbjct:  381 VRARDPEDSPVVYSMVSLLDSRSQS-LFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSF----------PPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASV--QVKVLDDNDNYPQFS-------------ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNT------QSQFSIDSMS--GDVSLVKPLDYESV--RSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDD-NFPLAVDPRTGW----VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS--RLHYEITTGNTRGRFA---ITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGR-----------SDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTS-----VIQVAASDPDVGLNGRIKYLLSDRDIEDG-SFVIDPTSGTIRTN-KGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRL 1103          

HSP 2 Score: 155.992 bits (393), Expect = 1.064e-37
Identity = 174/677 (25.70%), Postives = 302/677 (44.61%), Query Frame = 1
Query:  736 EIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRIS--ENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNII---PFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNN------TIFVKNELNREH-KNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPN--TELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEIL-----TNWESYETLKIGI 2709
            ++++N+ D NDN P F +     ++ E+  +        A D D   N    YS+S+  + F  ++      +  IKPLDRE    +   +   +      S S    + V D NDN P F     + KY   N        + E+Q     + +  A D DE  +S++ Y I++ ++        +F+I S +    I +  +LDY  ++E+  +L + ATD+G   RS + ++ IN+ D N NF  I E +P   S  E+    T + +   +D D+     I+ +L+EES         F        I+   P D E +    + +   D   P L+ TT+ +I + D NDN P +    Y  ++ E +     +I+V A+D D    G++ + +++ DI +  +F+ ID  +G +     +DRE     V+++T        P  ++ +       ++ I ++D+ND+ P + S K    +PEN P+ S+V ++   D DE  + VV    I       D+SN  F +V         +    EL+ E  +    L ++A    SP  R   ++   + DVNDN+P+L+   +   I N   + F S E    I +I A D D  ++  L+Y+IL  N  N         G +L     TN   + T+++ +
Sbjct:  674 QLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF-----NPKYYEAN--------VGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNT------RGRFAITSQNGRGLITIAQSLDY--KQEKRFLLTVAATDSGG--RSDTATVHINITDAN-NFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDI-EDGSFV-IDPTSGTIRTNKGLDRESV--AVFHLTAIAVDKGSPPLSSTV-------EVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGG-----DDSNA-FSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVLR---DFQVIFNNFRDHFPSGE----IGRIPAFDAD--VSDKLHYRILSGNNANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSV 1295          

HSP 3 Score: 141.739 bits (356), Expect = 2.423e-33
Identity = 146/628 (23.25%), Postives = 259/628 (41.24%), Query Frame = 1
Query:  970 LDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSI----ESP-----SETAKIRLRLNLDYENQEERHIILVILATDNGKPQ---RSASVSLTINLLDINDNFPQITEKSPNRISENDKRETVL--KIFHVSDKDLISKDNISCN---LSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNF-IRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHS---FRI-QKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNIT 2787
            LDRE ++++   +   +      S +   QV V D ND+ P F              +E F   I+E  T+   + +  A D D G+N++I Y I +        VT    +    E P     S +  I  R +LD E  +  H  L++ A D    Q   R+A+ S+ + +LD NDN+PQ +E++       D+        + H+   D    +N +     +   ++ +F +     DV   + + P DYE  R   + +   D   P  + TT   + + D NDN P++   ++  +V E       II+V A DSD     ++ ++I+E D     NF + +D + G V     +DRE   +  + +   D           +   S  + + I ++D+NDN P +  +     + E+ P  + V  +   D DE       +    +  +    S    G++     +   L+ + +    L + A D+G   R     +H  I D N+ +PI ++ P ++ +     F        +  + A D D G+N+ + Y +   ++    S   F I  +TG I+TN         G + L ++  D G PSLS      + +T
Sbjct:  422 LDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTF-------------EAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEA--------VTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYH--LLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDV---SLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDD----NFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDG---------GVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLIT----IAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAPIFENAPYSASV-----FEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSG-YLLTVTAKDGGNPSLSDTTDVEIGVT 998          

HSP 4 Score: 78.5666 bits (192), Expect = 4.191e-14
Identity = 86/346 (24.86%), Postives = 144/346 (41.62%), Query Frame = 1
Query: 1792 PQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDD-------EYPSNVVTLKFIESESQTFDESNYWFGI--VNNTIFVKNELNREHKNNITLRLQAEDNGSPK--RRTF-VNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNITSA 2793
            P + Q  Y  +V E   +   +  V A D +      +Y  ++  D  ++ +  ++D + G V  + S+DRE      + +  TD+         +    S  T L +++ D ND+SP + +++    I E   + S V  L   D D       EY    VT    +      D+    F I   +  I  ++ L+RE  ++  L + A D  S +  RRT   ++  ++LD NDN P          +P  + +  TE N  +A I A D D G N+ + Y I+  N  ++ S         L     YE+++   + L I   D G+PS S      VN+  A
Sbjct:  357 PYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPV--VYSMVSLLD-SRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDD---------SFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVT----DGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQ-WGGTEDN-TVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRS--YRLVIRAQDGGSPSRSNTTQLLVNVIDA 682          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0088214)

HSP 1 Score: 177.178 bits (448), Expect = 3.617e-44
Identity = 201/787 (25.54%), Postives = 339/787 (43.07%), Query Frame = 1
Query:  520 LQSENSQNTKISFNNVVL---RSYSDLFKIDSK-GNLTTLTHIDRDDICI---RLSCCKDSICTIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEP---------HMTLIKPLDRETIEIYNL-----SLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQE---IYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQI-TEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLT---KHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLT--TSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESN-YWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKT-GEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNI 2784
            +++ + +++ + ++ V L   RS S LFK+DS+ G +TT   +DR+ + +   R+    DS            P S +  + +N+ D ND+ PTF +     +I E A + S      A D+D   N    Y +   ++    +     P          ++    LDRET + Y+L      L   + +R+  + S+  QVKV DDNDN P F                ++ + + E+Q    E   +    A D D+G N+ I Y+I   ++       ++FSI+S S    + L   LDYE+   R   LVI A D G P RS +  L +N++D NDN P+  T +    + EN      +      D D  +   I+ ++SE     F L    +  W    +  I P D E+      Q++  D   P  + +++  I + D NDN P +  K Y  NV E       +  V ATD D +   +L++ IT  +    F    I  QNG   +T   S+D ++  + +  +  TD+  R           S+   + I+I D N+ +P + +      + E+ P+ + V  +   D D   +  +T    E         + +        I     L+RE  +   L + A+D G+P      ++   + DVNDN+P  KSP   + I    L  ++     + ++ A DPD GLN  + Y +   ++ +  SF I  T G I TN +  +   + +F+L     D G+P LS+ V   + +
Sbjct:  381 VRARDPEDSPVVYSMVSLLDSRSQS-LFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSF----------PPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASV--QVKVLDDNDNYPQFS-------------ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNT------QSQFSIDSMS--GDVSLVKPLDYESV--RSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDD-NFPLAVDPRTGW----VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS--RLHYEITTGNTRGRFA---ITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGR-----------SDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTS-----VIQVAASDPDVGLNGRIKYLLSDRDIEDG-SFVIDPTSGTIRTN-KGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRL 1103          

HSP 2 Score: 155.992 bits (393), Expect = 1.064e-37
Identity = 174/677 (25.70%), Postives = 302/677 (44.61%), Query Frame = 1
Query:  736 EIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRIS--ENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNII---PFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNN------TIFVKNELNREH-KNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPN--TELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEIL-----TNWESYETLKIGI 2709
            ++++N+ D NDN P F +     ++ E+  +        A D D   N    YS+S+  + F  ++      +  IKPLDRE    +   +   +      S S    + V D NDN P F     + KY   N        + E+Q     + +  A D DE  +S++ Y I++ ++        +F+I S +    I +  +LDY  ++E+  +L + ATD+G   RS + ++ IN+ D N NF  I E +P   S  E+    T + +   +D D+     I+ +L+EES         F        I+   P D E +    + +   D   P L+ TT+ +I + D NDN P +    Y  ++ E +     +I+V A+D D    G++ + +++ DI +  +F+ ID  +G +     +DRE     V+++T        P  ++ +       ++ I ++D+ND+ P + S K    +PEN P+ S+V ++   D DE  + VV    I       D+SN  F +V         +    EL+ E  +    L ++A    SP  R   ++   + DVNDN+P+L+   +   I N   + F S E    I +I A D D  ++  L+Y+IL  N  N         G +L     TN   + T+++ +
Sbjct:  674 QLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF-----NPKYYEAN--------VGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNT------RGRFAITSQNGRGLITIAQSLDY--KQEKRFLLTVAATDSGG--RSDTATVHINITDAN-NFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDI-EDGSFV-IDPTSGTIRTNKGLDRESV--AVFHLTAIAVDKGSPPLSSTV-------EVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGG-----DDSNA-FSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVLR---DFQVIFNNFRDHFPSGE----IGRIPAFDAD--VSDKLHYRILSGNNANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSV 1295          

HSP 3 Score: 141.739 bits (356), Expect = 2.423e-33
Identity = 146/628 (23.25%), Postives = 259/628 (41.24%), Query Frame = 1
Query:  970 LDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSI----ESP-----SETAKIRLRLNLDYENQEERHIILVILATDNGKPQ---RSASVSLTINLLDINDNFPQITEKSPNRISENDKRETVL--KIFHVSDKDLISKDNISCN---LSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNF-IRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHS---FRI-QKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNIT 2787
            LDRE ++++   +   +      S +   QV V D ND+ P F              +E F   I+E  T+   + +  A D D G+N++I Y I +        VT    +    E P     S +  I  R +LD E  +  H  L++ A D    Q   R+A+ S+ + +LD NDN+PQ +E++       D+        + H+   D    +N +     +   ++ +F +     DV   + + P DYE  R   + +   D   P  + TT   + + D NDN P++   ++  +V E       II+V A DSD     ++ ++I+E D     NF + +D + G V     +DRE   +  + +   D           +   S  + + I ++D+NDN P +  +     + E+ P  + V  +   D DE       +    +  +    S    G++     +   L+ + +    L + A D+G   R     +H  I D N+ +PI ++ P ++ +     F        +  + A D D G+N+ + Y +   ++    S   F I  +TG I+TN         G + L ++  D G PSLS      + +T
Sbjct:  422 LDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTF-------------EAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEA--------VTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYH--LLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDV---SLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDD----NFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDG---------GVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLIT----IAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAPIFENAPYSASV-----FEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSG-YLLTVTAKDGGNPSLSDTTDVEIGVT 998          

HSP 4 Score: 78.5666 bits (192), Expect = 4.191e-14
Identity = 86/346 (24.86%), Postives = 144/346 (41.62%), Query Frame = 1
Query: 1792 PQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDD-------EYPSNVVTLKFIESESQTFDESNYWFGI--VNNTIFVKNELNREHKNNITLRLQAEDNGSPK--RRTF-VNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNITSA 2793
            P + Q  Y  +V E   +   +  V A D +      +Y  ++  D  ++ +  ++D + G V  + S+DRE      + +  TD+         +    S  T L +++ D ND+SP + +++    I E   + S V  L   D D       EY    VT    +      D+    F I   +  I  ++ L+RE  ++  L + A D  S +  RRT   ++  ++LD NDN P          +P  + +  TE N  +A I A D D G N+ + Y I+  N  ++ S         L     YE+++   + L I   D G+PS S      VN+  A
Sbjct:  357 PYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPV--VYSMVSLLD-SRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDD---------SFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVT----DGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQ-WGGTEDN-TVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRS--YRLVIRAQDGGSPSRSNTTQLLVNVIDA 682          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 253.447 bits (646), Expect = 7.408e-69
Identity = 221/832 (26.56%), Postives = 381/832 (45.79%), Query Frame = 1
Query:  382 SK*SNMKISHLVNILFSLNYVFLKKTNQIEFNLIDVTPKETIIGSLLQSENSQNTKISFNNVVLRSYSDLFKIDSK-GNL-TTLTHIDRDDICIRLSCCKDSIC----TIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLS---DPSNTFNYSLIHNE----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHII-LVILATDNGKPQRSASVSLTINLLDINDNFPQIT---------EKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWD----VYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHS-FRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTN--VYFYVNIT 2787
            S+ S M +  L+ +  S N V     N I + + +  P  T+IGSL   +   +T   +   V   Y    ++D K G++ TT   IDR+ +    +  +   C     + +T ++        E  + I DENDN P F SP+  ++IPE+  + +L+ +P+A D+DS  NGI  Y+L+   + +N F+  +  +     P + ++  LDRE  + Y+L++ V +       +S   ++ ++D NDN P F   + + +             + EN  +   +    A D+D G N ++ YS+      P + V    SI+    T  I ++ ++D   +EE  I+   + A DNG   +S+   +TI + D NDN P I          E     ISE+    T + +  VSD+D      ++C ++ +   + +      +     Y L      DYE+ +   ++++ +D   P L+ T + K+++ D NDN P ++   Y V   E +     ++ V ATD+DS    +L ++IT   +P+      I+   G V + + +DRE+     + +   D           +        + + + D NDN P++      F + EN+P  S V  +   D DE  +  V L  +E ++  F   N  + I++   F     +RE ++  + RL+A D G P R ++V +   +LD NDN+P +  P N+S+     L   T     +  +EA+D D GLNS L++ I+     N H  FRI   GEI T  + +    IG+  L + + D GTP   T   V+ YVN T
Sbjct:   28 SRWSAMLVWILLLLCCSANVV-----NTILYQVTEEQPPNTLIGSLASDQGLPDTGHLYKLEVGAPY---LRVDGKTGDIYTTENSIDRESLKDCRNLFEGDPCFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGE-------------LPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQ----PSSPVMRLLSIDR--NTGIIFVKGSVD---REEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPE--GLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADK---------GVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLS-VEPDNGKFMIQNGTYTILSTISF-----DREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSY---KFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGG---NPHGLFRISSEGEI-TLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNET 805          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 252.292 bits (643), Expect = 9.587e-69
Identity = 222/838 (26.49%), Postives = 383/838 (45.70%), Query Frame = 1
Query:  364 IWVNRVSK*SNMKISHLVNILFSLNYVFLKKTNQIEFNLIDVTPKETIIGSLLQSENSQNTKISFNNVVLRSYSDLFKIDSK-GNL-TTLTHIDRDDICIRLSCCKDSIC----TIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLS---DPSNTFNYSLIHNE----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHII-LVILATDNGKPQRSASVSLTINLLDINDNFPQIT---------EKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWD----VYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHS-FRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTN--VYFYVNIT 2787
            +W    S+ S M +  L+ +  S N V     N I + + +  P  T+IGSL   +   +T   +   V   Y    ++D K G++ TT   IDR+ +    +  +   C     + +T ++        E  + I DENDN P F SP+  ++IPE+  + +L+ +P+A D+DS  NGI  Y+L+   + +N F+  +  +     P + ++  LDRE  + Y+L++ V +       +S   ++ ++D NDN P F   + + +             + EN  +   +    A D+D G N ++ YS+      P + V    SI+    T  I ++ ++D   +EE  I+   + A DNG   +S+   +TI + D NDN P I          E     ISE+    T + +  VSD+D      ++C ++ +   + +      +     Y L      DYE+ +   ++++ +D   P L+ T + K+++ D NDN P ++   Y V   E +     ++ V ATD+DS    +L ++IT   +P+      I+   G V + + +DRE+     + +   D           +        + + + D NDN P++      F + EN+P  S V  +   D DE  +  V L  +E ++  F   N  + I++   F     +RE ++  + RL+A D G P R ++V +   +LD NDN+P +  P N+S+     L   T     +  +EA+D D GLNS L++ I+     N H  FRI   GEI T  + +    IG+  L + + D GTP   T   V+ YVN T
Sbjct:    8 MW----SRWSAMLVWILLLLCCSANVV-----NTILYQVTEEQPPNTLIGSLASDQGLPDTGHLYKLEVGAPY---LRVDGKTGDIYTTENSIDRESLKDCRNLFEGDPCFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGE-------------LPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQ----PSSPVMRLLSIDR--NTGIIFVKGSVD---REEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPE--GLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADK---------GVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLS-VEPDNGKFMIQNGTYTILSTISF-----DREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSY---KFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGG---NPHGLFRISSEGEI-TLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNET 787          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh1b (protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-2])

HSP 1 Score: 252.677 bits (644), Expect = 1.260e-68
Identity = 222/838 (26.49%), Postives = 383/838 (45.70%), Query Frame = 1
Query:  364 IWVNRVSK*SNMKISHLVNILFSLNYVFLKKTNQIEFNLIDVTPKETIIGSLLQSENSQNTKISFNNVVLRSYSDLFKIDSK-GNL-TTLTHIDRDDICIRLSCCKDSIC----TIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLS---DPSNTFNYSLIHNE----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHII-LVILATDNGKPQRSASVSLTINLLDINDNFPQIT---------EKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWD----VYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHS-FRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTN--VYFYVNIT 2787
            +W    S+ S M +  L+ +  S N V     N I + + +  P  T+IGSL   +   +T   +   V   Y    ++D K G++ TT   IDR+ +    +  +   C     + +T ++        E  + I DENDN P F SP+  ++IPE+  + +L+ +P+A D+DS  NGI  Y+L+   + +N F+  +  +     P + ++  LDRE  + Y+L++ V +       +S   ++ ++D NDN P F   + + +             + EN  +   +    A D+D G N ++ YS+      P + V    SI+    T  I ++ ++D   +EE  I+   + A DNG   +S+   +TI + D NDN P I          E     ISE+    T + +  VSD+D      ++C ++ +   + +      +     Y L      DYE+ +   ++++ +D   P L+ T + K+++ D NDN P ++   Y V   E +     ++ V ATD+DS    +L ++IT   +P+      I+   G V + + +DRE+     + +   D           +        + + + D NDN P++      F + EN+P  S V  +   D DE  +  V L  +E ++  F   N  + I++   F     +RE ++  + RL+A D G P R ++V +   +LD NDN+P +  P N+S+     L   T     +  +EA+D D GLNS L++ I+     N H  FRI   GEI T  + +    IG+  L + + D GTP   T   V+ YVN T
Sbjct:    8 MW----SRWSAMLVWILLLLCCSANVV-----NTILYQVTEEQPPNTLIGSLASDQGLPDTGHLYKLEVGAPY---LRVDGKTGDIYTTENSIDRESLKDCRNLFEGDPCFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGE-------------LPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQ----PSSPVMRLLSIDR--NTGIIFVKGSVD---REEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPE--GLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADK---------GVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLS-VEPDNGKFMIQNGTYTILSTISF-----DREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSY---KFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGG---NPHGLFRISSEGEI-TLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNET 787          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 252.292 bits (643), Expect = 1.262e-68
Identity = 221/832 (26.56%), Postives = 381/832 (45.79%), Query Frame = 1
Query:  382 SK*SNMKISHLVNILFSLNYVFLKKTNQIEFNLIDVTPKETIIGSLLQSENSQNTKISFNNVVLRSYSDLFKIDSK-GNL-TTLTHIDRDDICIRLSCCKDSIC----TIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLS---DPSNTFNYSLIHNE----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHII-LVILATDNGKPQRSASVSLTINLLDINDNFPQIT---------EKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWD----VYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHS-FRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTN--VYFYVNIT 2787
            S+ S M +  L+ +  S N V     N I + + +  P  T+IGSL   +   +T   +   V   Y    ++D K G++ TT   IDR+ +    +  +   C     + +T ++        E  + I DENDN P F SP+  ++IPE+  + +L+ +P+A D+DS  NGI  Y+L+   + +N F+  +  +     P + ++  LDRE  + Y+L++ V +       +S   ++ ++D NDN P F   + + +             + EN  +   +    A D+D G N ++ YS+      P + V    SI+    T  I ++ ++D   +EE  I+   + A DNG   +S+   +TI + D NDN P I          E     ISE+    T + +  VSD+D      ++C ++ +   + +      +     Y L      DYE+ +   ++++ +D   P L+ T + K+++ D NDN P ++   Y V   E +     ++ V ATD+DS    +L ++IT   +P+      I+   G V + + +DRE+     + +   D           +        + + + D NDN P++      F + EN+P  S V  +   D DE  +  V L  +E ++  F   N  + I++   F     +RE ++  + RL+A D G P R ++V +   +LD NDN+P +  P N+S+     L   T     +  +EA+D D GLNS L++ I+     N H  FRI   GEI T  + +    IG+  L + + D GTP   T   V+ YVN T
Sbjct:   23 SRWSAMLVWILLLLCCSANVV-----NTILYQVTEEQPPNTLIGSLASDQGLPDTGHLYKLEVGAPY---LRVDGKTGDIYTTENSIDRESLKDCRNLFEGDPCFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGE-------------LPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQ----PSSPVMRLLSIDR--NTGIIFVKGSVD---REEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPE--GLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADK---------GVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLS-VEPDNGKFMIQNGTYTILSTISF-----DREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSY---KFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGG---NPHGLFRISSEGEI-TLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNET 800          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 251.906 bits (642), Expect = 1.362e-68
Identity = 222/838 (26.49%), Postives = 383/838 (45.70%), Query Frame = 1
Query:  364 IWVNRVSK*SNMKISHLVNILFSLNYVFLKKTNQIEFNLIDVTPKETIIGSLLQSENSQNTKISFNNVVLRSYSDLFKIDSK-GNL-TTLTHIDRDDICIRLSCCKDSIC----TIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLS---DPSNTFNYSLIHNE----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHII-LVILATDNGKPQRSASVSLTINLLDINDNFPQIT---------EKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWD----VYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHS-FRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTN--VYFYVNIT 2787
            +W    S+ S M +  L+ +  S N V     N I + + +  P  T+IGSL   +   +T   +   V   Y    ++D K G++ TT   IDR+ +    +  +   C     + +T ++        E  + I DENDN P F SP+  ++IPE+  + +L+ +P+A D+DS  NGI  Y+L+   + +N F+  +  +     P + ++  LDRE  + Y+L++ V +       +S   ++ ++D NDN P F   + + +             + EN  +   +    A D+D G N ++ YS+      P + V    SI+    T  I ++ ++D   +EE  I+   + A DNG   +S+   +TI + D NDN P I          E     ISE+    T + +  VSD+D      ++C ++ +   + +      +     Y L      DYE+ +   ++++ +D   P L+ T + K+++ D NDN P ++   Y V   E +     ++ V ATD+DS    +L ++IT   +P+      I+   G V + + +DRE+     + +   D           +        + + + D NDN P++      F + EN+P  S V  +   D DE  +  V L  +E ++  F   N  + I++   F     +RE ++  + RL+A D G P R ++V +   +LD NDN+P +  P N+S+     L   T     +  +EA+D D GLNS L++ I+     N H  FRI   GEI T  + +    IG+  L + + D GTP   T   V+ YVN T
Sbjct:   27 MW----SRWSAMLVWILLLLCCSANVV-----NTILYQVTEEQPPNTLIGSLASDQGLPDTGHLYKLEVGAPY---LRVDGKTGDIYTTENSIDRESLKDCRNLFEGDPCFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGE-------------LPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQ----PSSPVMRLLSIDR--NTGIIFVKGSVD---REEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPE--GLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADK---------GVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLS-VEPDNGKFMIQNGTYTILSTISF-----DREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSY---KFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGG---NPHGLFRISSEGEI-TLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNET 806          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: vapa (VAMP associated protein A [Source:Xenbase;Acc:XB-GENE-990155])

HSP 1 Score: 257.299 bits (656), Expect = 3.662e-70
Identity = 224/787 (28.46%), Postives = 360/787 (45.74%), Query Frame = 1
Query:  514 SLLQSENSQNTKISFNNVVLRSYSDLFKIDSKGN--LTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNS----ISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNE-----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFV-IYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEK---SPNR----ISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNS---FIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPS-LST--NVYFYVNITSASS 2799
            S + +    +T + +  V     S L K+ S      TT T IDR+ +C   S   ++ C  ++  V+I PN     I  +II  +KD NDN P F S +  I+IPE+  + S + +P AVD D+  NG+  Y L +  + F   ++        P + + + LDRE  + Y + + V +      S++   QV VSD NDNKP F               ES V ++I EN  +   +   HA D D G N++I Y   ++ +       TK      + T  I ++  LD E        L +LATD       A+V  TIN+ D+NDN P I  +   SP      +SE D   T + +  VSDKD      + C +  E +  F L   + + Y L      DYE  +  + +++  D  +P L QT   ++E+ DENDN P ++Q    ++V E +    ++  V+A+D DS K   + + +         +F  +D + G +  +   DRE   + ++ +T  DN               ++  + + + D NDNSP++      F + ENLP  S V  +   D D   +  VTL  +       D  N+     +  I      +RE +++ T  ++A D G P R +   +   I+D NDNSP++ SPP+N+    +P + +  S     ++A++ A D D G+N+ L Y I+  N  NK  FRI      +T  E      +G+  L ++I D G P  L T   V+ YVN T+ ++
Sbjct:   50 SHINAATGSSTSLVYRLVSKAGDSPLVKVSSSTGEIFTTSTRIDREKLCAGSSNSDENECFFEL-EVVILPNDFFRLIKIKII--VKDTNDNAPMFPSTVINISIPENTLINSRFPIPSAVDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNKPVF--------------KESQVEVHIPENAPIGTSVVQLHATDADIGSNAEIKYIFGAQVTS-----ATKRLFALNNTTGLITVQRPLDREETAVHK--LTVLATDGSSTPARATV--TINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPINTKIALITVSDKDTDVNSKVICFI--EREVPFHLKAVYDNQYLLETSSLLDYEGIKEFSFKIVAADTGKPSLNQTALVRVELEDENDNPPIFSQPVIELSVSENNRRGLYLTTVSASDEDSGKNSDIVYQLG-----PNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDN---------GTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITATDSDAGENKAVTLSILN------DNENFVLDPYSGLIKSNVSFDREQQSSYTFDVKAVDGGQPPRSSTAKVTINIMDANDNSPVVISPPSNTSFKLVPLSAIPGS-----VVAEVFAVDTDTGMNAELKYTIVSGN--NKGLFRIDPVTGNITLEEKPSAADVGLHRLVVNISDLGYPKPLHTLVLVFLYVNETAGNA 781          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: ENSXETT00000047804.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 248.44 bits (633), Expect = 2.518e-67
Identity = 221/803 (27.52%), Postives = 371/803 (46.20%), Query Frame = 1
Query:  406 SHLVNILFSLNYVFLKKTNQIEFNLIDVTPKETIIGSLLQSEN-----SQNTKISFNNVVLRSYSDLFKIDSKGN--LTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSI--SYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNE-----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEK-------SPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFY-LHISIYDSGTP 2748
            ++L+ +L +   VF     +  + + +  P+  +IG+LL+  N       +T + F  V       L +++       TT   IDR+ +C  +    ++ C  ++  V + P+ +    +I   I+D NDN P F S +  I+IPE+  + S Y +P A+D D   NGI  Y L    N F   +I        P + + + LDRE  + Y + + V +      S++   QV V+D NDN+P F       K I +N        I E+  +   +   HA D D G N+KI +   ++ +   N+    F+I++   T  I ++  LD E  E  +  L +LA+D       A+V  TIN+ DINDN P I  +          ++SE     T + +  V+DKD      ++C    +    F+L   F + + L    P DYE +R   ++++  D  +P L Q+    I+I DENDN P +T     ++  E +     + K++ATD+DS +  +L + +   + P  FN   +D + G +     +DRE+  +  + +   DN   +P   TN       T +T+ + D NDNSP +   + +F +PENLP+   V  +   D D   + VVTL  + +        N+    +   I      +RE + + T +++A D GSP++ + V +   + DVNDN P+   P NN      +   ST    ++A++ A D D G+N+ L Y I+  N  ++  F I +    +T  E       G+ Y L I + DSG P
Sbjct:   27 TYLLAVLIAC-IVFESGAQEKNYIVREELPENVLIGNLLKDLNLTLDPDLSTPLQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLCSGI--FTENKCFYEV-EVAVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKE-----KDIEVN--------IPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQIT---NLAKRHFAIDN--NTGLITVKEPLDRE--ESPYHKLTVLASDGSSTPSRATV--TINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVP--FRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSY-MLGPNAPTIFN---LDRRTGILTAVRKLDREKQDRYTFTVIAKDN--GNPSLQTN-------TTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNA------RDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQ--TSTSPGSVVARVYAIDNDTGINADLRYSIIGGN--SRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSGKP 778          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: ENSXETT00000047798.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 248.44 bits (633), Expect = 2.967e-67
Identity = 221/803 (27.52%), Postives = 371/803 (46.20%), Query Frame = 1
Query:  406 SHLVNILFSLNYVFLKKTNQIEFNLIDVTPKETIIGSLLQSEN-----SQNTKISFNNVVLRSYSDLFKIDSKGN--LTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSI--SYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNE-----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEK-------SPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFY-LHISIYDSGTP 2748
            ++L+ +L +   VF     +  + + +  P+  +IG+LL+  N       +T + F  V       L +++       TT   IDR+ +C  +    ++ C  ++  V + P+ +    +I   I+D NDN P F S +  I+IPE+  + S Y +P A+D D   NGI  Y L    N F   +I        P + + + LDRE  + Y + + V +      S++   QV V+D NDN+P F       K I +N        I E+  +   +   HA D D G N+KI +   ++ +   N+    F+I++   T  I ++  LD E  E  +  L +LA+D       A+V  TIN+ DINDN P I  +          ++SE     T + +  V+DKD      ++C    +    F+L   F + + L    P DYE +R   ++++  D  +P L Q+    I+I DENDN P +T     ++  E +     + K++ATD+DS +  +L + +   + P  FN   +D + G +     +DRE+  +  + +   DN   +P   TN       T +T+ + D NDNSP +   + +F +PENLP+   V  +   D D   + VVTL  + +        N+    +   I      +RE + + T +++A D GSP++ + V +   + DVNDN P+   P NN      +   ST    ++A++ A D D G+N+ L Y I+  N  ++  F I +    +T  E       G+ Y L I + DSG P
Sbjct:    7 TYLLAVLIAC-IVFESGAQEKNYIVREELPENVLIGNLLKDLNLTLDPDLSTPLQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLCSGI--FTENKCFYEV-EVAVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKE-----KDIEVN--------IPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQIT---NLAKRHFAIDN--NTGLITVKEPLDRE--ESPYHKLTVLASDGSSTPSRATV--TINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVP--FRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSY-MLGPNAPTIFN---LDRRTGILTAVRKLDREKQDRYTFTVIAKDN--GNPSLQTN-------TTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNA------RDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQ--TSTSPGSVVARVYAIDNDTGINADLRYSIIGGN--SRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSGKP 758          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: ENSXETT00000047801.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 248.44 bits (633), Expect = 3.122e-67
Identity = 221/803 (27.52%), Postives = 371/803 (46.20%), Query Frame = 1
Query:  406 SHLVNILFSLNYVFLKKTNQIEFNLIDVTPKETIIGSLLQSEN-----SQNTKISFNNVVLRSYSDLFKIDSKGN--LTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSI--SYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNE-----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEK-------SPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFY-LHISIYDSGTP 2748
            ++L+ +L +   VF     +  + + +  P+  +IG+LL+  N       +T + F  V       L +++       TT   IDR+ +C  +    ++ C  ++  V + P+ +    +I   I+D NDN P F S +  I+IPE+  + S Y +P A+D D   NGI  Y L    N F   +I        P + + + LDRE  + Y + + V +      S++   QV V+D NDN+P F       K I +N        I E+  +   +   HA D D G N+KI +   ++ +   N+    F+I++   T  I ++  LD E  E  +  L +LA+D       A+V  TIN+ DINDN P I  +          ++SE     T + +  V+DKD      ++C    +    F+L   F + + L    P DYE +R   ++++  D  +P L Q+    I+I DENDN P +T     ++  E +     + K++ATD+DS +  +L + +   + P  FN   +D + G +     +DRE+  +  + +   DN   +P   TN       T +T+ + D NDNSP +   + +F +PENLP+   V  +   D D   + VVTL  + +        N+    +   I      +RE + + T +++A D GSP++ + V +   + DVNDN P+   P NN      +   ST    ++A++ A D D G+N+ L Y I+  N  ++  F I +    +T  E       G+ Y L I + DSG P
Sbjct:   27 TYLLAVLIAC-IVFESGAQEKNYIVREELPENVLIGNLLKDLNLTLDPDLSTPLQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLCSGI--FTENKCFYEV-EVAVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKE-----KDIEVN--------IPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQIT---NLAKRHFAIDN--NTGLITVKEPLDRE--ESPYHKLTVLASDGSSTPSRATV--TINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVP--FRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSY-MLGPNAPTIFN---LDRRTGILTAVRKLDREKQDRYTFTVIAKDN--GNPSLQTN-------TTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNA------RDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQ--TSTSPGSVVARVYAIDNDTGINADLRYSIIGGN--SRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSGKP 778          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 234.572 bits (597), Expect = 9.972e-63
Identity = 202/808 (25.00%), Postives = 360/808 (44.55%), Query Frame = 1
Query:  445 FLKKTNQIEFNLIDVTPKETIIGSLLQSENSQNTKISFNNVVLRSYSDLFKIDSK-GNL-TTLTHIDRDDI--CIRLSCCKDSICTIKMTAV-LIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSL---SDPSNTFNYSLIHNE----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQIT---------EKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWD----VYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSL--STNVYFYVNIT 2787
             L  + ++ + + +  P   +IGSL       ++K  +   +   Y    ++D K G++ TT T IDR+ +  C  L   +      +++   L+ P     +  + I D NDN P F SP+  ++IPE+  +  L+ +P A D+DS  NG+  Y L    +  + F   +  ++    P + ++  LDRE  + Y+L++ V +      ++S   ++ + D NDN P F  +             ++   + EN  +   +    A D+D+G N++I YS            T +  +     T  I ++  +D E+     +   ++A D G   ++A   +TI + D NDN P I          +     ISE+   ET + +  VSD D      ++C ++ +   + K            Y L      DYE  +  T++++ +D   P L+ T + K+++ D NDN P ++Q    V   E ++ N  +++V+ATD+DS    +L+++I     P       I+  +G + + T +DRE+     +++   D           I        + I + D NDN P++     +F + EN+P  S V  +  +D D+  +  + L  +E ES  F   N        TI      +REH++  T RL+A D G P R ++V +   +LD NDN+P++  P N S+     L   T     +  + A+D D G+N+ L+Y I   N      F+I      +T  ++      G+  L + + D G PS   +  V+FY+N T
Sbjct:   62 ILGSSTKVAYRVPEEQPPNILIGSLASDYGYPDSKHLYKLELGHPY---LRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKM-------------AYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASD------TVRRLLHLDRSTGLITVQGPIDREDVGT--LKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPD--PSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDK---------GIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLS-VEPESGEFVIQNG-----TGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISY---KYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPF--ELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINET 823          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 255.373 bits (651), Expect = 1.797e-70
Identity = 212/762 (27.82%), Postives = 356/762 (46.72%), Query Frame = 1
Query:  589 LFKIDSKGN--LTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNS----ISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNE-----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFV-IYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEK---SPNR----ISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNS---FIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTP-SLST--NVYFYVNITSASS 2799
            L K+ S      TT   IDR+ +C   S  +++ C  ++  V+I PN     I  +II  +KD NDN P F SP+  I+IPE+  + S + +P A D D+  NG+  Y L +  + F   ++        P + + + LDRE  + Y + + V +      S++   QV VSD NDN+P F               E  V ++I EN  +   +   HA D D G N++I Y   ++ +       TK      + T  I ++ +LD E +   H + V+ +  +  P R+   ++TIN+ D+NDN P I  +   SP      +SE D   T + +  VSDKD      + C +  E    F L   + + Y L      DYE ++  + +++  D  +P L QT   ++++ DENDN P + Q    ++V E +    ++  ++ATD DS K   + + +         +F  +D + G +  +   +RE   + ++ +T  DN               ++  + + + D NDNSP++      F + ENLP  S V  +   D+D   +  VTL  +       D  N+     +  I      +RE +++ T  ++A D G P R +   +   ++DVNDNSP++ SPP+N+    +P + +  S     ++A++ A D D G+N+ L Y I+  N  NK  FRI      +T  E      +G+  L ++I D G P +L T   V+ YVN T+ ++
Sbjct:   75 LVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFEL-EVVILPNDFFRLIKIKII--VKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVF--------------KEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAP-----ATKRLFALNNTTGLITVQRSLDRE-ETAIHKVTVLASDGSSTPARA---TVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVP--FHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLG-----PNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDN---------GTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILN------DNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGS-----VVAEVFAVDIDTGMNAELKYTIVSGN--NKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKALHTLVLVFLYVNDTAGNT 781          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 254.988 bits (650), Expect = 1.336e-69
Identity = 233/810 (28.77%), Postives = 373/810 (46.05%), Query Frame = 1
Query:  442 VFLKKTNQIEFNLIDVTPKETIIGSLLQSEN-------SQNTKISFNNVVLRSYSDLFKIDSKGN--LTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSI--SYEIILNIKDENDNRPTFVSPLTVINI--PESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNE-----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEK---SPNR----ISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQ-TFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNN-SFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTP-SL--STNVYFYVN 2781
            VF     +  + + +  P+  +IG LL+  N       S  T + F  V       L +I+       TT   IDR+ +C  +    D+ C  ++  V + P+ I    +I   I+D NDN P F  P TVINI  PE++ + S Y LP A+D D   NG+  Y L    N F   +I        P + + K LDRE  + Y + + V +      S++   QV V+D NDN P F+              +   + I EN  +   +   HA D D GEN++I +  S+  S   N+    F + +   T  I ++  LD E        L++LATD G     A+V   +N+ DINDN P I  +   +P      +SEN    T + +  V DKD      ++C    E    F+L   F + + L      D+E +R   ++L+  D  +P L Q++   I++ DENDN P +TQ    ++V E ++    + K++ATD+DS +  ++ + +   D P  FN   +D + G +     +DRE+  +  + +   DN    P   +N T F       + + D NDNSP +   + +F +PE+LP +  V  +   D D   ++ VTL  ++   Q T D  +   G++   I      +RE + + T  ++AED G   R +   +   ++DVNDN PI   PP+N SF     +  ST    ++ K+ A D D G+N+ + Y I+  N   K  F I++T   +T  E      +G+  + +   D G P SL    NV F++N
Sbjct:   18 VFQSGAQEKNYTVREEMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVL--DARCFYEV-EVAVLPDEIFRLVKIRFLIEDINDNAPLF--PTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFI-------------EKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVS---NIAKRLFHLNT--TTGLITVKEPLDREESPSHK--LLVLATDGGSTPARATV--LVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVP--FRLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISY-MLGFDAPPEFN---LDQRTGILTAVKKLDREKQEKYYFTVLAQDN--GIPPLMSNATVF-------VTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILDVNDQFTIDPQS---GVIRPNI----SFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSF---EWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGN--TKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQPDSLFNVVNVNFFIN 773          

HSP 2 Score: 78.9518 bits (193), Expect = 2.863e-14
Identity = 94/392 (23.98%), Postives = 165/392 (42.09%), Query Frame = 1
Query: 1672 FDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKL--YFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSP----RY---PSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESE-----SQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPI-------LKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNI 2784
             D E+     +++   D   P+ + T   ++ + D NDN P + +KE  V++ E +     + +++ATD+D  +  ++  YF+   ++I K      ++   G + +   +DRE  P     +  TD                 +  + +++ DINDN P    RY   P+  T   + EN P+N+ +  +  +D D   +  VT  F + E        F  SN +  ++    F+  E  RE+     ++L A D G P       L  ++ D NDN+P+       L  P NNS  P  +L           KI A D D G N+ ++Y +          F + +   ILT  +  +  K   +Y  +   D+G P L +N   +V +
Sbjct:  207 LDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAK--RLFHLNTTTGLITVKEPLDREESPSHKLLVLATDG-----------GSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVL-LSENAPLNTKIALITVMDKDSEHNGRVTC-FTDHEVPFRLRPVF--SNQF--LLETAAFLDFESTREY----AIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNS--PGAQL----------TKISATDADSGQNAEISYML---GFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTV 560          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 255.758 bits (652), Expect = 2.457e-69
Identity = 212/764 (27.75%), Postives = 357/764 (46.73%), Query Frame = 1
Query:  583 SDLFKIDSKGN--LTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNS----ISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNE-----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFV-IYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEK---SPNR----ISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNS---FIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTP-SLST--NVYFYVNITSASS 2799
            + L K+ S      TT   IDR+ +C   S  +++ C  ++  V+I PN     I  +II  +KD NDN P F SP+  I+IPE+  + S + +P A D D+  NG+  Y L +  + F   ++        P + + + LDRE  + Y + + V +      S++   QV VSD NDN+P F               E  V ++I EN  +   +   HA D D G N++I Y   ++ +       TK      + T  I ++ +LD E +   H + V+ +  +  P R+   ++TIN+ D+NDN P I  +   SP      +SE D   T + +  VSDKD      + C +  E    F L   + + Y L      DYE ++  + +++  D  +P L QT   ++++ DENDN P + Q    ++V E +    ++  ++ATD DS K   + + +         +F  +D + G +  +   +RE   + ++ +T  DN               ++  + + + D NDNSP++      F + ENLP  S V  +   D+D   +  VTL  +       D  N+     +  I      +RE +++ T  ++A D G P R +   +   ++DVNDNSP++ SPP+N+    +P + +  S     ++A++ A D D G+N+ L Y I+  N  NK  FRI      +T  E      +G+  L ++I D G P +L T   V+ YVN T+ ++
Sbjct:   73 APLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFEL-EVVILPNDFFRLIKIKII--VKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVF--------------KEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVA-----PATKRLFALNNTTGLITVQRSLDRE-ETAIHKVTVLASDGSSTPARA---TVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVP--FHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLG-----PNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDN---------GTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILN------DNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGS-----VVAEVFAVDIDTGMNAELKYTIVSGN--NKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKALHTLVLVFLYVNDTAGNT 781          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 256.144 bits (653), Expect = 2.475e-69
Identity = 212/764 (27.75%), Postives = 357/764 (46.73%), Query Frame = 1
Query:  583 SDLFKIDSKGN--LTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNS----ISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNE-----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFV-IYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEK---SPNR----ISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNS---FIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTP-SLST--NVYFYVNITSASS 2799
            + L K+ S      TT   IDR+ +C   S  +++ C  ++  V+I PN     I  +II  +KD NDN P F SP+  I+IPE+  + S + +P A D D+  NG+  Y L +  + F   ++        P + + + LDRE  + Y + + V +      S++   QV VSD NDN+P F               E  V ++I EN  +   +   HA D D G N++I Y   ++ +       TK      + T  I ++ +LD E +   H + V+ +  +  P R+   ++TIN+ D+NDN P I  +   SP      +SE D   T + +  VSDKD      + C +  E    F L   + + Y L      DYE ++  + +++  D  +P L QT   ++++ DENDN P + Q    ++V E +    ++  ++ATD DS K   + + +         +F  +D + G +  +   +RE   + ++ +T  DN               ++  + + + D NDNSP++      F + ENLP  S V  +   D+D   +  VTL  +       D  N+     +  I      +RE +++ T  ++A D G P R +   +   ++DVNDNSP++ SPP+N+    +P + +  S     ++A++ A D D G+N+ L Y I+  N  NK  FRI      +T  E      +G+  L ++I D G P +L T   V+ YVN T+ ++
Sbjct:   73 APLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFEL-EVVILPNDFFRLIKIKII--VKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVF--------------KEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVA-----PATKRLFALNNTTGLITVQRSLDRE-ETAIHKVTVLASDGSSTPARA---TVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVP--FHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLG-----PNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDN---------GTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILN------DNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGS-----VVAEVFAVDIDTGMNAELKYTIVSGN--NKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKALHTLVLVFLYVNDTAGNT 781          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 255.373 bits (651), Expect = 2.718e-69
Identity = 233/810 (28.77%), Postives = 373/810 (46.05%), Query Frame = 1
Query:  442 VFLKKTNQIEFNLIDVTPKETIIGSLLQSEN-------SQNTKISFNNVVLRSYSDLFKIDSKGN--LTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSI--SYEIILNIKDENDNRPTFVSPLTVINI--PESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNE-----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEK---SPNR----ISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQ-TFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNN-SFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTP-SL--STNVYFYVN 2781
            VF     +  + + +  P+  +IG LL+  N       S  T + F  V       L +I+       TT   IDR+ +C  +    D+ C  ++  V + P+ I    +I   I+D NDN P F  P TVINI  PE++ + S Y LP A+D D   NG+  Y L    N F   +I        P + + K LDRE  + Y + + V +      S++   QV V+D NDN P F+              +   + I EN  +   +   HA D D GEN++I +  S+  S   N+    F + +   T  I ++  LD E        L++LATD G     A+V   +N+ DINDN P I  +   +P      +SEN    T + +  V DKD      ++C    E    F+L   F + + L      D+E +R   ++L+  D  +P L Q++   I++ DENDN P +TQ    ++V E ++    + K++ATD+DS +  ++ + +   D P  FN   +D + G +     +DRE+  +  + +   DN    P   +N T F       + + D NDNSP +   + +F +PE+LP +  V  +   D D   ++ VTL  ++   Q T D  +   G++   I      +RE + + T  ++AED G   R +   +   ++DVNDN PI   PP+N SF     +  ST    ++ K+ A D D G+N+ + Y I+  N   K  F I++T   +T  E      +G+  + +   D G P SL    NV F++N
Sbjct:   18 VFQSGAQEKNYTVREEMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVL--DARCFYEV-EVAVLPDEIFRLVKIRFLIEDINDNAPLF--PTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFI-------------EKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVS---NIAKRLFHLNT--TTGLITVKEPLDREESPSHK--LLVLATDGGSTPARATV--LVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVP--FRLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLG-FDAPPEFN---LDQRTGILTAVKKLDREKQEKYYFTVLAQDN--GIPPLMSNATVF-------VTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILDVNDQFTIDPQS---GVIRPNI----SFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSF---EWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGN--TKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQPDSLFNVVNVNFFIN 773          

HSP 2 Score: 78.9518 bits (193), Expect = 3.064e-14
Identity = 94/392 (23.98%), Postives = 165/392 (42.09%), Query Frame = 1
Query: 1672 FDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKL--YFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSP----RY---PSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESE-----SQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPI-------LKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNI 2784
             D E+     +++   D   P+ + T   ++ + D NDN P + +KE  V++ E +     + +++ATD+D  +  ++  YF+   ++I K      ++   G + +   +DRE  P     +  TD                 +  + +++ DINDN P    RY   P+  T   + EN P+N+ +  +  +D D   +  VT  F + E        F  SN +  ++    F+  E  RE+     ++L A D G P       L  ++ D NDN+P+       L  P NNS  P  +L           KI A D D G N+ ++Y +          F + +   ILT  +  +  K   +Y  +   D+G P L +N   +V +
Sbjct:  207 LDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAK--RLFHLNTTTGLITVKEPLDREESPSHKLLVLATDG-----------GSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVL-LSENAPLNTKIALITVMDKDSEHNGRVTC-FTDHEVPFRLRPVF--SNQF--LLETAAFLDFESTREY----AIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNS--PGAQL----------TKISATDADSGQNAEISYML---GFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTV 560          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q9HC56|PCDH9_HUMAN (Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 PE=1 SV=2)

HSP 1 Score: 258.07 bits (658), Expect = 4.784e-69
Identity = 214/762 (28.08%), Postives = 356/762 (46.72%), Query Frame = 1
Query:  589 LFKIDSKGN--LTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNS----ISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNE-----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFV-IYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEK---SPNR----ISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNS---FIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTP-SLST--NVYFYVNITSASS 2799
            L K+ S      TT   IDR+ +C   S  +++ C  ++  V+I PN     I  +II  +KD NDN P F SP+  I+IPE+  + S + +P A D D+  NG+  Y L +  + F   ++        P + + + LDRE  + Y + + V +      S++   QV VSD NDN+P F               E  V ++I EN  +   +   HA D D G N++I Y   ++ +       TK      + T  I ++ +LD E +   H + V+ +  +  P R+   ++TIN+ D+NDN P I  +   SP      +SE D   T + +  VSDKD      + C +  E +  F L   + + Y L      DYE ++  + +++  D  +P L QT   ++++ DENDN P + Q    ++V E +    ++  ++ATD DS K   + + +         +F  +D + G +  +   DRE   + ++ +T  DN               ++  + + + D NDNSP++      F + ENLP  S V  +   D D   +  VTL  +       D  N+     +  I      +RE +++ T  ++A D G P R +   +   ++DVNDNSP++ SPP+N+    +P + +  S     ++A++ A D D G+N+ L Y I+  N  NK  FRI      +T  E      +G+  L ++I D G P SL T   V+ YVN T+ ++
Sbjct:   75 LVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFEL-EVVILPNDFFRLIKIKII--VKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVF--------------KEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVA-----PATKRLFALNNTTGLITVQRSLDRE-ETAIHKVTVLASDGSSTPARA---TVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFI--EREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLG-----PNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDN---------GTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILN------DNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGS-----VVAEVFAVDVDTGMNAELKYTIVSGN--NKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHTLVLVFLYVNDTAGNA 781          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q9BZA8|PC11Y_HUMAN (Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 GN=PCDH11Y PE=1 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 2.269e-67
Identity = 236/798 (29.57%), Postives = 371/798 (46.49%), Query Frame = 1
Query:  442 VFLKKTNQIEFNLIDVTPKETIIGSLLQSEN-------SQNTKISFNNVVLRSYSDLFKI--DSKGNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSI--SYEIILNIKDENDNRPTFVSPLTVINI--PESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNE-----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNG-KPQRSASVSLTINLLDINDNFPQITEK-------SPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFI-ESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTEL-FASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRI-QKTGEILTNWESYETLKIGIFYLHISIYDSGTP 2748
            VF     +  + + +  P+  +IG+LL+  N       S  T + F  V       L +I  D+    TT   IDR+ +C  +   +D  C  ++  V I P+ I    +I   I+D NDN P F  P TVINI  PE++ + S Y LP AVD D   NG+  Y L    N F   +I        P + + K LDRE  + Y + + V +      S++   QV V+D NDN P F       K   I  S      I EN  +   +   HA D D GEN+KI +S S+  S   N+    F + +   T  I ++  LD E        L++LA+D G  P R+    + +N+ D+NDN P I  +           +SEN    T + +  V+DKD      ++C    E    F+L   F + + L N    DYE ++   ++L+  D  +P L Q+    I++ DENDN P +TQ    V++ E ++    ++KV+ATD+DS    ++ + +   D P  F+   +D + G + +   +DRE+  + ++ I   DN    P   +N+T F       + I D NDNSP +   +  F +PENLP +  V  +   D D   ++ VTL  + E++  T D      G++   I      +RE + + T  ++AED G   R +   +   ++DVNDN P+   PP N    + EL   ST    ++ ++ A D D G+N+ + Y I+  N   +  F I Q+TG I T  E  +   +G+  + +   D G P
Sbjct:   50 VFHSGAQEKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIP--RDEHCFYEV-EVAILPDEIFRLVKIRFLIEDINDNAPLF--PATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVF-------KETEIEVS------IPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVS---NIARRLFHLNA--TTGLITIKEPLDREETPNHK--LLVLASDGGLMPARAM---VLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIP--FRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINY-LLGPDAPPEFS---LDRRTGMLTVVKKLDREKEDKYLFTILAKDN--GVPPLTSNVTVF-------VSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQT---GVIRPNI----SFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNY---SYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGN--TRDLFAIDQETGNI-TLMEKCDVTDLGLHRVLVKANDLGQP 791          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q71M42|PC11X_PANTR (Protocadherin-11 X-linked OS=Pan troglodytes OX=9598 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 252.677 bits (644), Expect = 3.801e-67
Identity = 236/798 (29.57%), Postives = 372/798 (46.62%), Query Frame = 1
Query:  442 VFLKKTNQIEFNLIDVTPKETIIGSLLQSEN-------SQNTKISFNNVVLRSYSDLFKI--DSKGNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSI--SYEIILNIKDENDNRPTFVSPLTVINI--PESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNE-----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNG-KPQRSASVSLTINLLDINDNFPQITEK---SPNR----ISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFI-ESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTEL-FASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRI-QKTGEILTNWESYETLKIGIFYLHISIYDSGTP 2748
            VF     +  + + +  P+  +IG LL+  N       S  T + F  V       L +I  D+    TT   IDR+ +C  +   +D  C  ++  V I P+ I    +I   I+D NDN P F  P TVINI  PE++ + S Y LP AVD D   NG+  Y L    N F   +I        P + + K LDRE  + Y + + V +      S++   QV V+D NDN P F       K   I  S      I EN  +   +   HA D D GEN+KI +S S+  S   N+    F + +   T  I ++  LD E        L++LA+D G  P R+    + +N+ D+NDN P I  +   +P      +SEN    T + +  V+DKD      ++C    E    F+L   F + + L      DYE ++   ++L+  D  +P L Q+    I++ DENDN P +TQ    V++ E ++    + KV+ATD+DS    ++ + +   D P  F+   +D + G + +   +DRE+  + ++ I   DN    P   +N+T F       + I D NDNSP +   + +F +PENLP +  V  +   D D   ++ VTL  + E++  T D      G++   I      +RE + + T  ++AED G   R +   +   ++DVNDN P+   PP+N    + EL   ST    ++ ++ A D D G+N+ + Y I+  N   +  F I Q+TG I T  E  +   +G+  + +   D G P
Sbjct:   18 VFHSGAQEKNYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIP--RDEHCFYEV-EVAILPDEIFRLVKIRFLIEDINDNAPLF--PATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVF-------KETEIEVS------IPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVS---NIARRLFHLNA--TTGLITIKEPLDREETPNHK--LLVLASDGGLMPARAM---VLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIP--FRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINY-LLGPDAPPEFS---LDRRTGMLTVVKKLDREKEDKYLFTILAKDN--GVPPLTSNVTVF-------VSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQT---GVIRPNI----SFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNY---SYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGN--TRDLFAIDQETGNI-TLMEKCDVTDLGLHRVLVKANDLGQP 759          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 4.228e-67
Identity = 236/798 (29.57%), Postives = 372/798 (46.62%), Query Frame = 1
Query:  442 VFLKKTNQIEFNLIDVTPKETIIGSLLQSEN-------SQNTKISFNNVVLRSYSDLFKI--DSKGNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSI--SYEIILNIKDENDNRPTFVSPLTVINI--PESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNE-----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNG-KPQRSASVSLTINLLDINDNFPQITEK---SPNR----ISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFI-ESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTEL-FASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRI-QKTGEILTNWESYETLKIGIFYLHISIYDSGTP 2748
            VF     +  + + +  P+  +IG LL+  N       S  T + F  V       L +I  D+    TT   IDR+ +C  +   +D  C  ++  V I P+ I    +I   I+D NDN P F  P TVINI  PE++ + S Y LP AVD D   NG+  Y L    N F   +I        P + + K LDRE  + Y + + V +      S++   QV V+D NDN P F       K   I  S      I EN  +   +   HA D D GEN+KI +S S+  S   N+    F + +   T  I ++  LD E        L++LA+D G  P R+    + +N+ D+NDN P I  +   +P      +SEN    T + +  V+DKD      ++C    E    F+L   F + + L      DYE ++   ++L+  D  +P L Q+    I++ DENDN P +TQ    V++ E ++    + KV+ATD+DS    ++ + +   D P  F+   +D + G + +   +DRE+  + ++ I   DN    P   +N+T F       + I D NDNSP +   + +F +PENLP +  V  +   D D   ++ VTL  + E++  T D      G++   I      +RE + + T  ++AED G   R +   +   ++DVNDN P+   PP+N    + EL   ST    ++ ++ A D D G+N+ + Y I+  N   +  F I Q+TG I T  E  +   +G+  + +   D G P
Sbjct:   18 VFHSGAQEKNYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIP--RDEHCFYEV-EVAILPDEIFRLVKIRFLIEDINDNAPLF--PATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVF-------KETEIEVS------IPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVS---NIARRLFHLNA--TTGLITIKEPLDREETPNHK--LLVLASDGGLMPARAM---VLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIP--FRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINY-LLGPDAPPEFS---LDRRTGMLTVVKKLDREKEDKYLFTILAKDN--GVPPLTSNVTVF-------VSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQT---GVIRPNI----SFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNY---SYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGN--TRDLFAIDQETGNI-TLMEKCDVTDLGLHRVLVKANDLGQP 759          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q6X862|PC11X_GORGO (Protocadherin-11 X-linked OS=Gorilla gorilla gorilla OX=9595 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 5.277e-67
Identity = 235/798 (29.45%), Postives = 370/798 (46.37%), Query Frame = 1
Query:  442 VFLKKTNQIEFNLIDVTPKETIIGSLLQSEN-------SQNTKISFNNVVLRSYSDLFKI--DSKGNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSI--SYEIILNIKDENDNRPTFVSPLTVINI--PESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNE-----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNG-KPQRSASVSLTINLLDINDNFPQITEK-------SPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFI-ESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTEL-FASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRI-QKTGEILTNWESYETLKIGIFYLHISIYDSGTP 2748
            VF     +  + + +  P+  +IG LL+  N       S  T + F  V       L +I  D+    TT   IDR+ +C  +   +D  C  ++  V I P+ I    +I   I+D NDN P F  P TVINI  PE++ + S Y LP AVD D   NG+  Y L    N F   +I        P + + K LDRE  + Y + + V +      S++   QV V+D NDN P F       K   I  S      I EN  +   +   HA D D GEN+KI +S S+  S   N+    F + +   T  I ++  LD E        L++LA+D G  P R+    + +N+ D+NDN P I  +           +SEN    T + +  V+DKD      ++C    E    F+L   F + + L      DYE ++   ++L+  D  +P L Q+    I++ DENDN P +TQ    V++ E ++    + KV+ATD+DS    ++ + +   D P  F+   +D + G + +   +DRE+  + ++ I   DN    P   +N+T F       + I D NDNSP +   + +F +PENLP +  V  +   D D   ++ VTL  + E++  T D      G++   I      +RE + + T  ++AED G   R +   +   ++DVNDN P+   PP+N    + EL   ST    ++ ++ A D D G+N+ + Y I+  N   +  F I Q+TG I T  E  +   +G+  + +   D G P
Sbjct:   18 VFHSGAQEKNYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIP--RDEHCFYEV-EVAILPDEIFRLVKIRFLIEDINDNAPLF--PATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNMFGLDVIETPEGDKMPQLIVQKELDREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVF-------KETEIEVS------IPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVS---NIARRLFHLNA--TTGLITIKEPLDREETPNHK--LLVLASDGGLMPARAM---VLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIP--FRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINY-LLGPDAPPEFS---LDRRTGMLTVVKKLDREKEDKYLFTILAKDN--GVPPLTSNVTVF-------VSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQT---GVIRPNI----SFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNY---SYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGN--TRDLFAIDQETGNI-TLMEKCDVTDLGLHRVLVKANDLGQP 759          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A419QEP1 (Protocadherin-11 X-linked OS=Clonorchis sinensis OX=79923 GN=PCDH11X PE=4 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 9.937e-93
Identity = 284/980 (28.98%), Postives = 454/980 (46.33%), Query Frame = 1
Query:  463 QIEFNLIDVTPKETIIGSLLQSENSQNTKISFNNVVLRSYSDLFKIDSKGNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLI--FPNSISYEIILNIKDENDNRPTFVSPLTV---------------INIPESAELQSLYKLPMAVDKDSPGNGIDRYSL------------SDPSNTFNYSLI-----------HNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPP------NVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQI---------------TEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEK----SRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQF-----------SNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINS-IVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIV-----------NNTIFVKNELNREHKNNITLRLQAEDNG-SPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPN-----------TELFASTEKNKIIAKIEADDPDYGLNSTLNYKIL----------------------HSNLTNKHSFRI--QKTGEILTNW--------------------ESYETLK--------------IGIFYLHISIYDSGTPSLSTNVYFYVNITSASSPT------AEAYMXXXXXXXXXXXXXXXXXXXXXAAIFWVRFR 2910
            Q++F L D T  +  +G++L      + K  F   +L +   LF++D+ G+L T   +DRD IC  L CC+  +C I++ A L    P   +  + + + D NDN P F    T                I+IPESA + S + LP A DKDSP  G+  Y L            + P    ++ +I              P + L +PLDRE     +  L   +      ++ +  +VK+ D NDN P F  L++             +I I E+  +   IY F   D D+G N ++  S+    +YP         ++TK+++    +T ++R+   LDYE+Q ER ++LV+ A+D G P+ +++ +LT+ + D+NDN P I               +     R+ EN+    +LK+  V+D D +S   +SC+LS++ +  F+LT +   +Y L N   FDYE+    + H  V++ C D AEP+ +     +I + D NDN PQ+++  Y   V E       + +V ATD+DS + G+L + ++ +D P+  +F RI+ + G++Y TT +DRE    L +++T +D  D      T+++             SN T LTI I D+NDN P Y +  T   I E +P+ + I   +EF D D   +  V +  ++S S+ + E     G+V           ++ +    E++REH+    L + A D G S +  T  ++   + DVNDNSP L  P N S +             + + A T  N ++  I   D D G N T+ Y ++                      +S+L N  ++ +  +  G + T W                     S   LK               G++ +H+ + D G PSL T+  FYVNI+ A            A MSN +IL+LI+VCSLALI+SL AAIFWVRFR
Sbjct:   55 QVQFQLPDNTASDHFVGNIL---GVSHKKHQFTRAML-TPDHLFRLDNNGDLFTKDALDRDAICGSLGCCETDVCHIELEAYLFDSRPTPTAVNVNIYVTDANDNAPLFPHRQTEYSNSNLEDPEENVWEISIPESASVGSRHTLPTATDKDSPRFGVQNYRLLPAIEKSSNRISTVPDTFCSFEMILPPRIGAGQQSAQVPELQLGRPLDREQKSYCDFQLIAEDAGSPPLTSRILIRVKILDANDNAPIFANLSN----------TGLIITIPESIAVGSMIYKFSVQDIDDGPNGEVLLSVDWASTYPGLNQTMIQRLSTKYNLNP--KTGELRVVQPLDYESQLERRLLLVVKASDQGSPRLTSTTTLTVMVTDVNDNSPTIEVFEVGQNDENAAGSSAGKSARLMENEAEPKLLKLISVTDVDSVSVGKVSCHLSKQHQDDFQLTPYSNIMYGLVNSRAFDYEREASQTGHLAVRIECTDDAEPKRSTQQWIQIPLVDTNDNWPQFSRVNYQFYVAEDILVGTEVGRVEATDADSSQSGELSYELS-SDKPEFLSFFRINSKTGSIYTTTRMDRESLDVLEFHVTASDGGDAQ-SGGTSVSDSLEGNRKLSNVKSNTTGLTIFITDVNDNPPIY-TGPTEIHITEGVPVGTEIPVSIEFRDPDLGSNGTVQISLVQSHSR-YAEPLDGMGVVKLQDQPIGIIDSSKLVTTGEIDREHRAQFILSIVAVDQGESVQLTTTASITVHVDDVNDNSPTLLYPRNGSLLYGLIGESDWMNKLSTIPADTAPNTLVITIRGKDLDSGANGTITYHLMPGAHWVAPDSEKQTEERQNTEHNSDLLNGFNYFLLDETEGHLTTYWGLREEDNEAASNNGINLMTNRSSSGLKSKNLKQAKSNTPPEPGLYVIHVELRDGGVPSLVTSAVFYVNISEAVGGIFGLAFFTSANMSNTIILVLIMVCSLALIISLTAAIFWVRFR 1014          
BLAST of Protocadherin-9 vs. TrEMBL
Match: H2KPP4 (Protocadherin-11 Y-linked (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_102359 PE=4 SV=1)

HSP 1 Score: 335.495 bits (859), Expect = 1.528e-92
Identity = 284/980 (28.98%), Postives = 454/980 (46.33%), Query Frame = 1
Query:  463 QIEFNLIDVTPKETIIGSLLQSENSQNTKISFNNVVLRSYSDLFKIDSKGNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLI--FPNSISYEIILNIKDENDNRPTFVSPLTV---------------INIPESAELQSLYKLPMAVDKDSPGNGIDRYSL------------SDPSNTFNYSLI-----------HNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPP------NVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQI---------------TEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEK----SRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQF-----------SNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINS-IVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIV-----------NNTIFVKNELNREHKNNITLRLQAEDNG-SPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPN-----------TELFASTEKNKIIAKIEADDPDYGLNSTLNYKIL----------------------HSNLTNKHSFRI--QKTGEILTNW--------------------ESYETLKI--------------GIFYLHISIYDSGTPSLSTNVYFYVNITSASSPT------AEAYMXXXXXXXXXXXXXXXXXXXXXAAIFWVRFR 2910
            Q++F L D T  +  +G++L      + K  F   +L +   LF++D+ G+L T   +DRD IC  L CC+  +C I++ A L    P   +  + + + D NDN P F    T                I+IPESA + S + LP A DKDSP  G+  Y L            + P    ++ +I              P + L +PLDRE     +  L   +      ++ +  +VK+ D NDN P F  L++             +I I E+  +   IY F   D D+G N ++  S+    +YP         ++TK+++    +T ++R+   LDYE+Q ER ++LV+ A+D G P+ +++ +LT+ + D+NDN P I               +     R+ EN+    +LK+  V+D D +S   +SC+LS++ +  F+LT +   +Y L N   FDYE+    + H  V++ C D AEP+ +     +I + D NDN PQ+++  Y   V E       + +V ATD+DS + G+L + ++ +D P+  +F RI+ + G++Y TT +DRE    L +++T +D  D      T+++             SN T LTI I D+NDN P Y +  T   I E +P+ + I   +EF D D   +  V +  ++S S+ + E     G+V           ++ +    E++REH+    L + A D G S +  T  ++   + DVNDNSP L  P N S +             + + A T  N ++  I   D D G N T+ Y ++                      +S+L N  ++ +  +  G + T W                     S   LK               G++ +H+ + D G PSL T+  FYVNI+ A            A MSN +IL+LI+VCSLALI+SL AAIFWVRFR
Sbjct:   22 QVQFQLPDNTASDHFVGNIL---GVSHKKHQFTRAML-TPDHLFRLDNNGDLFTKDALDRDAICGSLGCCETDVCHIELEAYLFDSRPTPTAVNVNIYVTDANDNAPLFPHRQTEYSNSNLEDPEENVWEISIPESASVGSRHTLPTATDKDSPRFGVQNYRLLPAIEKSSNRISTVPDTFCSFEMILPPRIGAGQQSAQVPELQLGRPLDREQKSYCDFQLIAEDAGSPPLTSRILIRVKILDANDNAPIFTNLSN----------TGLIITIPESIAVGSMIYKFSVQDIDDGPNGEVLLSVDWASTYPGLNQTMIQRLSTKYNLNP--KTGELRVVQPLDYESQLERRLLLVVKASDQGSPRLTSTTTLTVMVTDVNDNSPTIEVFEVGQNDENAAGSSAGKSARLMENEAEPKLLKLISVTDVDSVSVGKVSCHLSKQHQDDFQLTPYSNIMYGLVNSRAFDYEREASQTGHLAVRIECTDDAEPKRSTQQWIQIPLVDTNDNWPQFSRVNYQFYVAEDILVGTEVGRVEATDADSSQSGELSYELS-SDKPEFLSFFRINSKTGSIYTTTRMDRESLDVLEFHVTASDGGDAQ-SGGTSVSDSLEGNRKLSNVKSNTTGLTIFITDVNDNPPIY-TGPTEIHITEGVPVGTEIPVSIEFRDPDLGSNGTVQISLVQSHSR-YAEPLDGMGVVKLQDQPIGIIDSSKLVTTGEIDREHRAQFILSIVAVDQGESVQLTTTASITVHVDDVNDNSPTLLYPRNGSLLYGLIGESDWMNKLSTIPADTAPNTLVITIRGKDLDSGANGTITYHLMPGAHWVAPDSEKQTEERQNTEHNSDLLNGFNYFLLDETEGHLTTYWGLREEDNEAASNNGINLMTNRSSSGLKSKNLKQAKSNTPPEPGLYVIHVELRDGGVPSLVTSAVFYVNISEAVGGIFGLAFFTSANMSNTIILVLIMVCSLALIISLTAAIFWVRFR 981          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A5J4NPD4 (Protocadherin delta 1 OS=Paragonimus westermani OX=34504 GN=DEA37_0006586 PE=4 SV=1)

HSP 1 Score: 333.954 bits (855), Expect = 8.884e-92
Identity = 306/998 (30.66%), Postives = 467/998 (46.79%), Query Frame = 1
Query:  460 NQIEFNLIDVTPKETIIGSLLQSENSQNTKISFNNVVLRSY---SDLFKIDSKGNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLI----FPNSISYEIILNIKDENDNRPTF------------VSP----LTV--INIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFN------------YSLIHN-----------EPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESF--VIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPP------NVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQI-------------TEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYE----KSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFS-----------NKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINS-IVEKLEFVDDDEYPSNVVTLKFIESESQTFD---ESNYW----FGIVNNTIFVKN-ELNREHKNNITLRLQAEDNGSPKR-RTFVNLHFEILDVNDNSPILKSPPNNSFIPNT-----------ELFASTEKNKIIAKIEADDPDYGLNSTLNY---------------KILHSN--------------LTNKHSFRI--QKTGEILTNW------------------------------ESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNITSASSPTAEAY---------MXXXXXXXXXXXXXXXXXXXXXAAIFWVRFRVSNDTP 2928
            ++++F+L D T    ++G++          +   +  LRS       F++ ++G+L T   +DRD++C RL CC    C + + A L      P +I  ++ L   DENDN P F             SP    LT   + IPESA + S + LP A D+DSP  G+ RYSL    +T +            +SLI              P + L +PLDRE  ++Y+L L   +  +   S +L  +V V D NDN P F+             S SF  VI I EN  +   I+ F   D+DEG N+ +  SI    SYP         ++ K+S++   ++  +R+   LDYEN  ER ++LV+ A D G P+ +AS S+TI++ D+NDN PQ+                 P  + EN+    +LK+  VSD D +S   I C L++  +  F+LT +   +Y L N+  FDYE    ++ H TV++ C+D+AEP  T     +I + D NDN PQ++Q  Y ++V E    +  + +V+ATD+DS   GK+ + ++ +D  K  ++IRID + G VY    +DRE    + +++T  D+ +    F + + + S           N T L I + D+NDN+P Y +      + EN+ I + I+  LEF D D   +  V +  ++S + T D    S  W      I N+T  V N E++RE +  + L + A D GS  R  T V+L   I D+NDN P L  P N S +  T            + A T  N +I  I   D D   N T+ Y               K+ H N              L + +++    Q  G + T+W                              +S ++ K G++ L++ + D G P L T+ +F+VNI   S P   ++         MSN +ILILI VCSLALI+SL AAIFWVRFR  +  P
Sbjct:   23 HRVQFHLPDNTDANHLVGNIFHG-------MRLKSTFLRSMLNPDAFFRLTTQGDLLTRDTLDRDEVCARLDCCDVDFCRVVLEAYLFDTRPVPTTIQIQVFL--ADENDNAPVFPKLHVKQNRGKQTSPGPEDLTAWELTIPESATVNSRHTLPAATDRDSPRFGLLRYSLHTVDSTRSRTSRIPSIDLSPFSLIPQVRSLASTSSLPAPEIQLDRPLDREVKQVYDLYLVAEDAGQPALSTTLLIRVNVEDANDNPPKFIN------------SSSFDAVITIPENIAVGSTIHQFSFHDDDEGPNADVLLSIDWSASYPTLNQSTIKRLSMKYSLDP--KSGDLRVIQPLDYENDVERRLVLVVRAIDQGSPKLTASTSVTISVTDVNDNSPQVEILEVATMSKDTDVSAIPAVLRENNAEPHLLKLISVSDADSVSSGKIHCELADPHQTDFQLTAYSTTMYGLLNLRAFDYEREASRTGHLTVRVECVDEAEPRRTSQQWVQIPLIDVNDNWPQFSQANYQLHVTEDVEIDTEVGQVDATDADSGLSGKVTYELS-SDNQKFLSYIRIDPRTGKVYTAAKLDREVLDTMDFHLTAMDSGELM-QFQSTLNEASIMDRKTSNVKTNTTGLRIIVNDVNDNAPIY-TGPAEIHVMENVAIGTEILSALEFTDPDLGSNGTVRVTLVDSSAFTTDLLRSSGNWRSFPVSITNSTSLVTNGEIDREKQAKMILSILATDQGSDVRLSTTVSLTVFIDDMNDNHPQLLYPRNASLLSGTMTNSEWSNQISTIPADTPANTLILTIHGKDMDANENGTVTYHLIREFKETKPQLWDKLTHQNGIHSEHDEGYAALGLPDGYAYFYVDQIHGHLKTHWGKPDTGKSTEISPLETAQNDSDLDKRSLEFKSTDSPKPGLYVLYVELRDGGKPPLVTHAHFFVNI---SEPIGISFWLGLFTTTNMSNTIILILITVCSLALIISLTAAIFWVRFRKDSHEP 991          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A183A4X0 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2005 PE=4 SV=1)

HSP 1 Score: 333.569 bits (854), Expect = 1.523e-91
Identity = 292/981 (29.77%), Postives = 442/981 (45.06%), Query Frame = 1
Query:  460 NQIEFNLIDVTPKETIIGSLLQSENSQNTKISFNNVVLRSY---SDLFKIDSKGNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLI--FPNSISYEIILNIKDENDNRPTFV--------SPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRY--------------------SLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPP------NVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQI--------------TEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRK--FKLTKHFWDVYNLNNIIPFDYE----KSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINS-IVEKLEFVDDDEYPSNVVTLKFIE---------------SESQTFDESNYWFGIVNN--TIFVKNELNREHKNNITLRLQAEDNGSP-KRRTFVNLHFEILDVNDNSPILKSPPNNSFI--------PNTELFASTEKNKI-----IAKIEADDPDYGLNSTLNYKILHSN----------------------------LTNKHSFRI-QKTGEILTNW-------------------ESYETLK---------IGIFYLHISIYDSGTPSLSTNVYFYVNITSASSPTAEAY---------MXXXXXXXXXXXXXXXXXXXXXAAIFWVRFRVSNDTPI 2931
            ++++F+L D TP   ++G++L         +S    ++R+       F++ + G+L T   +DRD IC RL+CC    C I++ A L    P   +  + L + DENDN PTF         +    ++IPESA + + + LP A D DS   G+  Y                    SL  P  T+   ++   P + + +PLDRET   Y++ L V +      + +L  +V + D NDN P FV                  I I E+ ++   ++ F   D DEG N  +  SI    SYP       N +++K+ I     T ++R+   LDYE++ ER ++LV+ A D+G PQ++AS SLTI L D+NDN P I                   +   END    +L++  VSD D +S   +SC LS++ + +  F LT +   +Y L N   FDYE    ++ H +V + C D AEP+ T+    +I + D NDN PQ++Q  Y   + E +     I  V ATD+DS   G++ + +T AD     N +RID + G VY+   +DRE    L +++T +D      D +    Q +N T LTI + D+NDN+P     K    + EN  I + +++K+   D D  P+  V +  IE               S S   ++  Y   ++ +  ++     L+RE +  + L L  +D G P       +L   I DVNDN P L  P NNSF+        P+T    +T    I     I  I   DPD G N T+ Y +L                                   H F +  +TG + T W                    S E +K          G++ + + + D G   ++T   FYVNI   S P    +         +SN VIL+LI+VCSLALI+SL AAIFWVRFR  ND+ I
Sbjct:   25 HRVQFHLPDNTPANHLVGNILGG-------VSLAQPLVRAMLNPDTWFRVTNTGDLFTRDSLDRDTICSRLACCLADFCQIQLEAYLFDSRPTPTTVRVTLFVADENDNPPTFPQLSQKDKEAKWWQVSIPESAAVGTKHTLPAATDADSSRFGVHHYKLFSAANSRSPMRPDDRLPFSLVTPPTTYPMPVVAPAPQLQIDRPLDRETKPSYDMYLVVEDAGSPPLTTTLSVRVNLLDTNDNAPSFVN------------QTDLAISIPESTSIGSVVHQFFVKDPDEGPNGNVTLSIDWPASYPGVNQTVLNRLSSKYMIHP--YTGELRVVQPLDYEDELERKVVLVVRAADSGSPQQTASSSLTITLTDVNDNGPVIEILGVDVRNDPISDGGTGVSTFKENDPEPQLLRLISVSDPDTVSIGKLSCKLSDQHQGENDFVLTSYSDTMYGLLNARAFDYEREASRTGHLSVSVECTDSAEPKRTRQQWIQIPLVDVNDNWPQFSQANYEFRIAENTEPGTEIGVVQATDADSGFHGQVTYRLT-ADNAAWLNLVRIDPKTGTVYVNAMLDRETVDHLEFHVTASDGNPNAAD-SEKAMQKTNTTGLTILVTDVNDNAPTCVGSK-EIHVSENTAIGTRVLKKIAVSDPDLGPNGSVLVSLIELPYMYSINLINHGLHSASTVPEKRQYLPFVIKDDLSLVTSGALDREQQTQVILTLLVKDQGQPIPLSATCSLTVVIDDVNDNPPQLIYPRNNSFLFGQREHSEPHTPYARATIPANIPYGSRIITIRGKDPDAGSNGTVTYHLLAQTDPIRRDIMMDFTELGSNDPFLEEGVLVYRDGMHLFELDSQTGFMTTAWGQSQDNSASEPVEEIAPSNGSSEIVKRRRRVEQPEPGLYAILVELRDMGPTPMTTKAIFYVNI---SEPVGMGFAFGLFSETNLSNTVILVLIMVCSLALIISLTAAIFWVRFR--NDSSI 976          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A2H1CV87 (Cadherin domain protein OS=Fasciola hepatica OX=6192 GN=D915_00962 PE=4 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 4.521e-89
Identity = 294/984 (29.88%), Postives = 454/984 (46.14%), Query Frame = 1
Query:  460 NQIEFNLIDVTPKETIIGSLLQSENSQNTKISFNNVVLRSY---SDLFKIDSKGNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIF--PNSISYEIILNIKDENDNRPTFVS--------PLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRY---------------SLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESP----SETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQI--------TEKSPNRIS------ENDKRETVLKIFHVSDKDLISKDNISCNLSE--ESKRKFKLTKHFWDVYNLNNIIPFDYEK----SRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFK---IPENLPINS-IVEKLEFVDDDEYPSNVVTLKFIE---------------SESQTFDESNYWFGIVNN--TIFVKNELNREHKNNITLRLQAEDNGSP-KRRTFVNLHFEILDVNDNSPILKSPPNNSFI-------------PNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKIL-HSN-------LT--------------------------NKHSFRIQK-TGEILTNW----------------------------ESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNITSASSPT------AEAYMXXXXXXXXXXXXXXXXXXXXXAAIFWVRFRVSNDTPINDQE 2943
            ++++F+L D TP   ++G++L         +S    + R+       F++ + G+L T   +DRD IC++L CC+   C I + A L    P   +  I L + DENDN P F              + IPESA + + + LP A D DS   GI  Y               SL  P++++    I   P + + + LDRET   Y+L L V +      + +L  +V + D NDN P F            N ++   + I EN T+   I+ F+  D D+G N  +  SI    S P +  T    + S       T ++R+  +LDYE++ ER ++LVI A D+G PQ++AS  LTI L D+NDN P I        +E   +  +      END    +L++  VSD D +S   +SC LS+  + +  F LT +   +Y L N   FDYE+    + H +V + C D+AEP+ T+    +I + D NDN PQ++Q  Y   V E +     I  V A+D+DS   G++ + +T  D  +  N IRID + G VY+   +DRE   +L +++T +D  D        + Q +N T LTI I D+NDN+P      T FK   + EN PI + +++++   D D   +  VT+  IE               S S   ++  +   +V +  ++     L+RE +    L L  +D+G+P    T  +L   I DVNDNSP L  P NNSF+               + + A+T     I  +   DPD G N T+NY +L H N       +T                            H F + K TG + T W                            ++ E  + G++ + + + D  +  L++   F+VNI+   S        +E  +SN VIL+LI+VCSLALI+SL AAIFWVRFR  +D P+  ++
Sbjct:   27 HRVQFHLADNTPPNHVVGNILGG-------VSLGQPLSRAMVTPDTWFRVTNAGDLFTRDSLDRDLICVKLECCQADFCQIHLEAYLFHSGPTPTTVRIALFVADENDNAPQFPQLSQKDKDEKWWRVFIPESAAVGTKHALPAATDADSARFGIHHYKLFSTRSRSNERLPFSLVTPASSYTTPTIVPAPQLQIDRHLDRETRPSYDLFLVVEDAGSPPLTTTLSVRVILLDTNDNAPIF-----------FNQTD-MSVTIPENTTIGTVIHQFYVRDLDDGPNGNVTLSIDWPASSPGSNQTALSRLSSKYLIHPYTGELRVAQSLDYEDELERKMVLVIRAADSGSPQQTASAILTITLTDVNDNGPTIEVLGVGTRSESGVDGTAELANFKENDPDPQLLRLISVSDPDSVSAGKLSCKLSDRHQGQTDFVLTSYSDTMYGLVNARAFDYEREASQTGHLSVSIECTDEAEPKKTRQQWIQINLIDVNDNWPQFSQANYEFRVAENTEPGTDIGVVQASDADSGFNGQVTYRLT-TDKTQWLNLIRIDPKTGTVYVNAMLDRESMTRLDFHVTASDG-DPSSSNTDRMAQKTNTTGLTIIITDVNDNAPSC----TEFKEVHVSENAPIGTQVLKRITVSDPDAGSNGSVTVSLIELPYMYSINMISHGVHSASTVPEKRQHLPFVVKDDLSLITSGSLDREQQTQFVLTLLVKDHGAPIPLSTTCSLTVVIDDVNDNSPQLVYPRNNSFLFGQREHSEPTSPYARSSVPANTPYGSRIITVRGKDPDAGANGTINYYLLPHENPIPNDSMMTLMMTMEISTAGQNGALEEDEILVYREGMHLFNLDKQTGLLTTAWGQNTDQYASKTAEDTTLISNTTDIRVKHQNIEQPEPGLYSVVVELRDMSSSPLTSKAVFFVNISEPVSMGFAFGLFSETNLSNTVILVLIMVCSLALIISLTAAIFWVRFR--SDNPVAGRQ 983          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 245.358 bits (625), Expect = 2.207e-66
Identity = 218/770 (28.31%), Postives = 356/770 (46.23%), Query Frame = 1
Query:  559 NNVVLRSYSDLFKIDSKGNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNS----ISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNE-----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFV-IYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEK---SPNR----ISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNS---FIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTP-SLST--NVYFYVNITSASS 2799
            +N +LR  S+  +I      TT   IDR+ +C   S  +DS C+ ++  V+I PN     I  +I+  +KD NDN P F SP+  I+IPE+  + S + +P A D D   N + +Y L +  + F   ++        P + + + LDRE  + Y + + V +      S++   QV V+D NDN+P F               ES + ++I E+  +   +    A D D G N++I Y   ++ S       T+      S T  I ++  LD E  E  +  L +LA+D      SA  ++TIN+ D+NDN P I  +   SP      +SE D   T + +  VSDKD      + C +  E    F L   + + Y L      DYE ++    +++  D  +P L QT   ++ + DENDN P +TQ    + V E +  + ++  + ATD DS +  ++ + +         +F  +D + G +  +   DRE   + ++ +T  DN  R            ++  + + I D NDNSP++      F + ENLP  S V  +   D D   + VV+L  +       D  N+        I      +RE +++ T  ++A D+G P   +   +   ++DVNDN PI+  PP+N+    +P + +  S     ++A++ A D D G+N+ L Y I++ N  NK  FRI      +T  E       G+  L ++I D G P SL T   V+ YVN T  +S
Sbjct:   72 DNPLLRVMSNTGEI-----FTTSNRIDREKLCPGPSY-EDSECSFEI-EVVILPNDYFRLIKIKIV--VKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVF--------------KESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSP-----ATRRLFALNSTTGLITVQRPLDRE--ETANHKLSVLASDGS--SSSARATVTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFI--EKDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLG-----PNASFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTR---------ALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVSLSILN------DNENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKLVPLSAIPGS-----VVAEVFAVDGDTGMNAELKYTIVNGN--NKGLFRIDPVTGNITLEEKPTEADSGLHRLVVNISDLGYPKSLHTLVLVFLYVNNTVGNS 780          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 244.588 bits (623), Expect = 2.897e-66
Identity = 218/770 (28.31%), Postives = 356/770 (46.23%), Query Frame = 1
Query:  559 NNVVLRSYSDLFKIDSKGNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNS----ISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNE-----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFV-IYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEK---SPNR----ISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNS---FIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTP-SLST--NVYFYVNITSASS 2799
            +N +LR  S+  +I      TT   IDR+ +C   S  +DS C+ ++  V+I PN     I  +I+  +KD NDN P F SP+  I+IPE+  + S + +P A D D   N + +Y L +  + F   ++        P + + + LDRE  + Y + + V +      S++   QV V+D NDN+P F               ES + ++I E+  +   +    A D D G N++I Y   ++ S       T+      S T  I ++  LD E  E  +  L +LA+D      SA  ++TIN+ D+NDN P I  +   SP      +SE D   T + +  VSDKD      + C +  E    F L   + + Y L      DYE ++    +++  D  +P L QT   ++ + DENDN P +TQ    + V E +  + ++  + ATD DS +  ++ + +         +F  +D + G +  +   DRE   + ++ +T  DN  R            ++  + + I D NDNSP++      F + ENLP  S V  +   D D   + VV+L  +       D  N+        I      +RE +++ T  ++A D+G P   +   +   ++DVNDN PI+  PP+N+    +P + +  S     ++A++ A D D G+N+ L Y I++ N  NK  FRI      +T  E       G+  L ++I D G P SL T   V+ YVN T  +S
Sbjct:   72 DNPLLRVMSNTGEI-----FTTSNRIDREKLCPGPSY-EDSECSFEI-EVVILPNDYFRLIKIKIV--VKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVF--------------KESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSP-----ATRRLFALNSTTGLITVQRPLDRE--ETANHKLSVLASDGSS--SSARATVTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFI--EKDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLG-----PNASFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTR---------ALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVSLSILN------DNENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKLVPLSAIPGS-----VVAEVFAVDGDTGMNAELKYTIVNGN--NKGLFRIDPVTGNITLEEKPTEADSGLHRLVVNISDLGYPKSLHTLVLVFLYVNNTVGNS 780          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh1b (protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-2])

HSP 1 Score: 238.424 bits (607), Expect = 3.191e-64
Identity = 217/813 (26.69%), Postives = 361/813 (44.40%), Query Frame = 1
Query:  466 IEFNLIDVTPKETIIGSLLQSENSQNTKISFNNVVLRSYSDLFKIDSK-GNL-TTLTHIDRDDICIRLSCCKDSIC----TIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSL---SDPSNTFNYSLIHNE----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQIT---------EKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEE--------------SKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHS-FRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTN--VYFYVNIT 2787
            I + L +  P  T++GSL   +   +T   +   V   Y    ++D K G++ TT   IDR+ +    +  +   C     + +T ++        E  + I+DENDN P F SP+  + IPE+  + + Y +P+A+DKD+  NGI  Y L   SD  N F+  +  N     P + ++  LDRE  + Y+LS+ V +       +S   ++ ++D NDN P F   + + +             + EN  + Q +    A D+D G N ++ YS        PNV   +  +     T  I+++ ++D E  E   +   + A DNG   +S+   +TI + D NDN P I          E     +SE+    T + +  VSDKD      ++C ++ +              SKRK          Y L    P DYE+ +   ++++ +D   P L+ T + K+++ D NDN P ++   Y V+  E +     ++ V ATD+DS    +L ++I      K      I+   G V +   +DRE   +  +++   D           +        + + + D NDN P++      F + EN+P  S V  +  +D D+  +  V L  +E E+  F   N        TI      +RE ++  T RL+A D G P R ++V +   +LD NDN+P +  P N+S+     L   T  +  + K++A+D D GLN+ L Y I      N H  FRI  T   +T  + +     G+  L + + D G PS  T   V+ +VN T
Sbjct:   35 ITYQLREEQPPNTLVGSLAADQGLPDTGHLYKLEVGGPY---LRVDGKTGDIYTTDVPIDRETLKDCRNLFEGDPCFLEFEVSITDLMKGSGPRLIEGRIEIQDENDNTPQFPSPILELAIPENTYVGAHYSIPVAMDKDAGSNGIADYKLNSGSDAMNLFSLQVADNTDEKVPQLIVLGNLDREQRDTYDLSIKVIDGGTPPRYSSALLRITITDTNDNVPKFERSHYEGE-------------MAENTPVGQSVLQVKANDDDLGANGQVTYSFHQPS---PNV---QRLLHIDHNTGIIQVKGSVDRE--EVPLLKFSVQARDNGPQAKSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQLRSASASDSTSKRK----------YFLQTTTPLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPSLYEVDFAEENQPGDKVLDVVATDADSGTNAELLYSIITDSATK--GLFDINPNTGEVRVMNQLDREYKERYEFHVEAADK---------GVPSLKGTATVVVRVLDRNDNDPKFMLNGYSFSVLENMPPLSPVGMVTVIDADKGENAHVQLS-VEPENGKFVIQNG-----TGTILSSISFDREKESTYTFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPSNSSY---KFLQPLTSPDTRVEKVDAEDIDTGLNAELVYSITGG---NPHGLFRISSTDGEITLAKEFTRKHNGLHRLVVKVSDKGKPSRHTTALVHIFVNET 790          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 233.802 bits (595), Expect = 1.382e-62
Identity = 199/728 (27.34%), Postives = 332/728 (45.60%), Query Frame = 1
Query:  616 LTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSI--SYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNE-----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEK-------SPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNN---SFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTP 2748
             TT   IDR+ +C  +   K     I+   V + P+ I    +I   I+D NDN P F S +  I+IPE+  + + Y +P A D D   NGI  Y L    + F   +I        P + + + LDRET + + + + V +      S++   QV VSD NDN+P F                   + + EN  +   +   HA D D G N++I +S S++ S         F+I+S   T  I ++  LD E+       L++LA+D       A+V   +N+ D+NDN P I  +           +SEN    T + +  V+D+D      ++C    +    F+L   F D + L    P DYE +R   ++++  D  +P L  +    I+I DENDN P + Q E  +++ E ++    +IK+ ATD+DS     + +++   D P  FN   ID ++G + ++  +DRE+  +  + +   DN        +N  Q +   KL   ++D NDNSP +   + +F +PENLP+   V  +   D D   + +VTL  I        + N+        I      +RE +++ T  ++A D+G  +  ++  +   ++DVNDN P+   P +N     +P T     T    ++ ++ A D D G+N+ L Y I+    + +  F I KT   +T  E       G+  L + + D G P
Sbjct:  125 FTTANRIDRERLCSGVFNEKRCFYEIE---VAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVF-------------KDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQIS---PATKRHFAIDS--STGLITVKQPLDRESNPVHK--LIVLASDGSATPSRATV--IVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVP--FRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLG-PDAPDGFN---IDPRSGILSVSKRLDREKQEKYSFTVIARDN-------GSNPLQSNVTVKLI--VQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIING------KDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFT-----TNPGSVVTRVFAIDNDTGMNAELQYSIIGG--SPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQP 799          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 233.417 bits (594), Expect = 4.276e-62
Identity = 197/728 (27.06%), Postives = 334/728 (45.88%), Query Frame = 1
Query:  616 LTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSI--SYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNE-----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEK-------SPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNN---SFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTP 2748
             TT   IDR+ +C  +   K     I+   V + P+ I    +I   I+D NDN P F S +  I+IPE+  + + Y +P A D D   NGI  Y L    + F   +I        P + + + LDRET + + + + V +      S++   QV VSD NDN+P F                   + + EN  +   +   HA D D G N++I +S S++ S         F+I+S   T  I ++  LD E+    H ++V+ +  +  P R+   ++ +N+ D+NDN P I  +           +SEN    T + +  V+D+D      ++C    +    F+L   F D + L    P DYE +R   ++++  D  +P L  +    I+I DENDN P + Q E  +++ E ++    +IK+ ATD+DS     + +++   D P  FN   ID ++G + ++  +DRE+  +  + +   DN        +N  Q +   KL   ++D NDNSP +   + +F +PENLP+   V  +   D D   + +VTL  I        + N+        I      +RE +++ T  ++A D+G  +  ++  +   ++DVNDN P+   P +N     +P T     T    ++ ++ A D D G+N+ L Y I+    + +  F I KT   +T  E       G+  L + + D G P
Sbjct:  125 FTTANRIDRERLCSGVFNEKRCFYEIE---VAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVF-------------KDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQIS---PATKRHFAIDS--STGLITVKQPLDRESNP-VHKLIVLASDGSATPSRA---TVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVP--FRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLG-PDAPDGFN---IDPRSGILSVSKRLDREKQEKYSFTVIARDN-------GSNPLQSNVTVKLI--VQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIING------KDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFT-----TNPGSVVTRVFAIDNDTGMNAELQYSIIGG--SPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQP 799          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 212.616 bits (540), Expect = 9.039e-57
Identity = 186/733 (25.38%), Postives = 320/733 (43.66%), Query Frame = 1
Query:  634 IDRDDICIRLSCCKDSICTIKMTAVLIFPNSI--SYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSL--SDPSNTFNYSLIHNE-------PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTK--FSIESPSETAKIRLRLNLDYENQEERHII-LVILATDNGK------------PQRSASVSLTINLLDINDNFPQITEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTK-HFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNS---FIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSG 2742
            +DR+ +C       +    +++  + + P       E+ +N++D NDN P F +P+  +++PE+A     + +  A D DS  NG+ RY L  SDP+    + L   E       P++ + K LDRE  ++Y ++L   +      S S   ++ V+D NDN P F     +             + I EN  +   +   HA D D G N+++ Y + +      +    K  F ++  S    +   LN     +EE  +  ++ILATD G                    S TI + DI      +       ISE       + +  VSD D+ +   ++C +    +  F+L K  + + Y L      DYE      VQ+   D     L++T +  I++ D NDN P +T+  Y V+V E +   K +I V+ATD D +K  ++ + +   D P  F+   +D + G + LT  +DRE+     + I   D           I        + +++ D+NDN PR+   +  F + EN+P +S V  +   D DE  +  V L  + ++++     +   G++ + +      +RE ++   L +QA D G P R + V +   ++D+NDNSPI+  PP+N+   F+        T    I+ ++ A D D  +N+ L Y I+  N  N   F I      +T  E       G+  L + + D G
Sbjct:  102 MDREALCGGQDPGDECHVDVQVGVLPVQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVN-------------VEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLN-----REESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVI-----YISEASHVNLPVALITVSDPDIGANGAVTCYIYN-PEVPFQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLG-PDAPTMFH---MDPETGIISLTEQLDREKKANYSFTILAKDQ---------GIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNRQLFSIDPESGMIRSNV----GFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFV-----VPRTLPGTIVTEVSAVDNDAEINAELRYHIVGGNPHNL--FHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIG 786          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.422 bits (472), Expect = 1.830e-48
Identity = 195/788 (24.75%), Postives = 329/788 (41.75%), Query Frame = 1
Query:  610 GNLTTLTHIDRDDICIR-LSCCKDS--ICTIKMTAVLIFPNSISYEII---LNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSN----TFNYSLIHNE----------------PHMTLI---KPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLR--LNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQI------TEKSPN---RISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKE--------YHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITE-ADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKT------HFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFI-ESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNITSASSPT 2805
            G L+    +DR+ +C+     C+ +  + T+++ A+     S +  ++   L ++D ND+ P F +P   ++I ES  +     LP A+D D+  N I  Y +S  S        +SL+ ++                 H  L+   + LDRE +  Y L L+  +      S S+   + V D NDN P FV    D    P+         I E+  +   +    A D D G N  IAYS  ++ +     + T+ ++     T  + +R    LD E        LV++A D G+  RSASV++T+ L D NDN P         E  P+   +I EN    T + +  VSD DL S   +   L  E     +L       + L      DYE+++   V ++  D+  P+L++  N  I + D NDN P +            Y V++ E   +   ++ + ATD+DS   G + F ++E A          ++ + G + L T +DRE+  ++ Y ++V       P       Q   +  + + + D NDN+P +            F + E   + + V  +   D DE  +  V L  + E+       +    G V  T+ V   L+RE +    L ++A D+G P       +   + D NDN+P++ SP  N    +   F S     +   + A+D D G N    Y+I+  N   K  F +      L+   +  +L  G+  L + + D G  S S  V     +  A++P 
Sbjct:   81 GELSVALRLDREALCMEEPDACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFV----DPPTRPVR--------ITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTS----LATQAALHVDGTTGLVTVRNAEKLDRETMPVHR--LVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRL--EFPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREK--RMRYELSVEACDGGSP-------QRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRTLVV---LDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTF-SPAGMLVGVSVTANDIDAGDNGRPLYEIIGGN--PKGIFLLNADSGALSLARTVSSLDEGLHRLVVRVRDRGG-SGSRRVRAVSGLLEAAAPV 832          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006996.1 (pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 gene:ENSPMAG00000006222.1 transcript:ENSPMAT00000006996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 161.384 bits (407), Expect = 4.873e-40
Identity = 162/639 (25.35%), Postives = 265/639 (41.47%), Query Frame = 1
Query:  730 SYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPN-RISENDKRETVLKIFHVSDKDLISK-DNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEP--ELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTT-SIDRERFPQLVY---NITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSN 2622
            S  + + + +ENDNRP F  PL  +++ E+A L +     +A D D+   G   Y  SD S+ F  SL      +++   LD E    + +++   +   Q  +  +  ++ + D NDN P F               +S+V   +EN      +    A D D   N++I YSI      P +  ++ FSI        + L   LDYE      I L I+A D G P  +++V+  + + D NDN P     S +  I EN      +   + +D D   +   +S   S E   +F++     D+    +    D E      + +  +D  +   + T      I + D NDN P W    Y V + E +     I  V+A D D  + G L + I   D P    F RI+  +G +  T   +DRE    + +      V    DR     +   + +    +T+ ++D+NDN P +       ++ E LP NS + ++   D DE  +  VT     S +      ++        I    +L+RE      LRL A D G+P   +   L   +LDVNDN+P     P  S +    L  S  ++ ++  +   D D GLN+ L++ I   N
Sbjct:   13 SARVHITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFSDDSDKF--SLDPASGLISVAAALDFEATPRFTVTVMARDGGGQETAGRV--RINLLDVNDNTPVF-------------QRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSI-----LPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGSTQFRINARSGDI---TSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAI---DPPNP--FYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADR----GSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTY----SMTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFH--PARSAV---SLMESVARDSVVISLNCTDADSGLNAELSFFITGGN 608          

HSP 2 Score: 128.257 bits (321), Expect = 5.921e-30
Identity = 173/708 (24.44%), Postives = 290/708 (40.96%), Query Frame = 1
Query:  583 SDLFKIDSKGNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSISYE----IILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSL---SDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVY--EKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDE----GENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKP--QRSASVSLTINLLDINDNFPQITEKS-PNRISENDKRETVLKIFHVSDKDLISKDNISCNLSE--------ESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIF--DENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNG-SPKRRTFVN-LHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSN 2622
            SD F +D    L            I ++   D   T + T  ++  +    E    + +N+ D NDN P F     V    E+    +      A D+DSP N    YS+   S  S+ F+ ++      +TL + LD E I    +SL +   +      ++++   V+V D+NDN P F                S+ I I EN      +   +A D D+    G+ S I YS+           +T+F I +   +  I     LD E   +   IL++ A D G    Q++   ++ I LLD+NDN P   +      I EN    T +     +D DL     +   +           +  K + T    D  +LN   P  +   R   V     D+  P    T +  + +   D NDN P +    Y + V E   +N  + +V ATD D    G + +++T A +P+  +F ++D   G +     +DRE        +  TD               S+ T L++ + D+NDN+P +   ++   + E++  +S+V  L   D D   +  ++  FI   +Q   +  +  G  +  +     L+RE K + +L ++A DNG +  RRT    L   +LDVNDN P+         +P      +  +  II +++A D D G+N  + Y+I+  N
Sbjct:   73 SDKFSLDPASGL------------ISVAAALDFEATPRFTVTVMARDGGGQETAGRVRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIF-------------DRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLI-YSLEG---------STQFRINA--RSGDITSTTLLDREAVSQ--YILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPPNPFYRINAASGKIRTTGLQLDREDLN---PISFASMRSIVVS--GADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAA-LPRP-DF-QLDAATGLITTLVQLDREAVAAYQLRLVATDR---------GTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSGLNAELSF-FITGGNQ---DGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFLEGSYEVSVPE-----NVTRGAIILQVQATDIDEGINGRVWYRIISGN 715          

HSP 3 Score: 119.013 bits (297), Expect = 4.027e-27
Identity = 157/639 (24.57%), Postives = 262/639 (41.00%), Query Frame = 1
Query:  451 KKTNQIEFNLIDV---TP---KETIIGSLLQSENS---------------QNTKISFNNVVLRSYSDLFKIDSKGNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLI----FPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKD-SP--GNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYI----PINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRL-RLNLDYEN------QEERHIILVILATDNGKPQRSASVSLTINLL--DINDNFPQ-ITEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRK-FKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDE 2238
            +   ++  NL+DV   TP   +++ +G+  +++NS                N +I+++ +   +YS  F I   G    +T      +   L   K    TI +T + +     P + +   I+ + DENDN P F      I IPE+    +      A D D SP  G     YSL     +  + +      +T    LDRE +  Y L               +   V   D ND K    T+N     +    P      + + I EN     +I++  A D D  EN  + Y+I      PPN     + I + S   KIR   L LD E+         R I  V+   D G P R A+ S T+ +L  D+NDN P  +      ++ E     + L     +D D  +  N++ +++    R  F+L      +  L   +  D E      ++L+  D+  P L+ TT   + + D NDN P +      V++ E    +  +I +N TD+DS    +L F IT  +    F+   +  ++G V    S+DRE   +  Y++ V +  D  P      ++ +  T L + + D+NDN P +        +PEN+   +I+ +++  D DE
Sbjct:  112 ETAGRVRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVT------LARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLE---GSTQFRINARSGDITSTTLLDREAVSQYIL---------------IVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAID-----PPNPF---YRINAAS--GKIRTTGLQLDREDLNPISFASMRSI--VVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTL---VQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFS---VGFRDGLVRTVVSLDRET--KASYSL-VIEAIDNGPAG----SRRTGTTTLDVLVLDVNDNRPLFLEGSYEVSVPENVTRGAIILQVQATDIDE 701          

HSP 4 Score: 116.316 bits (290), Expect = 3.116e-26
Identity = 172/786 (21.88%), Postives = 312/786 (39.69%), Query Frame = 1
Query:  607 KGNLTTLTHIDRD--DICIRLSCCKDSICTIKMTAVLIFPNSISYEIILNIKDENDNRPTF-VSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYS--------LIHNEPHMTLIKPLDRETIEIYN----LSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRISENDKRETVLKIFHVSD--KDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQL--ICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYH--VNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNF--IRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRY--------PSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIES--ESQTFDESNYWFGIVNNTIFVKNELNREHKN--NITLRLQAEDNGSP-----------KRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHS-------------FRIQKTGE---ILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYV 2778
            +G +TT   +DR+  D  +     +D        A+ +  N     + +N+ DENDN P F     T++ + ESA   +L  +  A D+D+  NG    ++S  ++T   +        +I NE  +T++     + +E  +      +   +      S +    V V D NDN P F++        P  Y+ S V+ +    TL   ++   A D D G N ++ + I S           K SI       ++    N+D E +      L+++A D G P  S S  + + + D+ND  P              +  +VL+   V      + + +N   + ++ + +   + K+ + V+  + ++        +E   L  +  D   P L       +E+ D ND+ P +        VN+ E       I++V A D D  + G + ++   A    + ++   RI+  +G +    ++DRE   Q VY++ +  +    P        + +   L + + DI+DN P +        P Q   F IPE+ P  + V  +    D +  +N +   FI +  E   F+ S +        + V ++L+RE      I ++  +  N +P           K RT   +   + D+ND  P+     N+ +     + A       + ++EA D D G NS + Y+IL S L  KHS              R  + GE   IL  ++ +     G F L +   D    + +  V  Y+
Sbjct: 1782 QGEITTQAALDREATDSYMLTVLSRDGG---PREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNG----TVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLS--------PGGYAVS-VVELGAPGTLVASVW---ATDADAGPNGQVTFRIESGGG-------DKLSIGPSDGIIRVAPGANIDRETRAA--YTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPV--------QTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNAFTVHATSGLVTSTRLLKSYERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRES--QAVYSLILLASDQGQP------VSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQS--FSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNEGNKFNLSRWGL------LVVLSDLDREVSPYYAIIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVFT---NHEYTAGVAVDAKVGSE--LLQLEAVDRDVGNNSIVLYRIL-SILYIKHSSNSSTRMYNIFTLGRCARAGERDGILRTYDLFTAYGPGYFMLEVVAADLAGHNDTATVGVYI 2509          

HSP 5 Score: 102.064 bits (253), Expect = 5.537e-22
Identity = 144/626 (23.00%), Postives = 255/626 (40.73%), Query Frame = 1
Query:  616 LTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPM-AVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRE-TIEIYNLSLYVYEKQR---QMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEE------SKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAE-PELTQTTN--FKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVN----ATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNV--YLTTSIDRERFP--QLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRY--PSQKTHFKIPENLP-INSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNT--IFVKNELNREHKNNITLRLQAEDNGSP 2412
            +TT+T      +C ++   + +  + +   +   P   +  +++ I DENDN P F +    + + E      +    + A D D   N    Y++   +    + + +    +T +K LD E +  +Y L +   ++ R   +  +++    V V+D ND  P+F+             S    I + E Q     I +F A D D G N ++ YSI   D  P N    +F I       ++R  + LD E Q   +  L I+A D G P  ++++++ + +LD++DN P +    P   S ++    +  +  V   D     N +  L          +R F        VY +N   P D E+     + L   D  + P   +  +    + I DENDN P ++Q  Y   + E S +   +  +N    A+D+D      L +++    +  +  +  ID   GNV   L   +DRE  P  +L   I V D   R+              +L + + D+NDN+P +   SQ  H  + EN P + + V  ++ +D D    +  T+++           N  FGI  +T  I     ++ E +    L + A D   P
Sbjct: 1121 ITTITQ----RLCTKVLVKRAASASTRGICLTATPAQATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNTAATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFL------------RSYEGPIDVSEGQP-GPRIATFMASDQDSGLNGELEYSIIDGD--PRN----EFVISPADGDLRVRRYVELDRETQAFYN--LTIMAKDMGTPPLNSTLTVGVRVLDVHDNDP-VFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVY-VNR--PLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSL----LGGSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGRRN-----------ATVRLGVTVLDVNDNTPTFNVTSQTAH--VLENSPAVGTSVIVVKAMDRDLGVCDAGTVRY-----SIASGGNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPP 1695          

HSP 6 Score: 94.3597 bits (233), Expect = 1.457e-19
Identity = 149/653 (22.82%), Postives = 254/653 (38.90%), Query Frame = 1
Query:  745 LNIKDENDNRPTFV----SPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSL--SDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILA-TDNGKPQRSASVSLTINLLDINDNFP---QITEKSPNRISENDKRETVLKIF----HVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNII--PFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQW--TQKEYHVNVEECSNSNKFIIKVNATDSDSE--KFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESN--YWFGIVNNTIFVKNELNREHKNNITLRLQAEDNG----------SPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYK 2607
            +++ D ND  P F+     P+ V        + +     MA D+DS  NG   YS+   DP N F  S    +  +     LDRET   YNL++   +      +++L   V+V D +DN P F+ L       P N S      + E   +   +    A D +EG N       S     P +    + +  + S+T  + +   LD E   E  + L +    DN    R  S  + + +LD NDN P   Q+T ++   I EN    TVL +     + SD D      ++ +L   S   F + +   D  N++  +    D E      ++L  + +       T    + + D NDN P +  T +  HV +E        +I V A D D      G + ++I       TF    ID   G +     ID E  P+ +  +  T   D+ P F+T   +     +  +D K ++ +   Y +  +   +P  + +     +++       P  ++  K+ E +     ES+       +   I  +  L+RE  ++  L + + D G           P    +VN    + D NDNSP  ++          E+  S     ++  + A D D G N T++ +
Sbjct: 1270 VHVADVNDVTPWFLRSYEGPIDVSEGQPGPRIATF----MASDQDSGLNGELEYSIIDGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNL-------PANAS------LSEAAAVLAIVSRVRASDANEGRNCAALLQHS-----PTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEA--EIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDR---DRGNVSMALGQGLDREGIPGGRLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHV-LENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGG-NDTFG---IDESTGLIVTVAPIDYETRPEYLLMVVAT---DQAPPFHTASCELRVSLQNELDEK-LSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVN----VTDENDNSPEFEAGSATLV----EVRESAAPGTLLTVLHATDRDAGSNGTVSAR 1878          

HSP 7 Score: 92.4337 bits (228), Expect = 5.531e-19
Identity = 107/419 (25.54%), Postives = 171/419 (40.81%), Query Frame = 1
Query: 1426 ASVSLTINLLDINDNFPQITEKSPN-RISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIES-ESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSP--KRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSN---LTNKHSFRIQKTG 2661
             S  + I L++ NDN P  +    N  + EN    T +     +D D      +S + S++S  KF L      +   +     D+E +   TV ++  D    E       +I + D NDN P + +  Y     E  NS   +++V ATD DS    ++ ++I       ++  I +    G V L  ++D E+ P    ++T+       P  N+ +T         +++ D NDNSP +        IPEN+   + V  +   D D+ P     L  I S E  T    N   G + +T      L+RE  +   L ++A D G    ++     ++  +LDVNDN P  +  P         +  +T     I  + A DPD   N TL Y I   N     N  S +I+ TG
Sbjct:   12 GSARVHITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFSDDSD-KFSLDPASGLI---SVAAALDFEATPRFTVTVMARDGGGQE--TAGRVRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAI-------VEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSP-EYGQLSLIYSLEGSTQFRINARSGDITSTTL----LDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPY-----AVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPPNPFYRINAASGKIRTTG 407          

HSP 8 Score: 73.559 bits (179), Expect = 2.876e-13
Identity = 96/417 (23.02%), Postives = 168/417 (40.29%), Query Frame = 1
Query: 1426 ASVSLTINLLDINDNFPQITEKSPNRISENDKRETVLKIFHVSDKDLISKDN---ISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPE-----LTQTTNFKIEIFDENDNIPQWTQKEYH--VNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLK-----FIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNG---SPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSN 2622
            A+ S+ I + D NDN P     +   +         + + +V+  D    DN   +   +S  +   F +         L  +   D+E S    + L+     +P      LT T    + + D ND  P W  + Y   ++V E     + I    A+D DS   G+L ++I + D P+  N   I   +G++ +   ++ +R  Q  YN+T+       P  N+ +T       + + + D++DN P + +   +  + E   + +IV ++   D +E  +    L+     F   E   + +S          ++V   L+RE      L L   DN    S  R+    +   ILD NDNSP+       + IP       T    +   I A D D+G+N+TL Y +L  +
Sbjct: 1154 ATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNTAATFGIDN---GTGVLTAVKALDFEVSAGLYL-LVVTATDQPRDPARRLTSTATVSVHVADVNDVTP-WFLRSYEGPIDVSEGQPGPR-IATFMASDQDSGLNGELEYSIIDGD-PR--NEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLT-------VGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQ------TGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSP-NGTVLTVLNGPIYASDADFGVNATLAYSLLGGS 1547          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 151.754 bits (382), Expect = 1.500e-37
Identity = 153/676 (22.63%), Postives = 282/676 (41.72%), Query Frame = 1
Query:  466 IEFNLIDVTPKETIIGSL---LQSENSQNTKISFNNVVLRSYSDLFKIDSKGNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSISYEII---LNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNE-----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQI-------TEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKT--FNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSP--RYPSQKTH---FKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFG-IVNNTIFVKNELNREHKNNITLRLQAEDNGSPK 2415
            +++ L +  P  T++G L   LQ   +++    F  +    +S +   ++ G ++    IDR+       C +   C I+   +   P  + ++++   + + D ND+ P F      + I ES  L +   L  A D D  GN +  Y L D +  F  +L           + +   LDRE    Y L L  ++      S +   ++ V D NDN P F   + +             + ++E+ T    + + +A D DEG N ++ YS SS    P +    +     P +T K+ L+  LD+E   E  I   I A D G     A   + +++ DINDN P+I       +      +SE    E+ + +  VSD D      ++C+L       FKL  +  D   + N    D E+     + L   D   P       F + + DENDN P++ +  Y  ++ E ++   ++  V A D+D+E  G + +N+ E+++       ++ I+  +G +Y    +D E    L + +   D  D  P   TN T       +++ I D NDN+P   +P  +      ++P +  +  +V  +   D D   +  ++ + ++   +     N   G +  N   V +      ++++ + ++  D GSP 
Sbjct:   31 VKYALYEEQPAGTLVGRLSDDLQGRVAEHPSRHFRLMRRDDFSLVHVEEADGTVSAREVIDREQ-----QCGQAPSCVIRFDVLCTLPRGL-FQLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHL-DENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCN-------------VTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSS----PVDAEVRRLFQLDP-KTGKLSLKGQLDHELNSEYEI--SIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHL--RGHPHFKLLPYRDDYVVVTN-SSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARD--DGVPPLVTNAT-------VSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERNLFRINRLGGEVFTNAASVTDAAASATRHSLVVMVR--DRGSPA 665          

HSP 2 Score: 110.153 bits (274), Expect = 1.299e-24
Identity = 140/597 (23.45%), Postives = 240/597 (40.20%), Query Frame = 1
Query: 1057 QVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAK---IRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPN-RISENDKRETVLKIFHVSDKDLISKDNI----SCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQ------WTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLT-TSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYW-FGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQK-TGEILTNWESYETLKIGI--FYLHISIYDSGTPSLSTNVYFYVNITS 2790
            +V++ D ND+ P F              SE  V  I E+  L   +    A D D G N+  AY +   + +         ++ + ++ AK   + ++  LD E + E    L + A D G P RS +  + I +LD NDN P   + S N  + E+    TVL   + +D D      +    S  +  E +R F+L         L+     D+E +    + +   D     +       + + D NDN P+         +   V V E +    F+  V  +D DS + G +  ++         +F  + +++  V +T +S+DRE   Q+     V +  D          QF      T+ + D NDN PR+        + EN    + V  +   D D   + ++    +ESE      S Y      +  I+    L+ E   ++T ++QA D+G P   T   +   I+D NDN+P++  PP  +      L        ++  + A D D   N  L+Y+I+  N   ++ FRI +  GE+ TN  S            L + + D G+P+LS      + + +
Sbjct:  123 EVELLDINDHAPDFA------------RSEMHV-EISESVALGTRVPLEGARDLDVGGNALRAYHLDENERF-------GLALRARTDGAKYAELVVKSRLDREQEGE--YTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTG---KLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLR-----GHPHFKLLPYRDDYVVVTNSSLDRE---QMADYFLVLEASDGGTPPRVAARQF------TVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGN--ERNLFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPALSATAAIEIRVGA 678          

HSP 3 Score: 84.3445 bits (207), Expect = 9.622e-17
Identity = 102/468 (21.79%), Postives = 175/468 (37.39%), Query Frame = 1
Query: 1432 VSLTINLLDINDNFPQITEKSPN-RISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIP--FDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPR------YPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIV---NNTIFVKN-ELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPIL-KSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHS---FRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNI 2784
            V   + LLDIND+ P       +  ISE+    T + +    D D+      + +L E  +    L            ++    D E+    T+QL   D  +P  + TT  +I + D NDN P + Q   +V V E +     ++ +NATD D    G++ ++ +     +     ++D + G + L   +D E   +  Y I++    D  P      +      K+ + ++DINDN+P         S+     + E     S V  +   D D   + +V               +  F ++   ++ + V N  L+RE   +  L L+A D G+P R         +LD NDN P   +S    S + N            +  + A D D   N  + Y ++ S +          I  +   +      +   +      +   D G P L TN    V I
Sbjct:  120 VHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSE--YEISIQAR-DMGP------SSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHL---------RGHPHFKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLEN------NSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRI 563          

HSP 4 Score: 60.4622 bits (145), Expect = 2.031e-9
Identity = 85/433 (19.63%), Postives = 164/433 (37.88%), Query Frame = 1
Query: 1576 DNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQL--------ICIDKAEPELT------QTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVY----LTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKF---IESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSP------ILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGE---ILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNI 2784
            D++   ++E   R F+L +   D ++L ++   D   S  E +           C+ + +   T      Q  + ++E+ D ND+ P + + E HV + E       +    A D D    G         D  + F        +G  Y    + + +DRE+  +    +T  D  D            S  T + I + D NDNSP +     +  + E+    +++  L   D DE P+  V   F   +++E +      +        + +K +L+ E  +   + +QA D G         +   + D+NDN+P      I++S  +  F+     + S      +  +   D D   N      ++  +L     F++    +   ++TN  S +  ++  ++L +   D GTP       F V +
Sbjct:   50 DDLQGRVAEHPSRHFRLMRR--DDFSLVHVEEADGTVSAREVIDREQQCGQAPSCVIRFDVLCTLPRGLFQLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLD---VGGNALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGD---------PPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRL----FQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYES-----FVGLVTVSDIDSAENG-----LVACHLRGHPHFKLLPYRDDYVVVTN-SSLDREQMADYFLVLEASDGGTPPRVAARQFTVRL 453          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.214 bits (378), Expect = 1.007e-36
Identity = 183/760 (24.08%), Postives = 317/760 (41.71%), Query Frame = 1
Query:  502 TIIGSLLQSENSQNTKISFNNVVLRSYSDLFKID-SKGNLTTLTHIDRDDIC---IRLSCCKDSICTIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYE----NQEERHIILVILATDNGKP---QRSASVSLTINLLDINDNFPQITEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLS---EESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVT-DNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYW-FGIVNNTIFVKNELNREHKNNI-TLRLQAEDNGSP---KRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRI-QKTGEILTNWESYETLKIGIFYL 2718
            T++GS+  S    N  +++  +V       F I+ S G + T   IDR++     +R+      +      +VL+              D N++ P F      ++I E   + S +    A DKDS  NG  +Y + + +    +  I  +  + +   LDRET E Y+L++   +   +  S+S+   V V D NDNKP F              S S+V +  E Q +   + +  A D D G N  + YS        P V     + E  SET +I      D E              ++ATD G+P   Q  A+V + +   D+NDN PQ   KS  + S ++    + ++  V+  D+    N +   +        KF +      +  L ++   D E++   T+ +   D     L  +    +++ DENDN P++T+    V+  E +   + +I + A+D D+   G + + I   +   TF    ID   G+V+L   +D E   Q +Y + V+ ++  R P         S+ T L + ++D NDN P +        I EN+PI + V  +   D    P   V  +   S ++ F    ++     +  I    E++RE    +  + ++A D   P   +R    N+   + D NDN+P   +P   + I    L A+     ++  ++A DPD   N+ + Y +   +      FR+ ++TG I T+ E       G F L
Sbjct:  675 TLVGSVSASTLDLNANVTYL-IVSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGGVAGEASVSVLV-------------HDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFG-IFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLF-------------NSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEK-----PQV-----NFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQ--DVNDNPPQFA-KSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSL---DREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFA---IDRSTGSVFLARRLDFET--QRLYRLNVSAEDGGRPPR--------SSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARD----PDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTP---TAILVDGLRAAA--GSVVGTLQASDPDEAENAAVRYAVTGGDAAIL--FRLDRRTGIIETSTELDRESGHGAFTL 1366          

HSP 2 Score: 143.28 bits (360), Expect = 1.409e-34
Identity = 130/554 (23.47%), Postives = 230/554 (41.52%), Query Frame = 1
Query: 1123 YIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKS-PNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHE------TVQLICIDKAEPE-LTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAK----IEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTP 2748
            + P+    S+ + I E++ ++   +S  A D D G+N ++ Y I   +         KF I       ++ +R  LD E +EE    L + A D G    S+SV++ + +LD+NDN P     S      E  +  +++     +D D  S   ++ +  E+ +  F+L      + +L     FD E    +      +  ++  D   P+ L      ++ + D NDN PQ+ +  Y  +V E +++   +++V A+D D    G L + I E +    F    +D   G + L  S+DRE        ++ TD         +  +  +    + + + D NDN PR+          E+  +  ++  L   D+D  PS  V    +   +     + +       ++F+   L+ E +    L + AED G P R +   L   + D NDN P        +F+P  ++FAS  +N  I      + A DPD  +N  L+Y I        H     ++GEI T  E    +  G+F + +   D   P
Sbjct:  754 HAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNG------GEKFGI---FPDGQLYVRYELDRETREEYS--LTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSF-EKPQVNFELDSETGRIASLRV---FDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFT---VDASTGQITLLGSLDREETASYTLVVSATD---------SGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTH----ATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPP--------AFLPG-DVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIP 1267          

HSP 3 Score: 125.561 bits (314), Expect = 4.390e-29
Identity = 151/692 (21.82%), Postives = 259/692 (37.43%), Query Frame = 1
Query:  736 EIILNIKDENDNRPTFVSPLTV-INIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEP-------HMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQI------TEKSPNRISENDKRETVLKIFHVSDKDLISKDN-ISCNLSEESKRKFKLTKHFWDVYNLNNI---IPFDYEKSRHETVQLICIDKAEP-ELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNK----IIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSG 2742
            E+ + + D NDN P+F  P  + +   E A +     L  AVD+D   NG++ ++    S      L+   P       H+    PLDRE    Y L++   +         L   V V D NDN P F                ++   + E+  +   +     L    G                        ++    +T  +  R  LD+E +  R   L + A D G P  S   +  I LLD+NDN P I             + E+    TV  +  V+D D  + +  +S ++   ++R      H   V  L  +      D E+     + ++  D  +P   + T +  + + D ND+ P++    Y   + E + +  ++  V A D+DS    KL ++I   +      +  +D   G V     +DRE    +V NI+  D               +  T LT+ + D+ND  P +   K      EN      V  +   D D   +  V   F       + E  +    +   +     L+RE      L +QA+D GSP   +   +   + D+NDN P+        F P  + FAS  +N+     +  + A DPD G N T+ Y++   +      F++      ++   S +  +  ++ L ++  D G
Sbjct:    8 EVRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAF-------------EKPAYRASVAEDSPVGAALRDL--LHRGRG----------------------PLAVPFDPKTGMVSTRQPLDFEAR--RQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERG-HFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGN---DLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQ---------GAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREM-FRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPV--------FYP-VQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAAR---FQVNAVTGAVSTRVSLDREERAVYQLQVTALDGG 634          

HSP 4 Score: 122.479 bits (306), Expect = 3.080e-28
Identity = 124/565 (21.95%), Postives = 226/565 (40.00%), Query Frame = 1
Query:  514 SLLQSENSQNTKISFNNVVLRSYSDLFKIDSK-GNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAE-----LQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYS-----LIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQR-SASVSLTINLLDINDNFPQITEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIP-------FDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRY 2151
            S   ++  QN  ++++  VL      F +D+  G L     +DR++    L   + S  T          ++    + + ++D NDN P F       ++ E A       +++    +A D DS   G   Y+L+ PS   +++     L      + + +PLDRE+   Y L     +      +  L+  V V D NDN P                ++S    + E+      +    A D+DEG N+++ +SISS D         +F++ +  + +  R    LD E Q   ++++ +       P R S++V +++ L D+NDN P  T        E+     V+      D D      +   L+ + +            + LN +          D E  +   + ++ +DK  P LT T    + + D NDN P++ ++EY   + E       +++++A D D    G+L ++I   D    F   R+D   G + +   +DRER     Y + V       P         S+   + + + D+ND SP +
Sbjct: 1539 SATDADQGQNALVTYS--VLSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASDGT----------HATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALA-PSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLY--VNVLDANDNAPSV-------------QNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDP------EGRFAVGNDGQLSVARA---LDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDF---RLDPVLGTLAVARPLDRERTAS--YELAVRARDGGGP-------ARSDTASVRVTLSDVNDCSPAF 2054          

HSP 5 Score: 117.857 bits (294), Expect = 8.298e-27
Identity = 142/629 (22.58%), Postives = 249/629 (39.59%), Query Frame = 1
Query:  724 SISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQI-TEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIV-NNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNY 2604
            S +  +++ + D ND+ P F        + E A   S  K   A+D DS  N   RYS+   ++   +S+  +   +T    +DRE      L++   ++  Q  +      V + D ND  P F                 +V    EN      + S  A D+D GEN  + Y+    D   P      F ++  S T K+    +LD E  EE    LV+ A D G P   ++  +T+ + D+NDN P     +    I EN+   T +     +D D  +   +   L+     +F++      V   +  +  D E+     +Q+  +D             I + D  D  P + + +Y   V E       +  V+A+  D      + + I   D   +F+   I+   G ++   +IDRE   Q  Y + V            N    + +  +++ + D+N+++P +        I E+ P+NS    +   D D   +  V  +  E            FGI  +  ++V+ EL+RE +   +L + A D G     + V ++  +LDVNDN P+  S   +S++         E   ++  ++A D D G N  + Y
Sbjct:  322 SATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTK-------------YVATAVENSLPGLFVVSVSAADSDLGENGTVRYNF---DPDMPAQYREMFRLD--SLTGKVTTLKSLDREELEE--YPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAV---STRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNA--NVTYLIVSGDQRGSFS---IEWSGGRIFTANAIDREE--QAFYQLRVV----------ANSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEG------NGGEKFGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNS---SSYV--FHFCEEQEVGSLVGAVQATDADAGSNGGVTY 899          

HSP 6 Score: 115.546 bits (288), Expect = 4.251e-26
Identity = 134/602 (22.26%), Postives = 230/602 (38.21%), Query Frame = 1
Query: 1057 QVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYI--KENQTLSQEIYSFHALDNDEGENS--KIAYSISSRDS----YPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQ-----WTQKEYHVNVEECSNSNKFIIKVNATDSDSEKF-GKLYFNITEADIPKTFNFIRIDHQNGNVYL-----TTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVK--NELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKI----IAKIEADDPDYGLNSTLNYKILHSNLTN-KHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNI 2784
            +V V D NDN P F               E  V+ +  KE+  + +++    A+D D G N     AY I S +      PP  VT +         A + L      + +      L + A D G P+R   + + + + D NDN P   EK   R S  +       +     +DL+ +      +  + K     T+            P D+E  R  T+ L   D   P L+      I++ D NDN P              +V+E +        V  TD+DS    G+L  +I   +    F    + H  G   L      + +DRER P  +YN+T+  + +  P         S    L + + D+ND++PR+        + E  P  S V+ +  +D D   +  +    +            WF +  +T  V    +++RE  +++ L + A+D G+  +  + +L   +LDVND  P+            T+  A+  +N +    +  + A D D G N T+ Y          +  FR+      +T  +S +  ++  + L +   D G+P L +     V +
Sbjct:   10 RVVVGDVNDNAPSF--------------PEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKR---------AFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAF-EKPAYRASVAEDSPVGAAL-----RDLLHRGRGPLAVPFDPKTGMVSTRQ-----------PLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHF----VLHAPGVPGLRVLKVASQLDRERIP--MYNLTILASDNGKP------VARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLG------WFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFT---------QTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVV 544          

HSP 7 Score: 115.546 bits (288), Expect = 4.626e-26
Identity = 175/708 (24.72%), Postives = 280/708 (39.55%), Query Frame = 1
Query:  718 PNSISYEIILNIKDENDNRPT----FVSPLT-VINIPESAELQSLYKLPMAVDKDSP-GNGIDRYSLSDPSNTFNYSLIH--NEPHMTLIK---PLDRETIEIYNLSLYVYEKQRQMF-SNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITE-KSPNRISENDKRETVLKIFHVSDKDLISKDNISCN----LSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWE-SYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNIT 2787
            P S     ++ + D NDN P     ++ P     ++ ESA   ++  L    D DSP  NG    S+    N   + ++H    P + ++K    LDRE I +YNL++   +  + +  S +    V V+D ND+ P F                       E       +    A+D D G N+K+ YSI S +          FS++    T  +     +D E      ++L I A D G   ++A  SLT+ LLD+ND  P  T+ K      EN      +     +D DL     +  N    +  + +  F+L      V  L ++   D E+     + +   D+  P L  T    + + D NDN P +   +Y  ++ E       +  V ATD D    G + + +T  D  +     +++   G V    S+DRE   + VY + VT     H        +  +   +TI + D  D  P +      F + EN+   ++V  +     D   +NV  L  I S  Q    S  W G     IF  N ++RE +    LR+ A   G     +   L   + DVN+++P+         I   E       N     + A D D G N  + Y+I   N   K  F I   G++   +E   ET +   + L +S  D+G   LS++V   VN+T
Sbjct:  204 PLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVG-GNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAAL-------------SEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDL------GWFSVD--ESTGLVTTDGKVDREVASS--VVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSL---DREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAAR----FQVNAVTGAVSTRVSLDREE--RAVYQLQVTALDGGH-------LRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLD-LNANVTYL--IVSGDQRGSFSIEWSG---GRIFTANAIDREEQAFYQLRVVANSGGVAGEASVSVL---VHDVNNHAPVFDRASYEVSIAEDEPV-----NSRFFSVRATDKDSGKNGEVKYEIGEGNGGEK--FGIFPDGQLYVRYELDRETRE--EYSLTVSAMDTGVEPLSSSV--TVNVT 851          

HSP 8 Score: 108.997 bits (271), Expect = 4.206e-24
Identity = 123/519 (23.70%), Postives = 219/519 (42.20%), Query Frame = 1
Query:  496 KETIIGSLLQSENSQNTKISFNNVVLRSYSDL---FKIDSK-GNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAE-LQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFV-IYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSP-NRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHET-----VQLICIDKAEPELTQTTNFK---IEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRE 2007
            +E  +GSL+ +  + +     N  V  S+      F++DS+ G + +L   DR+ +  +      S   +        P      + + ++D NDN P F   +   ++ ESA  L  L ++  A D D   NG  RY++++ +    +++  +   +TL+  LDRE    Y L +   +      + S    V+V D+NDN P F              +ES + +   E+  + + + +  A D D G +  + Y+I + +++        F+I+    T  + L   LD+E Q  R   L + A D G+P RS++  L +++ D NDN P          I EN    T +      D D     +++  L     R+F    HF  +   +  I    E  R  T     V +   DKA P  T+ +  K   + + DENDN P++      +     + +   +  + A+D D  +   + + +T  D    F   R+D + G +  +T +DRE
Sbjct:  873 EEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRV-TASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRF--------------TESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTH------ATFAID--RSTGSVFLARRLDFETQ--RLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDA----DVNGELHYSIARQFPPGAHFT-IDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVTGGDAAILF---RLDRRTGIIETSTELDRE 1358          

HSP 9 Score: 103.219 bits (256), Expect = 2.768e-22
Identity = 147/615 (23.90%), Postives = 242/615 (39.35%), Query Frame = 1
Query:  736 EIILNIKDENDNRPTFVSPLTVINIPE-SAELQSLYKLPMAVDKDSPGNGIDRYS-LSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIY---IKENQTLSQEIYSFHALDNDEGENSKIAYSIS-SRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFP---------QITEKSPN-----RISENDKRETV---LKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNIT------EADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKF-IESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPP 2490
            ++ ++++D NDN P F  P   + + E + E + ++ L  A D D   N +  YS LS     F          +   + LDRE    Y L++   +      +      V V D NDN P F             ++ SF +      + +T    I +  A D D G   ++ Y+++ S DS   +     F +     T  + +   LD E++     +L   ATD G    +A+  L +N+LD NDN P         ++ E +P      RIS  D  E V   L+ F +S  D   +  +  +      R     +  +  YNL   +    +++RH   +L          +      + + D NDN P +T     +  E+ S     +  V A D DS +   + + +                   ++   G V L   +DRE   +  Y +TV       P   +  T       L + + D NDN+PR+P ++    I E+ P  + V +L   D DE  +    L++ I S   T D   +    V  T+ V   L+RE   +  L ++A D G P R    ++   + DVND SP  +  P
Sbjct: 1501 QVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTL-SATDADQGQNALVTYSVLSGSEGAFVVDAASGV--LRASRRLDREERASYLLTVRASDG---THATDARLSVAVRDANDNSPRFS-----------RHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDS---DWADGAFGLHP--VTGALNVTRPLDRESRA--CYVLRARATDGGG--LAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELE-FSISSGDPEGRFAVGNDGQLSVARALDRERQSF--YNLVVRV---SDRARHPPARL----------SSAVRVSLILTDVNDNAPAFTSPRSALAPED-SPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREA--RQSYALTVLAVDKGRPPLTSTAT-------LAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANG--ELRYDIASGDPTGD---FRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSP 2058          

HSP 10 Score: 91.2781 bits (225), Expect = 1.024e-18
Identity = 71/319 (22.26%), Postives = 135/319 (42.32%), Query Frame = 1
Query: 1732 PELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKI-----PENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNG--SPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEI 2667
            P ++     +I + D NDN P +   E  + VEE +   + I  ++ATD+D  +   + +++    +  +     +D  +G +  +  +DRE     +  +  +D               +   +L++ ++D NDNSPR+      F +     P+     +++  +   D D  P   VT     SE   + +  +    V   + V   L+RE +    LR +A D G  +   R +VN    +LD NDN+P ++   N+S     E+         + +I A D D G+N+ L + I   +   +  F +   G++
Sbjct: 1494 PPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSV----LSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASDG------------THATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLYVN----VLDANDNAPSVQ---NDSLA--AEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGR--FAVGNDGQL 1785          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 207.608 bits (527), Expect = 4.111e-54
Identity = 188/681 (27.61%), Postives = 294/681 (43.17%), Query Frame = 1
Query:  751 IKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKS--PNRISENDK-RETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNI 2784
            + D NDN P F   L    + E+           A D DS  NG   YS+   +    +++      +T   PLDRETI  Y+L++   +     F  +    + ++D+NDN+P F T  S F              I E+      +    A D D G N  + Y+I S +          F ++  S    + +R  LD E        LV+ A+D G PQ+S + S+ +++LD+NDN P+  EKS     I E+     TVL++  V DKD  S   I+ +LS E    F +    +    + +  P DYE +    + +   D   P  + T   KI I + NDN+P +       ++ E    N  ++K+NATDSD      L F+I E +   +F   +ID  +G + +   +DRE        +  T+   +      N          TI + D+NDN+P +        + ENLPI   V K+   D DE  +  VT +    ++  F E N   G+V      K  L+RE + + +LR+ A D+G P +     +   I D+NDNSP      +   +  TE   +T     I ++ A DPD G N  + Y I+  N  N  +FRI  T   +T     +   +  + L IS  DSG P   +  +  + +
Sbjct:  675 VDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTF-TGPSRFN-------------ISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQ------GNSFQLDPRS--GILSVRSTLDRETIPS--YTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRF-EKSLFSGEIREDASVHSTVLQV-KVEDKDEGSNGAITLSLSGEGSDNFTIDSTGF----VLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDGTP---LTFDIVEGNAGSSF---KIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNN---------ATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKF-EVNPATGLVT----TKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQ--SKYTLTVTE---NTANGSNILRVLASDPDAGANGRVTYSIISGNHGN--AFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITV 1298          

HSP 2 Score: 197.208 bits (500), Expect = 6.578e-51
Identity = 172/680 (25.29%), Postives = 306/680 (45.00%), Query Frame = 1
Query:  739 IILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKS-PNRISENDKRETVLKIFHVSDKDLISKDNISCN-LSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKI----IAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLST 2760
            I L I D NDN P F      + + E+    S     +A D D+  NG   YS+   ++   + +      +T++  +DRE +  YNL++   +     + ++ F  + V+D+NDN P F +  + +              I E  ++   +    A D DEG N+++ YSI   D       T+ F+I + +    ++  +N     +      L I A+D G P  ++   LT+ + D+NDN P    +S    + EN  + T +      D D+ +   +  + +S   +++FK+      +       P D+E+     +++   D    + T  TN  I + + ND  P +TQ+ Y  +V E S ++  ++KV+A+D DS  FG L ++I        F+   ID ++G +     +DRE        + VTD    +P         SN T +TI I D NDNSP++ S      I EN   +S   KL   D DE  +  +T     +++       +  G  +  I +   L+RE+K+   L +QA D+G+P + + + +   ++D+ND+ P++ S         + L  S  +N+     + +I A D D GLN+ L + +L +   +K  F +  T   ++     +  +  ++ L I + D G PSLS+
Sbjct: 1189 ITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYG-------------IDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGD-------TSAFAINAMNGVLTVKKEIN----RETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTT---PLDFEEKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDS--FGSLSYSIVGGKDSDKFS---IDQRSGIISTADVLDRELVSLYAIQVRVTDA--GNP-------PLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDA-------FMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINS---------SSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNE--HKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSS 1806          

HSP 3 Score: 164.081 bits (414), Expect = 9.317e-41
Identity = 177/684 (25.88%), Postives = 296/684 (43.27%), Query Frame = 1
Query:  739 IILNIKDENDNRPTFVSPLT--VINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIY---IKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKS-PNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNII----PFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLST 2760
            +++++KDENDN P F  PL   V NI E+     +  +  A D+DS  N    YSL    N F  +    E  +  + PLD ET + Y + +  ++ +   F       + V D NDN P+F                +  +Y   + E+  +   +    A+D D G N++++YS+ S D       T+ F+++S      IR +   D E +    + L   A D G P RS   ++ I +LD+NDN P  +       + E+      +     SDKD  + +N     S  S      T H + +  +  ++      D+E+     + L   D+  P LT T++  I + D NDN P ++   Y   V+E + +     +V+ATD DS   G L F I + +    F    ID   G + +  S D E   +  Y++TV    DR      +  Q      +TI I+D+ND+SP +       +IPE+  I S V  +   D D  P   +  + I    +      +     + +I V +EL+RE   + +L+++A D GS  R +   +   + D+NDNSPI + P    ++    +  S+     I ++ A D D   N  + Y +      N   F I  +  ++T     +  K   + + ++  D GTPS S+
Sbjct:   56 VVIDVKDENDNAPEF--PLNSYVFNIRENTPAAQV-AIVTATDRDSGTNAAITYSLFSGENKFMMNSKTGE--IRTVTPLDHETKDSYTMRISAFDGKHTTF----VPLITVDDVNDNAPFF----------------ALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGD-------TSYFTVDS---QGVIRTKGAFDRETKASYQVAL--RAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKD--NGNNADLRYSFTSGN----TNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRDSSTNGALVFGIIKGNDDGVFT---IDGSTGIISIAKSPDYEN--KTRYDLTVQAR-DRGVPVKYDTAQ------VTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVK----GAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGP----YV--FRVSESSSPGHQIGQVAATDADDSSNGDVRYALSD----NTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSS 667          

HSP 4 Score: 154.836 bits (390), Expect = 6.441e-38
Identity = 175/695 (25.18%), Postives = 297/695 (42.73%), Query Frame = 1
Query:  739 IILNIKDENDNRPTFVSPLTVI-----NIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIP-------FDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWE-SYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNI 2784
            +++N+ D NDN P F SP         N P   ++        A D+DS  NG   + +   ++   +++  +   +++ K  D E    Y+L++   ++   +  ++    + + D ND+ P F          P NYS+     I E+  +   + +  A D D G   ++ Y + S +      V   F+I++ S    IR+   LD E        L + A D G   RS+S  +TI L DINDN P        R+SE+      +     +D D  S  ++   LS+ +           DV+++N            DYEK     V +   D   P  +  T  K+ + D NDN PQ+ +  Y   V E   +   +  V ATD+DS   GK+ ++I   +    F    +D   G +     +DRE      Y++T+  N D     + ++ +F   T + I I D NDN P + +  + F I E+ P  + V +L   D D  P+  VT   I        + +   GI++    V++ L+RE   + TL ++A D GSP++    ++H  +LDVNDN+P  +       + + E+      +  + +++ +D D G N  +   +      N   F I  TG +L+     YET     + L ++  D G+PS S      + I
Sbjct:  362 LLINVNDINDNPPVF-SPSAYQSRVKENTPAGTQVS-------ATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFS---------PSNYSKQ----IPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGN------VKGAFNIDANS--GSIRVSSELDRETTPSYS--LQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNT-----------DVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAF---AMDRFTGEITTRVPLDRETIAS--YSLTI--NAD-----DGSLVRFMAATTVNISIADENDNQPTF-TGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGILS----VRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKS-----LFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDN---FTIDSTGFVLSKTPLDYET--TAAYQLTVTARDGGSPSKSATAQVKITI 987          

HSP 5 Score: 154.066 bits (388), Expect = 1.272e-37
Identity = 158/648 (24.38%), Postives = 268/648 (41.36%), Query Frame = 1
Query:  736 EIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKS-PNRISENDKRETVLKIFHVSDKDLISKDNISCN-LSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILT 2673
            ++ + I+D ND+ P F        IPES  + S      A D DS   G   Y L   +    +++  N   + +   LDRET   Y+L +   +      S+S    + + D NDN P F                 +V  + E+ +   +I    A D D+  N  + Y++S          T  FSI   + T  I L+  LDYE + +   ++ + A D G P RS+   + + + D+NDN PQ  +      + EN      +     +D D  +   IS + LS      F + +   ++      +P D E     ++ +   D +       T   I I DENDN P +T      N+ E S +   + ++ ATD D    G + + I   +   +F   ++D ++G + + +++DRE  P   Y + V  +    P       Q S    + + + D+NDN+PR+       +I E+  ++S V +++  D DE  +  +TL      S  F   +  F      +  K  L+ E      L + A D GSP +     +   I++VNDN P   SP   + IP          N  + K+ A D D    + L + I+  N     SF+I ++  +++
Sbjct:  463 QVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIF--------------QGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDN--------TDVFSIN--TSTGLITLKTQLDYEKKTQ--YMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTR---VPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPS-RFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSF---QLDPRSGILSVRSTLDRETIPS--YTLVVKASDAGSP-------QQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTIDSTGF------VLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAI-----NTHVVKLNATDSD---GTPLTFDIVEGNA--GSSFKIDQSSGLIS 1052          

HSP 6 Score: 149.058 bits (375), Expect = 4.762e-36
Identity = 170/677 (25.11%), Postives = 283/677 (41.80%), Query Frame = 1
Query:  739 IILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRISENDKRETVLKIFHVSDKDLISKDNIS-CNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNT---ELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLS 2757
            + + ++D NDN P F  P  V  + ES+          A D D   NG  RY+LSD  NT  +S+  +   +TL   LD E    Y +++   +      S+    +V V D NDN P F                 +   + EN      +    A D D G N KI+YSI S +          F+++    T +I  R+ LD E        L I A D    +  A+ ++ I++ D NDN P  T  S   ISE+    T +     +D+D+     ++   +S      F+L      + ++ + +  D E     T+ +   D   P+ + T +  + + D NDN P++ +  +   + E ++ +  +++V   D D    G +  +++      + NF  ID   G V   T +D E      Y +TVT      P         S   ++ I I ++NDN P + S      IPE++ IN+ V KL   D D  P   +T   +E  +     S++     +  I V   L+RE   N TL ++A + GS     + N    +LDVNDN+P+        F P +    L  +    + +AK+ A D D G N+ + Y++   ++ +   F +     ++T     +      + L ++  D G PS S
Sbjct:  569 VTIALQDINDNSPIFQGPY-VFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSD--NTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFA-------------KSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNE------NMAFAMDR--FTGEITTRVPLDRETIASYS--LTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSG-ILSVRSTL--DRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGE---GSDNFT-ID-STGFVLSKTPLDYET--TAAYQLTVTARDGGSP-------SKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDGTP---LTFDIVEGNAG----SSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPV--------FNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYEL---SVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQS 1184          

HSP 7 Score: 147.517 bits (371), Expect = 1.255e-35
Identity = 159/655 (24.27%), Postives = 290/655 (44.27%), Query Frame = 1
Query:  529 ENSQNTKISFNNVVLRSYSDLFKIDSK-GNLTTLTHIDRDDIC---IRLSCCKDSICTIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKS-PNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNT--IFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSP 2472
            +   N +++++ ++  ++ + F+IDS  G +T +  +DR+ +    + +S     +     TA           + + + DENDN P F S  T   I E   + S   +  A D+D   N    YS+    +T  +++      +T+ K ++RET+  Y L++   ++   M ++     V V+D NDN P F              S+S++  ++EN   S  + +  A D+D G N+ + YSI S +         +F I S S    I     LD+E  E+    L + ATD+   + +A  ++TI ++++ND  P  T+++    + EN    T +     SD+D     + S    ++S  KF + +    +   +     D E      +Q+   D   P L+  T   I+I DENDN P++    Y  ++ E S  + F  K+ ATD+D     ++ +N++  D         I   +G + L   +DRE   +  Y++ +       P   ++IT       + + + DIND+ P   S      + EN P  + V ++   D D   +  +T   + +E ++       F + N T  I  K  L+RE +   TLR+   D G+P   +  ++  +++D +DN P
Sbjct: 1231 DAGANGRVTYS-IISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAF----------VAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVR-GDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVF-------------NSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEK------RFKINSTS--GVIMTTTPLDFE--EKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSD-KFSIDQRSGIISTAD---VLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDA------FMIGASSGVITLAQPLDREN--KSTYDLAIQARDHGTPPQASSIT-------IRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSV------FTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCP 1822          

HSP 8 Score: 122.865 bits (307), Expect = 4.045e-28
Identity = 145/601 (24.13%), Postives = 249/601 (41.43%), Query Frame = 1
Query:  892 YSLSDPSNTFNYSLIHNEPHMTLI-KPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKS-PNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSF-IPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQK-TGEILTNWE 2682
            YS+ D ++   +++  +   +T   +  DRE+   Y L++   +   +         + V D+NDN P F          P+N   S+V  I+EN T + ++    A D D G N+ I YS+ S ++        KF +   S+T +IR    LD+E ++     + I A D    + +  V L I + D+NDN P          + E+    ++++     D D+     +S +L       F +         +     FD E      V L   D   P  +     +IEI D NDN P ++  +Y  +V+E       ++ V A+D D+     L ++ T  +    F    +D   G V ++ S+D E+       ++VTD               ++ + L I++ DINDN P +       ++ EN P  +   ++   D D   +  +    I+      D+  +        I +    + E+K    L +QA D G P +     +   I DVND+SP+  SP N S  IP + +  ST     +  + A D D G    L Y+++  N+  K +F I   +G I  + E
Sbjct:    1 YSIMDGNDQGMFTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEF----------PLN---SYVFNIREN-TPAAQVAIVTATDRDSGTNAAITYSLFSGEN--------KFMMN--SKTGEIRTVTPLDHETKDS--YTMRISAFDG---KHTTFVPL-ITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDSQGV----IRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFT---LDAVTGVVTVSRSLDFEQRSSYALGLSVTDR---------GSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRDSSTNGALVFGIIKGN----DDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVF-SPSNYSKQIPESTVIGST-----VVTVTATDLDSGPRGRLEYRLISGNV--KGAFNIDANSGSIRVSSE 540          

HSP 9 Score: 120.168 bits (300), Expect = 3.093e-27
Identity = 173/765 (22.61%), Postives = 304/765 (39.74%), Query Frame = 1
Query:  541 NTKISFNNVVLRSYSDLFKIDSKGNLTTLTHIDRD-----DICIRL----SCCKDSICTIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSI--SSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRISENDKRETVLK--IFHVSDKDLISKDNISCN---LSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIES-ESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNI 2784
            N ++S++  ++   +  F +DS+G + T    DR+      + +R     S  +    T++                + I D NDNRP F S     ++ E   + +      A DKD+  N   RYS +  +    ++L      +T+ + LD E    Y L L V ++     +++    + V+D NDN P F          P  Y       +KEN     ++    A D D   N  + + I   + D          F+I+    T  I +  + DYEN+      L + A D G P +  +  +TI + D+ND+ P     SP+  S+     TV+   +  V+  DL S          +S   K  F +  +   +   + +   D E +   ++Q+   D      + +T   I + D NDN P + Q  Y   V E S+    I +V ATD+D    G + + +++       +   I+   G + L T +D E+  Q  Y +TVT      P         S+ T + + + D+NDN P++        + ENL     V  +   D D   +  ++   +   E+  F    +        I  +  L+RE   + +L + A+D    +      ++  I D NDN P    P  + F     +   +     + ++ A D D G N  + Y I+  N  N  SF++     IL+   + +   I  + L +   D+G+P  S     +V++
Sbjct:  200 NARLSYS--LVSGDTSYFTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVE----------------IEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFS---------PSAYQS----RVKENTPAGTQV---SATDRDSSTNGALVFGIIKGNDDGV--------FTID--GSTGIISIAKSPDYENKTRYD--LTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVF---SPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSEL---DRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIF-QGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSD-----NTDVFSINTSTGLITLKTQLDYEKKTQ--YMVTVTAKDGGTP-------SRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRF-----TGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGP--SRF----NISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGN--SFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSV 884          

HSP 10 Score: 117.087 bits (292), Expect = 2.872e-26
Identity = 102/385 (26.49%), Postives = 177/385 (45.97%), Query Frame = 1
Query:  739 IILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKS-PNRISENDKRET-VLKIFHVSDKDLISKDNISCNL-SEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSD 1884
            + + + + ND  P F       ++ E++   +      A D+DS G+    YS+    ++  +S+      ++    LDRE + +Y + + V +      SN  +  +K+ D+NDN P F              S S+   I EN   S   +   A D DEG N++I Y++S  D++     +   ++  P           LD EN+      L I A D+G P +++S+++ + ++DIND+ P I   S    + EN  +ET V++I   SD D      ++ +L S E K  F L     D+   +  +P D E+    T+++   DK  P L+   +  I++ DE+DN P++   EY+V + E       I++V A D D
Sbjct: 1500 VTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGS--LSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKF-------------DSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDAFMIGASSGVITLAQP-----------LDRENKSTYD--LAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRIL-ASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDI---STKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASIVQVTARDID 1852          

HSP 11 Score: 105.531 bits (262), Expect = 8.293e-23
Identity = 95/375 (25.33%), Postives = 159/375 (42.40%), Query Frame = 1
Query: 1672 FDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAK----IEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNI 2784
            FD E      + ++  D A       T   I++ DENDN P++    Y  N+ E + + +  I V ATD DS     + +++   +     N   ++ + G +   T +D E        I+  D   +H  F   IT           + D+NDN+P +        + E++ + SIV +L  VD D      V +    S S    +++Y+       I  K   +RE K +  + L+A+D GSP R     +  EILDVNDN P+  S          +  AS +++  I      + A D D G N+ L Y     N    H+F +     ++T   S +  +   + L +S+ D G+P L+   +  +N+
Sbjct:   28 FDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQVAI-VTATDRDSGTNAAITYSLFSGE-----NKFMMNSKTGEIRTVTPLDHETKDSYTMRISAFDG--KHTTFVPLIT-----------VDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLD------VGINARLSYSLVSGDTSYFTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSS---------AQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGN--TNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINV 366          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 204.142 bits (518), Expect = 4.408e-53
Identity = 193/730 (26.44%), Postives = 321/730 (43.97%), Query Frame = 1
Query:  610 GNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNE-PHMTLI-----KPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQ--ITEKSPNRI-----SENDKRETVLKIFHVSDKDLISKDNISCNLS-EESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQT--FDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAK---IEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSG 2742
            G ++T   IDR+           +   I +    + P++    + + + D NDN P F +    + I ES ++ +   +  A D D+  NG   Y+++   NT  +SL     P  + +     KPLDRET + Y L++   ++            + + D+ND+ P F                S++  I EN      I    A D D G N  I Y+I   D+   N +   F ++S   T  IR + NLD+E   +      ++A+D G P ++   ++TIN+LD NDN PQ  IT   P+       SEN    T +    V+DKD  +       ++  + +  FK+   F   Y +    P D E      + L   DK  P  +      I++ D NDN P +T   Y  N+ E + +  +++++NATD D    G + ++IT  +      + ++D Q+G V     +DRE+   +   IT  D+    P         +  T +T+ I D NDN PR+        I E   I + V ++   D D   +  +T +   S++Q     E N   G+    ++ K++L+RE K+  +  + A+D+G P+  + V +   I D+NDN+P+        F P  E FAS  +N+   K   + A D D G N+ ++Y I+  N  N  +F I  +  +++   S +      F L IS  D G
Sbjct:   49 GVISTTARIDRE-----------TTTQISLQLRTLNPSNQPISVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFT-------------QNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAID-WDAIQSNSI---FDLDS--STGVIRTKQNLDFE--VKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKV--EFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGN---DLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDH-GSAPK--------TGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGV----LWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPV--------FYP-VEYFASIMENEPPGKLLQVTATDADEGTNAVISYDIIGGN--NNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGG 717          

HSP 2 Score: 140.198 bits (352), Expect = 2.030e-33
Identity = 165/686 (24.05%), Postives = 282/686 (41.11%), Query Frame = 1
Query:  739 IILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPM-AVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQI-TEKSPNRISENDKRETVLKIFHVSDKD-----LISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPN---NSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNV 2766
            +++++ D NDN P F S     NI E A+  S Y L + A D D   NG   YS++  ++   + +      +T  KPLDRE +    +++   +      + S    V + D NDNKP F  + S +K             I E  ++   +    A D D G+N +I Y ISS D+     V   F +   ++T  +  +  LD E +        +LA D+G PQ  +SV + + + DINDN P     +    I EN+    +L++   +D D     +IS D I  N    +   F +      +  L ++   D+E     ++ +   D       +T    + + ++ DN+P +  + Y+  V E       + +V AT  D  K G + + I   D P   N   +D   G + +   +DRE   Q +  +               +   S +  + I++ D NDN+P++ +      I     +  +V     VD D   + +V  +   +      E   W    +  I +  +L    +   T+++ A D+GSP + + + +H   L +N        PP    +S++  T + AS   +     + A D D G N  L Y I   N   +  F I   G++       + LK G + L +   D G PS S +V
Sbjct:  411 VLIDVTDVNDNSPAFTSNAYTANISELAQNGS-YVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRF--MKSSYKGT-----------ISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQ----VNGLFELN--TQTGVLWTKSQLDRETKSLYS--FTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLLQV-TATDADEGTNAVISYDIIGGN----NNGNFSIDSSTGVISTLASL---DHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKD--KNGSISYAIVSGD-PT--NLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVG---------TVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNA-----EGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHIT-LSIN-------HPPKFTLSSYV--THVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGN--EEGLFGIFPGGKLYIRKSLLQALK-GSYDLIVRATDGGVPSFSASV 1034          

HSP 3 Score: 127.102 bits (318), Expect = 2.457e-29
Identity = 190/792 (23.99%), Postives = 328/792 (41.41%), Query Frame = 1
Query:  472 FNLIDVTPKETIIGSLLQSENSQNTKISFNNVVLRSYSDLFKIDSKGNLTTLTH-IDRDDICIRLSCCKDSICTIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMT-LIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPN-RISENDKRETVLK--IFHVSDKDLISKDNISCNLSEESKRKFKLTKHFW-DVYN--LNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFK------IEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEA-DIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESE-SQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRI-QKTGEILTNWE-SYETLKIG--IFYLHISIYDSGTPSLSTNVYFYVNIT 2787
            F + +  PK T++G +  +   +N  IS+  +V    ++LF +DS G +  +   +DR++    L      + T+K       P S    + + + D NDN P F +   +++I  +  +  +     AVD D+  NG+ RY L+  SN      I++   +  L + L       Y + +   +       +++   + +S    N P   TL+            S+V ++  +Q LS + +   A+D D G+N ++ YSI      P       F I  P     IR  L    +   +    L++ ATD G P  SASV +TI + D ND+       +    ++EN    T++   + H  D    +KD +   +S ES        HF  DV +  +   +  D E+    T   + I +AE     TT  +      + + D NDN P +++  Y + V E S     + ++ A D+D     K ++++     + K F    I+   G ++L+ ++DRE      YN+ V     +  D  +N   +S   K+ I + D ND  P +P       I E+  I S+V  L   D D   + ++         +  FD  +         + V   L+ E      L + A+D+G     + VN+   +LDVNDN+P+  + P         +  +      + +  A D D G N+ + + +     T   +F +   T EI T      ET+  G   F L +   D G+P LST     V +T
Sbjct:  748 FTVYENVPKGTLVGRVYATTKDKNGSISYA-IVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVK-------PLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLT--SNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLS---INHPPKFTLS------------SYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSI------PQGNEEGLFGI-FPGGKLYIRKSLLQALKGSYD----LIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSR-TKDIVYSLISSES--------HFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFF----INSSTGELHLSKTLDRETTSS--YNLVV-----KATD-ASNANLYSTA-KIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVES-----ATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQP-----VTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQ--TPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVT 1469          

HSP 4 Score: 111.309 bits (277), Expect = 1.316e-24
Identity = 155/680 (22.79%), Postives = 284/680 (41.76%), Query Frame = 1
Query:  775 PTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSF--HALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLD--YENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRISENDKRETVLKIFHVSDKDLISKDNIS---CNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYP-SNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSN--LTNKH--SFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYV 2778
            P F     V ++  S  L   +   +AVD+DS  NG   YS+    N      I     + + K L +     Y+L +   +     FS S+   + + D ND++  FV  N+ F++            + EN +    + +   HALD+   ++  I YS+ S +S+        F+++  S     R+RL+ +   +N      I+   A  N    +     + + + D+NDN P +  ++   I+ ++       +F +   D    DN       +S     KF +     +++ L+  +  D E +    + +   D +   L  T   +I + D ND  P + + +Y VN+ E +     +I +NA+D D  + G + ++I+  ++   F+   ++   G + +  S+D E   QL Y +T+T         +  +   S+   +T+++ D+NDN+P +P+Q     + EN+     V +    D D    +++    + ++ S+TF   N     +     +  E     +++  L + A D GSPK  T  ++  ++ D NDNSP   SPP           A+   +  +  I A+DPD   N  + Y I+  N    N H  + ++Q   +I  N          I+ L I   D G PS  T     V
Sbjct:  944 PKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQ-GNEEGLFGIFPGGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFV--NNTFRFA-----------VAENSSPGTLVGTLVAHALDHSRTKD--IVYSLISSESH--------FAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAP-VFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELH-LSKTL--DRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFD---VESATGRLIVAKSLDFET-TQL-YELTITAQ-------DHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTF-SVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPA----------AAAGSSLNVMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQIPDNPT--------IYQLTIQASDGGQPSRQTQTVVSV 1564          

HSP 5 Score: 92.8189 bits (229), Expect = 6.269e-19
Identity = 114/483 (23.60%), Postives = 194/483 (40.17%), Query Frame = 1
Query:  736 EIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRISENDKRETVLKIFHVSDKD------------LISKDNISCNLSEESKRKFKLTKHFWD---VYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDEN--DNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDIN 2133
            +I + + D ND RP F      +NI E A + SL     A DKD   NG+ +YS+S+ +    + +      + + K LD ET ++Y L++   +      S+++   V V D NDN P F T             +   + ++EN      +    A D D G N+ IA+S+ S+        +  FS+ S +        ++L+          LV++ATD G P+ S   S+T+ + D NDN P     SP   +        L +  ++ +D            +IS +N   NL   S  + ++     D   +Y L              T+Q    D  +P  ++ T   + +F E      P ++  +Y  +V E   +   ++ V A    S   G + + +T       F  ++     G V  T  IDRE      +N+ V     + P   T      +   +TI ++D+N
Sbjct: 1249 KIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPT-------------QPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTP------SKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFV--SPPAAAAGSS----LNVMTITAEDPDRNSNGKVTYSIISGNNGYFNL-HPSTGQLQMIHQIPDNPTIYQL--------------TIQ--ASDGGQP--SRQTQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTSDSSKGGFEVVK---STGVVKTTRGIDREGM-GASFNLVVYAVDKQGPSART------SSATVTITVQDVN 1677          

HSP 6 Score: 55.4546 bits (132), Expect = 1.539e-7
Identity = 59/232 (25.43%), Postives = 99/232 (42.67%), Query Frame = 1
Query: 1933 PKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIV----NNTIFV--KNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKI 2610
            PK F F   +   G +  T  IDRE   Q+   +  T N    P              + + + DINDN PR+P+     +I E++ +N+    +    D +  +N      I S   T   + +  G       +T+ V  K  L+RE  +   L + A D G+P    +  ++  ILD ND++P+      NS++ +  +  +T+    I ++ A D D G N  + Y I
Sbjct:   39 PKQFGF---NSNTGVISTTARIDRETTTQISLQLR-TLNPSNQP------------ISVQVQVDDINDNEPRFPTLYYTLRIRESMDVNT-TNPINTATDPDAGNNGTVDYTIASGDNT---ATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFT---QNSYLGS--IAENTKPGVSILRVSAADRDSGSNGDIKYAI 245          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO34815 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN97])

HSP 1 Score: 159.458 bits (402), Expect = 8.369e-40
Identity = 151/601 (25.12%), Postives = 257/601 (42.76%), Query Frame = 1
Query:  853 AVDKDSPGNGIDRYSL-----SDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKP-QRSASVSLTINLLDINDNFPQIT-EKSPNRISENDKRETVLKI---FHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIP-FDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDN-FDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNT--IFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKIL 2613
            A D D   NG   YS+      DP +  +++L  N   +   + L+R+    YNL++   +     FS +    + V D NDN P F          P NYS +    + EN  +   +    A D D G+N+ + YS+++ DS+      TK S     E A      NLD E  +  +  L I ATD G P  R+A     + +LD NDN P+ +  +    I EN      +++      +D+D+ S  ++   L+     +F +      +    +  P  D+E++ + T  +I  D+A           I + D NDN P++        + E ++  + + +V A D DS   G+++F+I      K      I   +G V ++ S+DRE     V N++  D  +     + T          +T+ ++D+NDN+P++     +  + E + + S++      D D+  +  +          T+  S   F I +NT  + +   L+RE K   +  + A D G  +    VN+  EI D NDNSP     P   +   T++   T    I+  + A+D D G N  + Y IL
Sbjct:   28 ATDSDDGANGDVDYSIVDGNVGDPRSNSDFTLDPNTGMIKTARNLERQQTFSYNLTIGAADHGLPSFSATTRVSIVVGDLNDNNPVFN---------PTNYSTT----VFENSPVGTSLLDVTATDADSGQNAYVTYSVTAGDSHGLFRAVTKVSNHGTIEVAG-----NLDREVNDFYN--LTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHARYTGSIQENSGPGVPVQMASSIMATDRDIESNADVRYRLNGSDSIQFAVNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSEGK----FEIGRSDGVVRVSGSLDREAKAVYVLNVSAIDGSYSPREGYGT----------VTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAI----------TYSMSYPGFAINSNTGSVTITRPLDRETKQAYSFTVHARDGGGLESNVAVNV--EIGDENDNSPQF---PTVQY--QTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAIL 577          

HSP 2 Score: 140.969 bits (354), Expect = 5.115e-34
Identity = 178/744 (23.92%), Postives = 303/744 (40.73%), Query Frame = 1
Query:  466 IEFNLIDVTPKETIIGSLLQSENSQNTKISFNNVVLRSYSDLF----KIDSKGNLTTLTHIDRD--DICIRLSCCKDSICTIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLP---MAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIK-------PLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPN-RISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRER-----FPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNT--IFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNL 2625
            +  +L+DVT  +        +++ QN  ++++     S+  LF    K+ + G +    ++DR+  D         D    I  TA+ I         ++ I D NDN P F       +I E++      ++    MA D+D   N   RY L+  S++  +++    P   +I         LD E    Y   +   ++      +     + V D NDN P         ++IP     S    I E  ++ Q +    A D D G N +I +SI+S           KF I        +R+  +LD E +     +L + A D     R    ++T+ L D+NDN P+ T+ + N  +SE     +V+     +D D  S   I+ ++S      F +  +   V       P D E  +  +  +   D    E     N  +EI DENDN PQ+   +Y  +V + +     ++ VNA D D    G + + I          FI I    GN+  ++ +DRE+         V N++VTD+          +TQF++   L I + D NDN P++   +    + EN+P+ + V  +   D+D   ++ +       +          F I  +T  I ++  +NRE K N  + + A D G+P   +   +H  +LDVNDN P+  S         T    +    + + ++ A D D   N  + Y I+H  L
Sbjct:  129 VGTSLLDVTATD--------ADSGQNAYVTYSVTAGDSHG-LFRAVTKVSNHGTIEVAGNLDREVNDFYNLTITATDGGVPISRTAIAI--------ALVRILDRNDNVPKFSHARYTGSIQENSGPGVPVQMASSIMATDRDIESNADVRYRLNG-SDSIQFAV---NPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTP---------RFIP----SSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSE-------GKFEIGR--SDGVVRVSGSLDREAKAV--YVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITYSMSYPG---FAINSNTGSVTITR---PLDRETKQAYSFTVHARDGGGLESNVAVN--VEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAIL------ILPFI-IVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDH---------GVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMYSLTGGDG--------VFSIEPSTGQIRLQKAINREAKENYHVTITASDRGTPVLSSDAKVHVHVLDVNDNPPVFTS----RVYERTMSEGNAAAGEFVVQVNATDADVERNGHVTYTIMHGAL 791          

HSP 3 Score: 116.316 bits (290), Expect = 2.215e-26
Identity = 143/590 (24.24%), Postives = 241/590 (40.85%), Query Frame = 1
Query:  736 EIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQI-TEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFW---DVYNLNNIIPFDYEKSR-----HETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPE-NLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPI 2475
            E+++++ D NDN P F+       I E+A +        A D DS  NG   +S++  S    + +  ++  + +   LDRE   +Y L++   +             V + D NDN P F                +F + + E   +   I +  A D D+G N+ I YS+S    YP       F+I S   T  + +   LD E ++       + A D G  +  ++V++ + + D NDN PQ  T +    + +     T++   +  D+D+ +  +++  +         L   F    D  N+N     D E+       H  + L   D    + T      I + D NDN PQ+ Q EY   V E       +  V A D DS    ++ +++T  D         I+   G + L  +I+RE      Y++T+T +     D  T +   S+  K+ + + D+NDN P + S+     + E N      V ++   D D   +  VT   +      F   N   G+    I  +  LNRE K+  TL + A D G+     F  +   ++D NDN+PI
Sbjct:  319 EVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSEG-KFEIGRSDGVVRVSGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFT-------------KPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITYSMS----YP------GFAINS--NTGSVTITRPLDRETKQAYS--FTVHARDGGGLE--SNVAVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAI---------LILPFIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMYSLTGGD-----GVFSIEPSTGQIRLQKAINREAKEN--YHVTITAS-----DRGTPV--LSSDAKVHVHVLDVNDNPPVFTSRVYERTMSEGNAAAGEFVVQVNATDADVERNGHVTYTIMHGALGMF-TINETTGV----IRTQGVLNRESKDFYTLIVMARDQGAVPYMDFGTIDVHVIDKNDNTPI 850          

HSP 4 Score: 96.6709 bits (239), Expect = 3.066e-20
Identity = 120/504 (23.81%), Postives = 196/504 (38.89%), Query Frame = 1
Query: 1123 YIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKS-PNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNI---IPFDYEKSRHETVQLICIDKAEP-ELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSN---KFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKI 2610
            + P +Y+ +F    + + T    I +  A D+D+G N  + YSI   +   P    + F+++    T  I+   NL  E Q+     L I A D+G P  SA+  ++I + D+NDN P     +    + EN    T L     +D D  S  N     S  +     L +    V N   I      D E +    + +   D   P   T      + I D NDN+P+++   Y  +++E S      +    + ATD D E    + + +  +D  +     R       V    S+D ER     +++   D            T   +  ++ I + D NDN+PR+        I E   I   V ++   D D   +  +    I S S    E  +  G  +  + V   L+RE K    L + A D     R  +  +   + DVNDN+P    P   +F  N ++        +I    A DPD G N+ + Y +
Sbjct:    3 FTPASYNATFT---EGSSTRGVLIATVKATDSDDGANGDVDYSIVDGNVGDPR-SNSDFTLD--PNTGMIKTARNL--ERQQTFSYNLTIGAADHGLPSFSATTRVSIVVGDLNDNNPVFNPTNYSTTVFENSPVGTSLLDVTATDAD--SGQNAYVTYSVTAGDSHGLFRAVTKVSNHGTIEVAGNLDREVNDFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHARYTGSIQENSGPGVPVQMASSIMATDRDIESNADVRYRLNGSDSIQFAVNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAG---------TGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFS-INSGS----EGKFEIGRSDGVVRVSGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKP---AF--NVDVSEGVAVGSVIVNATATDPDQGSNAAITYSM 477          

HSP 5 Score: 87.4261 bits (215), Expect = 2.241e-17
Identity = 85/349 (24.36%), Postives = 147/349 (42.12%), Query Frame = 1
Query: 1714 CIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPEN----LPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKI---IAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDS 2739
              D   P  + TT   I + D NDN P +    Y   V E S     ++ V ATD+DS +   + +++T  D    F  +     +G + +  ++DRE      YN+T+T       D    I++ +    L + I D NDN P++   +    I EN    +P+  +   +   D D   +  V  +   S+S  F   N   G++   +     L+ E   N T  + A D       +   +   +LD NDN+P         FIP++     +E   I   +A++ A+DPD GLN  + + I   N  ++  F I ++  ++    S +     ++ L++S  D 
Sbjct:   86 AADHGLPSFSATTRVSIVVGDLNDNNPVFNPTNYSTTVFENSPVGTSLLDVTATDADSGQNAYVTYSVTAGDSHGLFRAVTKVSNHGTIEVAGNLDREV--NDFYNLTITAT-----DGGVPISRTAIAIAL-VRILDRNDNVPKFSHARYTGSIQENSGPGVPVQ-MASSIMATDRDIESNADVRYRLNGSDSIQF-AVNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTP--------RFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSI---NSGSEGKFEIGRSDGVVRVSGSLDREAKAVYVLNVSAIDG 413          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 154.451 bits (389), Expect = 1.212e-37
Identity = 179/732 (24.45%), Postives = 313/732 (42.76%), Query Frame = 1
Query:  586 DLFKIDSKGNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSISYEII-LNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLF----FQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKS-PNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESK---RKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKR-RTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEK---NKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSG 2742
            ++F +D  G +T    +DR+          + + T+K        +S++  I+ + + D ND  P F        I E ++  S+     A+ +D   N    YS+S   NT N  LI++   + L   +D E I     SLY+  + +   +  LF      + V D NDN P F              S S ++ + E+  +    Y+    D D G   ++++S+ S          T F+++S   T  + L   +DY N   R   L + A D G P RS++  L + ++D+ND  P     S    + E    ++   I  V   D+ S +N   + + +SK    KF L ++   ++  + +   D E      +++I ID   P  + + + K+ + D NDN P + Q  Y   V+E      ++  V+A+DSD    G + +        +   FI +D Q G +  +  +DRE     V++I  TD            +   +KT++T+ ++D+ND SP++   K    + E+LP+ S +  L   DDD+   N      I +  + F  +      V   + + + L+RE  +   L + A D G  +   T   +   +LDVNDN P+        FI  T      EK     ++A + A D D G N  + YKI++ N     +F+I +T  +++   + +      + L +S  D G
Sbjct:  645 EVFSVDGSGLITLAKLLDRE-------TQDNYLLTVKAVDGG-GQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISK-GNTDNIVLINSTGTLYLQSEVDHEKIP----SLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQF-------------NSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPG-------TLFNLDS--NTGALSLTKLIDYGNSA-RSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDS--NIIEVVATDVDSGENGRISYAFDSKVDTSKFGL-RNGGKIFIKSKL---DREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDT----QVAQFI-VDKQTGKITTSQVLDREAKASYVFSIVATDG---------GSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQ-----VTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPV--------FINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGN--TDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMG 1305          

HSP 2 Score: 152.91 bits (385), Expect = 3.032e-37
Identity = 178/677 (26.29%), Postives = 292/677 (43.13%), Query Frame = 1
Query:  607 KGNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIH-----NEPHMTLIK-----PLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKP-QRSASVSLTINLLDINDNFPQI----TEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIP----FDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTF-NFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPD 2577
             G +TT T +DR+            +    +T V       SY +++ ++D NDN P+FV   +   +    +     KL +AVD D   N    Y++   +    + LI       + +  L+       +DRE ++ Y L++   +         L   + V D NDNKP F           ++YS +    I EN  +   I    A D D G N++I YSI +     P  +   F I     T  I   + LDYE   +R  ++V+ A D G   Q S+S  + I +LD+NDN P I    T     +++EN    T +    VSD D  S  N   N++ E    +   K  +DV N  +II      D E   H  ++ +CIDK +P  T   +F+I + D ND  P++ +  Y   V E +  N  +  VNA D D     +L + I      +++ ++  ID  +G +   T +DRE+ PQ+V  + V D               S+   + +++ D NDN P +     +  + EN P  S V +L   D D   ++++    +   +  F +     G+V N+      L+ E +++ T ++ A D G   R     +H  + D+NDN P+   P + S     E F +T   + I +++A D D
Sbjct:   11 AGVITTKTVLDRE-----------KVSAYNLTIVEFSTPPKSYTVLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFRQKL-IAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSN---------VSYSGT----IPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSD--PQAI---FGIHP--TTGVIVNNVRLDYE--AKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDAD--SGKNGEVNVTLEGGDGYFSMK--FDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDR---------GSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTPFFLDPRK--GLVTNS----RTLDHEVQSSYTFQVAATDGGG--RSCNATVHVSLTDLNDNQPVFD-PSSYS----VEYFENTRIGQSICQLKAIDRD 627          

HSP 3 Score: 143.665 bits (361), Expect = 2.028e-34
Identity = 189/772 (24.48%), Postives = 328/772 (42.49%), Query Frame = 1
Query:  493 PKETIIG------SLLQSENSQNTKISFNNVVLRSYSDLFKIDSKGNLTTLTH-IDRDDICIRLSCCKDSICTIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITE-KSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQT-TNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVN---LHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYF 2772
            P++T IG      S+  +++    ++SF+  +L +   LF +DS     +LT  ID  +        +     ++       P S +  + L + D ND  P F +     ++ E+    S     +A D DS  NG   Y+     +T  + L  N   + +   LDRE IE YNL +   +      S+S   +V V D NDN P+F                S+  ++KEN+ ++  + +  A D+DEG N  + Y   ++          +F ++   +T KI     LD E +     +  I+ATD G   R     +T+ + D+ND  P+ ++ K    ++E+    + L     +D D    ++    +     + F L      V  L  + P D E +    + ++  DK   +  +T T  +I + D NDN P +  +     V E       +  V A DSD    GK+ + I   +   TF   +I+   G +    ++D E   + V  ++ TD   +         Q ++   +TI ++D NDN P +        I EN+PIN+ V  ++  DDD   ++ +         +   + N   G++  T    + ++RE  +  +L+++A D    ++    N   L   I D+NDN+P   S  N +++   E F     N  +  I A DPD G    + Y+I+  + T K S  + KTG +L    S +   +  + LHIS  D G+P L++   F
Sbjct:  817 PEDTPIGHTFYTVSVFDADSGVLGRVSFS--LLSNPGTLFNLDSNTGALSLTKLIDYGN------SARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGL-RNGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHF-------------QQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQ--------VAQFIVDK--QTGKITTSQVLDREAKAS--YVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSL-NQVTGVLTL--VSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTF---KINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQ--------QKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKINSETGLIQTT----HPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSR-NLTYVMEDEPF-----NFQVTSITALDPDTGQGGNVEYRIVSPD-TGKFSLDL-KTG-VLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLF 1527          

HSP 4 Score: 135.961 bits (341), Expect = 5.002e-32
Identity = 167/633 (26.38%), Postives = 270/633 (42.65%), Query Frame = 1
Query:  724 SISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYE-KQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSA---SVSLTINLLDINDNFPQITEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKI 2610
            +I+Y I +N+ D NDN P F++  T   +PE   + S+    +AVD D   NG  RY + + +    + +      ++ ++ LD E    Y L +   +  ++Q  ++     + V D NDN+P F                  + +I EN  ++  + +  A D+D G NS+I Y+I   DS  P      F I   SET  I+    +D E   E    L + ATD    ++     + +L I + D+NDN P+   ++   + E++     +      D D     N+   +      KF L         L  I   DYE     T+ +   D   P LT    F + + D NDN P++T+  +   V E   +   ++KV A D DS    +L ++I        F+   ID  +G +   + +DRE+  +  Y +TV      +P F        + T + I++ D NDN P++ S     K+PEN P   I      V D +Y +N   L  I S +    +  +  G     +    +L+RE K +  L +QA+D   P    F N+   I D NDN P+ +    +S I  +EL   T     I  + A D D G N  + Y +
Sbjct: 1206 TITY-IEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTF-------------DKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTI---DSQSPRA---HFKIN--SETGLIQTTHPIDREEISEYS--LKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLD---LKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFS---IDKHSGLIVTNSILDREK--KDTYFLTVHATGVSYP-FRV------SSTSVRINVMDRNDNPPKFISPVVTLKVPENSPARLIYTLT--VQDLDYGNNTKVLYSIMSGNT---DGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTI--SEL---TPPGTSILNLTASDKDSGSNGNIVYTL 1789          

HSP 5 Score: 120.168 bits (300), Expect = 3.712e-27
Identity = 179/718 (24.93%), Postives = 293/718 (40.81%), Query Frame = 1
Query:  574 RSYSDLFKID-SKGNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLI---KPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIE--------SPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPN-RISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEK--SRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNT-IFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQK-TGEILTN 2676
            RSY   F ID S G +TT T +DR+ I          + T+ +      P S +  +I+N+ D NDN P F       ++ E++   S     +A D D   N +  YS+  P+  F       +P   L+   + LD E    Y   +   +   +  + ++   V ++D NDN+P F          P +YS  +     EN  + Q I    A+D D                  P    T+F IE        S   +  I L   LD E Q+  + +L + A D G         + I +LD+ND  P  ++   N  I E+ +  +V+   H   +D  +   +  ++S+ +     L      +Y  + +   D+EK  S + TVQ    DK  P L    N  I + D NDN PQ+      V + E +        V+  D+DS   G++ F++     P T     +D   G + LT  ID     +  Y + V       P         S+   L + + D+ND SP + +      + E  P +S + ++   D D   +  ++  F        D S   FG+ N   IF+K++L+RE      L++ A D+G+P+R +  ++   + DVNDN+P  +      F+   E  A+      +  + A D D G N  + Y+      T    F + K TG+I T+
Sbjct:  435 RSYLHWFAIDPSSGMITTATDLDREQI-------PQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTPFFL-----DPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSCNATV--HVSLTDLNDNQPVF---------DPSSYSVEYF----ENTRIGQSICQLKAIDRDS-----------------PKFAITRFIIEQGNADEVFSVDGSGLITLAKLLDRETQD--NYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINSTGTLYLQSEV---DHEKIPSLYLTVQ--AKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSN--PGTL--FNLDSNTGALSLTKLIDYGNSAR-SYTLPVQAQDGGSP-------PRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAF----DSKVDTSK--FGLRNGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVAT-----YLGAVSASDSDEGSNGHVTYRF----DTQVAQFIVDKQTGKITTS 1074          

HSP 6 Score: 115.546 bits (288), Expect = 8.555e-26
Identity = 153/629 (24.32%), Postives = 267/629 (42.45%), Query Frame = 1
Query:  931 LIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAK---IRLRLN---LDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKS-PNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEP-ELTQTTNFKIEIFDENDNIP----QWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIE--SESQTFDESNYWFGI--VNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVY 2769
            L +N   +T    LDRE +  YNL++  +    + ++  ++ Q    D NDN P FV             S   V++ + ++   Q++    A+D+D G NS  +Y+I S +      V   F + S  +T       L +N   +  + +     +L I A+D G P     + L+I + D NDN P+ +  S    I EN    T +     SDKD+ +   I  ++   S  +     H      +NN +  DYE  R   + +   DK    +L+ +   +IE+ D NDN P     +T    +  V E +     + +V+ +D+DS K G++   +   D   +  F  ++ ++  + +  S+DRE            D  D  P   T       +    I++ D+ND +P++       ++ EN  +N++V  +  VD D + SN   +  I   +ES+++    +WF I   +  I    +L+RE    + L +   D GSP      ++   + D NDN P       N    N  LF ++     + ++ A DPD G NS     IL+S LT    F +     ++TN  + +      +   ++  D G  S +  V+
Sbjct:    7 LEYNAGVITTKTVLDREKVSAYNLTIVEFSTPPKSYTVLVYVQ----DLNDNSPSFVR----------GTSAKLVVF-ENDKDFRQKLI---AVDSDFGSNSTQSYTIVSGN------VGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNN-VRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSY-QVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDES-IIAVGQSLDRETHDHFFLKAVCIDKGD--PPRTT-------EKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQD-FGSNSELVYTIANTTESRSY---LHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYF-----NQSSYNASLFENSPSGSPVVQLLAQDPDIGENSL----ILYSILTPNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSCNATVH 586          

HSP 7 Score: 108.997 bits (271), Expect = 9.015e-24
Identity = 145/646 (22.45%), Postives = 260/646 (40.25%), Query Frame = 1
Query:  970 LDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQE--IYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKL---------------TKHFWDVYNLNNIIPFDYE----------------KSRHETVQLI--CIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSE-KFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNIT--LRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQK-TGEILTNWE-SYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNIT 2787
            LD E+ + + L L    +     +  +   + V D NDN P F             +  + +  + E+    +   +    A D D G N K+ YSI + +          F+I+S   T +I     LD E        LVI  TD+G P +S +  + + + D+NDN P     S   I E+ +   V+     +D D  S+  ++ NL   S     +                K+ + + N + I   DY+                + R   +Q+    +D+  P        +I I  E    P++    Y   V E +     ++ V  TD+ +    G++ +NI  +      N+ RI  ++G + +   +D E   + +  ++  D  D  P     +  +       I++ D+ND  P +       +  E +P+ +IV  +   D D   +  V         Q+ D+    F I   T  ++ +   +H+   T  + ++A D GSP   T V++   +LD+NDN P+ + P  N    + ++  +   N  + +I A D D G N+ L++ ++    T +  F I K +G + TN    YE   +  + L I   D+G P LS+N+   VN+ 
Sbjct: 2025 LDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAF-------------HPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNE------AGVFTIDS--TTGEITTAKLLDRETTASFD--LVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESR--LTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQI---DYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITRE----PKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENS------NYFRIGQRSGVISVNKPLDYETKRRFLLVVSAID--DTAPSKPVRVPVY-------INVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAI-----QSGDDKGS-FAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPN----DVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGG--TGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVA 2611          

HSP 8 Score: 105.916 bits (263), Expect = 6.793e-23
Identity = 135/589 (22.92%), Postives = 244/589 (41.43%), Query Frame = 1
Query:  745 LNIKDENDNRPTFVSPLTVIN---IPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFN--YSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTK-----FSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNR-ISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYN--LNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSP 2472
            + + D NDN P      T+     + E+A + +        D DS  NG    +L      F+  + ++++E  + + + LDRET + + L     +K     +    F++ V D ND  P F                ++   + EN T++  +   +A+D D G NS++ Y+I+       N   ++     F+I+ PS +  I    +LD E   +  ++L +L  D G P  S + S+ +NL D NDN P   + S N  + EN    + +      D D+     I  ++   +      T  F D     + N    D+E     T Q+   D        T +  + + D NDN P +    Y V   E +   + I ++ A D DS KF    F I + +  + F+       +G + L   +DRE     +  +   D   +            NK  + I + D+ND  P +   + +F I E+    S++  +  +  D+  +  V     +  +      N        T+++++E++ E   ++ L +QA+D G+P    + N+   ++D+NDNSP
Sbjct:  267 IEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKF-------------DRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIA-------NTTESRSYLHWFAID-PS-SGMITTATDLDREQIPQ--VVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPN------TPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSCNATVH--VSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSV----DGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDS---------VNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINS-----TGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSP 805          

HSP 9 Score: 103.605 bits (257), Expect = 3.619e-22
Identity = 141/603 (23.38%), Postives = 245/603 (40.63%), Query Frame = 1
Query:  745 LNIKDENDNRPTFVSPLTVINIPE-SAELQSLYKLPM-AVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYF-----VTLNSDFKYIPINYS--------ESFVIY-IKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSP--------NRISENDKRETVLKIFHVSDKDL-ISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSP--RYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSP 2472
            +N+ D NDN P F     +  + E +   +  + + + A D DS  NG   YS+   +    +++      +T  K LDRET   ++L +   +      S +   +V V+D NDN P F     V +  D +   +  S        ES + Y +K   T    I    A D D G N++I YS        P   + +   +  ++T  I  R  +D   ++   I + + A D G P + A V + I           I  + P         ++ EN    T +    V+D    +    IS N+  E+   F++ +    V ++N   P DYE  R   + +  ID   P         I + D ND  P + Q  Y     E       ++ V+A D DS   G+++F I   D   +F    ID + G +    ++D E       ++  TD  +  P  +T+++       +TI + D+NDN P  R P      ++ ENLP+NS + ++   D D   +  ++   I    Q     + + G +   I    E    ++ ++T++  A D G+P   + + +   + D ++  P
Sbjct: 2055 INVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSF-------PITNSDQIDYKIDADTGVISARRTIDVRIRDS-FIQIPVQAMDQGVPPQRALVYVRI-----------IITREPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNI--ENSNYFRIGQRSG-VISVNK--PLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSF---AIDRKTGVIRTQRALDHETIKTHHVSVRATD--EGSPPMHTDVS-------VTIRVLDLNDNPPVFRVPGPN-DVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIK--ATDAGNPPLSSNITIIVNVADEDEYDP 2618          

HSP 10 Score: 101.679 bits (252), Expect = 1.410e-21
Identity = 174/767 (22.69%), Postives = 301/767 (39.24%), Query Frame = 1
Query:  604 SKGNLTTLTHIDRD-DICIRLSCCKDSICTIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPE-SAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEI---YNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSIS-SRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRIS--ENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNK--FIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDE------------YPS-NVVTLKFIESESQTFDESNYWFGIVN------------NTIFVKNELN-REHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLN-STLNYKILHSNLTNKHSFRI-QKTGEILTNWE-SYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNIT 2787
            S G L+T T +DR+     +LS     I     TA   F N     I + I+D+NDN P F   L    I E +    S+  L  A DKDS  NG   Y+LS+ +    Y +   +    ++    R    I   YN      ++ +      +  ++K+ D N++ P F     +    P   + + V  +                D D+  N K+ Y +  S++S      T+ F +ES + +    +R +  + N  +    L I+A D+G P       + I + +I D+ P+   ++P R+S  EN K  + +           S   ++ ++   +K +      F  V ++ +    DYE +++  + L+   +    L       I + D NDN P +        + E + + K  F++KV ATD DS   GK+ ++I   +    F    ID   G +     +DRE        I  TD         + I   S   ++ + + D+NDN P +    +   I E+    ++V  +   D D+             P   ++ +   + +S +  +  Y F I N              I  +  ++ R   + I + +QA D G P +R  V +   I       P  + P     +P   +  ++     +  +   D   GL    ++Y I +SN      FRI Q++G I  N    YET +   F L +S  D   PS    V  Y+N++
Sbjct: 1698 STGELSTTTKLDRETKASYQLSVQAKDITPPYYTA---FAN-----ITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNL-TASDKDSGSNGNIVYTLSNDT----YGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDA-----------DTDKSTNGKVTYRLDDSKNS------TSLFVVESNTGS----VRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRARAS---SDAQVTYSIISGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFT---IDSTTGEITTAKLLDRETTASFDLVIRGTD---------SGIPPKSTNCQVKVVVTDLNDNPPLF-DPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIIT----REPKFELPSYFGKVPENAMMGTS-----VLTVRVTDNAAGLPLGRISYNIENSNY-----FRIGQRSGVISVNKPLDYETKR--RFLLVVSAIDDTAPSKPVRVPVYINVS 2398          

HSP 11 Score: 98.5969 bits (244), Expect = 1.439e-20
Identity = 173/668 (25.90%), Postives = 274/668 (41.02%), Query Frame = 1
Query:  592 FKIDSKGNLTTLTH-IDRDDIC---IRLSCCKDSICTIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSP-LTVI--NIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQ---------ITEKSPNRISENDKRETVLKIFHVSDKDLISKDN---ISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVY----LTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPS--NVVTLKFIESESQT---FDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSP-ILKSPPNNSFIP 2508
            FKI+S+  L   TH IDR++I    +++     +      T      N+ + +II  I+D NDN P FVS  LT +  + P + ++ S+     A+D D+   G   Y +  P +T  +SL      + LI  LD E +  Y L +   +      ++   F V V D NDN P F               + F+  + EN+     +    A D D G N+++ YSI      P  V   KFSI+    +  I     LD E ++     L + AT    P R +S S+ IN++D NDN P+         + E SP R+           I+ ++ +DL   +N   +   +S  +   F + +   +   L+     D E      + +   D   P  T   N  I I D+NDN P + Q  Y   + E +     I+ + A+D DS   G + + ++      T+    ID + G VY      TSI +E      YN       D+  D    I        + I I+D N+++P++        I  N   +++V  +   D D   S    VT +  +S++ T     ESN   G V  +    N     H     L + AED+GSP  R +  +   I ++ D+ P  L   P    IP
Sbjct: 1378 FKINSETGLIQTTHPIDREEISEYSLKVRATDQA-----FTEQDRLYNTATLKII--IQDLNDNAPKFVSRNLTYVMEDEPFNFQVTSI----TALDPDTGQGGNVEYRIVSP-DTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFT-------------RDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSI------PSGVEMDKFSIDK--HSGLIVTNSILDREKKDT--YFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENSPARL-----------IYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGE---LSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSN----DTYGVYSIDSRTGIVYSAARFETSIKQE------YNFFCIAK-DQGQDPKMAI------VPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNT--GSVRTSAGFSNPPQGRH----ALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIP 1973          

HSP 12 Score: 94.3597 bits (233), Expect = 2.276e-19
Identity = 93/385 (24.16%), Postives = 162/385 (42.08%), Query Frame = 1
Query:  775 PTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPN--RISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHF--WDVYNLNNIIPFDYEKSR--HETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYF 1911
            P F  P     +PE+A +     L + V  ++ G  + R S +  ++ + + +      +++ KPLD ET   + L +   +         +   + VSD ND KP F                 ++    E   +   + +  A D D G N ++ ++I S D         K S     +T  IR +  LD+E  +  H+   + ATD G P     VS+TI +LD+NDN P      PN  ++ EN    + L   + +D+D  +   +S  +   + +   L   F  W    L   I FDYE +     ++ +   D   P L+      + + DE++  P + + +Y  +V   +    F+ +V ATD DS   G+++F
Sbjct: 2302 PKFELPSYFGKVPENA-MMGTSVLTVRVTDNAAGLPLGRISYNIENSNY-FRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVF-------------GQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDD--------KGSFAIDRKTGVIRTQRALDHETIKTHHV--SVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGW----LTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFF 2657          

HSP 13 Score: 87.0409 bits (214), Expect = 3.889e-17
Identity = 119/506 (23.52%), Postives = 209/506 (41.30%), Query Frame = 1
Query: 1330 IRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRIS--ENDK--RETVLKIFHVSDKDLISKDNISCNL-SEESKRKFKLTKH-------FWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNI-TEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKT---HFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNN--TIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNK--HSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNIT 2787
            I  +  LD E     ++ +V  +T    P +S +V + +   D+NDN P     +  ++   ENDK  R+ ++ +    D D  S    S  + S      FKL          + D+    + I  D E+     + +   D   P         I + D NDN P+++   Y   + E  +    I++V+A+D D     ++ ++I T +D    F    I    G +     +D E     +  +   D    H        Q S+   + I++ D+NDN+P      T    +++ EN  I + V ++   D D   +  V +  +E     F   +  F ++N+   I V   L+RE  ++  L+    D G P R T  +    + DVND +P       +     T ++ +   N ++A + A D D+G NS L Y I ++  +    H F I  +  ++T     +  +I    L + ++D G+P LS N    VN+T
Sbjct:   14 ITTKTVLDREKVSAYNLTIVEFST----PPKSYTVLVYVQ--DLNDNSPSFVRGTSAKLVVFENDKDFRQKLIAV----DSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFG---IHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSH--------QLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVT-LEGGDGYF---SMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKF-----DRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLT 489          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 153.68 bits (387), Expect = 1.918e-37
Identity = 155/557 (27.83%), Postives = 250/557 (44.88%), Query Frame = 1
Query: 1162 IKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKS--PNRISENDKRETVLKIFHVSDKDLISKDNIS-CNL-SEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNT--IFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEI-LTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNITSASSPTAE 2811
            + E+  +   + +  A D D G N  I YS+S   +    +  T FSI+    T  I  +  LD E  + RH   V  A D G+P     + LTIN+LD+NDN P I E++     I E+      +     SD D  S   +  C L S+     F + +    V  +  +   D EK    T+Q+   D+  P  + T   KI + D ND  PQ+++K Y   + E    N+ +  V ATD D    G+++F I   +     NF  I+  NG V +   +D E     V+N+ VT   D+   F        N+T + I + D+NDN+P++ S      IPEN  +     +++  D D   +  +T  F++++          F I  NT  I +K EL+RE     T  ++A D G P +     +   +LD+NDN P       ++ I     + ++     + +++A DPD G  + + Y I+ S+  +   FRI   G I L+   +Y T  + +F   +S  D     LS+    YVN+T +++   E
Sbjct:   29 VSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNL---MSATYFSIDQ--ITGVITTKRGLDREFLD-RHFFRV-KAEDGGEPSLEGYMDLTINVLDVNDNGP-IFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSGAVTVMKKL---DREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGN---DMNFFSINRINGEVRVKQKLDYEMIG--VFNLLVTAQ-DKGQPF------LYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLP--------FSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTS-----VLQVKAIDPDSGPTNVV-YSIVSSS-GHDRCFRINPQGLITLSCTLNYNTKHVYVF--SVSASDG---MLSSTALVYVNVTDSNTHAPE 542          

HSP 2 Score: 144.05 bits (362), Expect = 1.821e-34
Identity = 159/684 (23.25%), Postives = 277/684 (40.50%), Query Frame = 1
Query:  766 DNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFN---YSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKS-PNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNII----PFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGI-VNNTIFVKNELNREHKNNITLRLQAEDNG-SPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNIT 2787
            +N P F       ++ E AE+ ++     A D DS  NG+ RYS+S   N  +   +S+      +T  + LDRE ++ +   +   +         +   + V D NDN P F                 +   I E++++   + +  A D D G N ++ Y I + D        + FSI   S    +  +L    + ++     L + A D G P RSA+V++ I LLD+ND  PQ ++K     I E+     ++     +D D  S   +   +   +        +F+ +  +N  +      DYE      + +   DK +P L   T   I + D NDN PQ+    +   + E     +   +V A D D    G++ F+  + D+P       I+   G + +   +DRE+ P+  + I      D+   F     Q      +TI + DINDN P++  ++ H  I EN    + V +++ +D D  P+NVV    + S        +  F I     I +   LN   K+     + A D   S     +VN    + D N ++P  K     S+  + E+         +  + A D D G N+ ++Y I     T    F + +T  ++    S +  K+  +   ++  D G P L    + Y++I 
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFSIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIF-------------ERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGD-----NSAFSIGEVSGAVTVMKKL----DREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGND------MNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLP-----FSINENTGGISIKEELDREKVPKFTFGIKAR---DKGVPFKEGTAQ------ITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVV-YSIVSSSGH-----DRCFRINPQGLITLSCTLNYNTKHVYVFSVSASDGMLSSTALVYVN----VTDSNTHAPEFK---RRSY--SAEVKEDASLGTSVLTVLATDRDTGSNAKISYSI----ATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIA 637          

HSP 3 Score: 139.043 bits (349), Expect = 6.352e-33
Identity = 157/683 (22.99%), Postives = 293/683 (42.90%), Query Frame = 1
Query:  736 EIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSL--SDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQ-ITEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQ-TFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSP--KRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNV 2766
            ++ +N+ D NDN P F   +   +IPE   +        A D DS  NG  +Y +  SD  N+  +S+      +T++K LDRE +  Y L +   ++     S ++  ++ + D ND  P F               + +   I+E+  ++Q + +  A D D+G N ++ + I S +          FSI   +   ++R++  LDYE     +  L++ A D G+P      ++ I L+D+NDN PQ ++      I EN             DKD  +   I+ +   ++   F + ++   +     +   D EK    T  +   DK  P    T    I + D NDN P+++Q+EYH ++ E S     +++V A D DS     +Y  ++ +   + F   RI+ Q G + L+ +++       V++++ +D               S+   + +++ D N ++P +  +    ++ E+  + + V  +   D D   +  ++        + + DE+    G++         L+RE  +     + A D+G P  K ++FV +H  I DVNDN P+   P   +     ++         + ++ A D D G N+ + Y    SN   + +F I  T  I+   +  +   I  + L +   D GTP    +V
Sbjct:  113 DLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNS-AFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQF-------------SKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGND------MNFFSINRIN--GEVRVKQKLDYEMIGVFN--LLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFM-QNDLPFSINENTGGISIKEEL---DREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGHDRCF---RINPQ-GLITLSCTLNYNTKHVYVFSVSASDGM------------LSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEFSVDETT---GVIKTA----GSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIH--IADVNDNDPVFLKPSYEA-----KVREDIRPGGRVIEVSASDADIGKNAQIIYS-FASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASV 736          

HSP 4 Score: 136.732 bits (343), Expect = 2.550e-32
Identity = 150/639 (23.47%), Postives = 258/639 (40.38%), Query Frame = 1
Query:  718 PNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSL--SDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQIT-EKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESK-RKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSN 2622
            P S +  + + + D ND  P F   +    I E   +  L     A D D   NG   + +   +  N F+ + I+ E  + + + LD E I ++NL +   +K +    N     + + D NDN P FV             S  F   I EN  + QE Y   A D D G N +I +S    D          FSI     T  I ++  LD E   +      I A D G P +  +  +TI LLDINDN P+ + E+    I+EN +  T +      D D    + +   +S     R F++      +  L+  + ++   ++H  V +  +  ++  L+ T    + + D N + P++ ++ Y   V+E ++    ++ V ATD D+    K+ ++I    +P+      +D   G +    S+DRE+     + +T TD+          I Q   K+ + I I D+NDN P +       K+ E++     V ++   D D   +  +   F    S    +  +        I     L+RE      L + A D G+P  +  V +   + DV D+ P+ + P     +P       T     +  ++A   D    + + Y I+  N
Sbjct:  213 PRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGE--VRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFV-------------SSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQND--------LPFSIN--ENTGGISIKEELDREKVPK--FTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGHDRCFRINPQ--GLITLSCTLNYN---TKH--VYVFSVSASDGMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATL-VPE----FSVDETTGVIKTAGSLDREKVDTYRFEVTATDH---------GIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSF---ASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPE-----DTPPRSPVITVKAKSQDLSPETGMMYSIVRGN 795          

HSP 5 Score: 68.9366 bits (167), Expect = 1.324e-11
Identity = 100/446 (22.42%), Postives = 175/446 (39.24%), Query Frame = 1
Query:  739 IILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTK----HFWDV----YNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNF 2052
            + +N+ D N + P F        + E A L +     +A D+D+  N    YS++     F  S+      +     LDRE ++ Y   +   +          F  + ++D NDN P F+               S+   ++E+      +    A D D G+N++I YS +S            F+I+S      IR    LD E   E    L ++ATD G P   ASV + + L D+ D+ P + EK    ++  +       +  V  K        S +LS E+   + + +      +D+      +  ++  DYE       +L       P  T+TT   + + D NDN P       ++NV+E     +   K+ A D D     KL F + E +  +   ++ ++  +G + +   + +   P  +  I VTD  
Sbjct:  529 VYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEF--SVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFL-------------KPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDG-----QGTFTIDS--TQGIIRTLKPLDRETIPEYE--LTVVATDQGTPPGQASVKVKVILEDVKDS-PPLFEKPLYEVTVPEDTPPRSPVITVKAK--------SQDLSPETGMMYSIVRGNSPQVFDINPNTGAIQTLMKLDYET--QSEYRLTVRATLSPFFTETT-VMVYLKDINDNTPVLEAFHMNINVQEGKVPPEARYKIPAYDPDVSD--KLTFKVMEGNAKE---WVTLNATSGELSVNKKLIQASKPANI-KIAVTDGL 932          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 236.498 bits (602), Expect = 1.150e-63
Identity = 206/747 (27.58%), Postives = 342/747 (45.78%), Query Frame = 1
Query:  616 LTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNS----ISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNE-----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEK---SPNR----ISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTP-SLST--NVYFYVNITSASS 2799
             TT   IDR+ +C   S  +D+ C+ ++  V++ PN     I  +II  +KD NDN P F SP+  I+IPE+  + S + +P A D D+  N + +Y L +  + F   ++        P + + + LDRE  + Y + + V +      S++   QV V+D NDNKP F                   ++I EN  +   +    A D D G N++I Y   ++ S       TK      S +  I ++  LD E +   H + V+ +  +  P R+   ++ IN+ D+NDN P I  +   SP      +SE D   T + +  VSDKD      + C +  E    F L   + + Y L      DYE ++    +++  D  +P L QT   ++ + DENDN P +TQ    + V E +  + F+  ++ATD DS K  ++ + +         +F  +D + G +  +   DRE   + ++ +T  DN                +  + + + D NDN+P++      F + ENLP  S V  +   D D   +  ++L  +       D  N+     +  I      +RE +++ T  ++A D+G P   +   +   ++DVNDN+PI+  PP+N+      L  S+    ++A++ A D D G+N+ L Y I+  N  NK  FRI      +T  E      IG+  L ++I D G P SL T   V+ YVN T  +S
Sbjct:   86 FTTSNRIDREKLCPG-SSFEDAECSFEI-EVVVLPNDYFRLIKIKII--VKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVF-------------RENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSP-----ATKRLFALNSTSGLITVQRPLDRE-ETAIHKLSVLASDGSSSPARA---TVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFI--EKDVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLG-----PNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDN---------GTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILN------DNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPL--SSIPGSVVAEVFAVDSDTGMNAELKYTIVSGN--NKGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLGYPKSLHTLVLVFLYVNDTVGNS 780          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 236.884 bits (603), Expect = 2.485e-63
Identity = 206/747 (27.58%), Postives = 342/747 (45.78%), Query Frame = 1
Query:  616 LTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNS----ISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNE-----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEK---SPNR----ISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTP-SLST--NVYFYVNITSASS 2799
             TT   IDR+ +C   S  +D+ C+ ++  V++ PN     I  +II  +KD NDN P F SP+  I+IPE+  + S + +P A D D+  N + +Y L +  + F   ++        P + + + LDRE  + Y + + V +      S++   QV V+D NDNKP F                   ++I EN  +   +    A D D G N++I Y   ++ S       TK      S +  I ++  LD E +   H + V+ +  +  P R+   ++ IN+ D+NDN P I  +   SP      +SE D   T + +  VSDKD      + C +  E    F L   + + Y L      DYE ++    +++  D  +P L QT   ++ + DENDN P +TQ    + V E +  + F+  ++ATD DS K  ++ + +         +F  +D + G +  +   DRE   + ++ +T  DN                +  + + + D NDN+P++      F + ENLP  S V  +   D D   +  ++L  +       D  N+     +  I      +RE +++ T  ++A D+G P   +   +   ++DVNDN+PI+  PP+N+      L  S+    ++A++ A D D G+N+ L Y I+  N  NK  FRI      +T  E      IG+  L ++I D G P SL T   V+ YVN T  +S
Sbjct:   86 FTTSNRIDREKLCPG-SSFEDAECSFEI-EVVVLPNDYFRLIKIKII--VKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVF-------------RENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSP-----ATKRLFALNSTSGLITVQRPLDRE-ETAIHKLSVLASDGSSSPARA---TVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFI--EKDVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLG-----PNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDN---------GTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILN------DNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPL--SSIPGSVVAEVFAVDSDTGMNAELKYTIVSGN--NKGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLGYPKSLHTLVLVFLYVNDTVGNS 780          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 236.498 bits (602), Expect = 4.185e-63
Identity = 206/747 (27.58%), Postives = 342/747 (45.78%), Query Frame = 1
Query:  616 LTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNS----ISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNE-----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEK---SPNR----ISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTP-SLST--NVYFYVNITSASS 2799
             TT   IDR+ +C   S  +D+ C+ ++  V++ PN     I  +II  +KD NDN P F SP+  I+IPE+  + S + +P A D D+  N + +Y L +  + F   ++        P + + + LDRE  + Y + + V +      S++   QV V+D NDNKP F                   ++I EN  +   +    A D D G N++I Y   ++ S       TK      S +  I ++  LD E +   H + V+ +  +  P R+   ++ IN+ D+NDN P I  +   SP      +SE D   T + +  VSDKD      + C +  E    F L   + + Y L      DYE ++    +++  D  +P L QT   ++ + DENDN P +TQ    + V E +  + F+  ++ATD DS K  ++ + +         +F  +D + G +  +   DRE   + ++ +T  DN                +  + + + D NDN+P++      F + ENLP  S V  +   D D   +  ++L  +       D  N+     +  I      +RE +++ T  ++A D+G P   +   +   ++DVNDN+PI+  PP+N+      L  S+    ++A++ A D D G+N+ L Y I+  N  NK  FRI      +T  E      IG+  L ++I D G P SL T   V+ YVN T  +S
Sbjct:   86 FTTSNRIDREKLCPG-SSFEDAECSFEI-EVVVLPNDYFRLIKIKII--VKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVF-------------RENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVS-----PATKRLFALNSTSGLITVQRPLDRE-ETAIHKLSVLASDGSSSPARA---TVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFI--EKDVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLG-----PNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDN---------GTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILN------DNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPL--SSIPGSVVAEVFAVDSDTGMNAELKYTIVSGN--NKGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLGYPKSLHTLVLVFLYVNDTVGNS 780          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 231.491 bits (589), Expect = 5.636e-62
Identity = 210/807 (26.02%), Postives = 361/807 (44.73%), Query Frame = 1
Query:  472 FNLIDVTPKETIIGSLLQSENSQNTKISFNNVVLRSYSDLFKIDSK-GNL-TTLTHIDRDDICIRLSCCKDSIC--------TIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLS---DPSNTFNYSLIHNE----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPN---------RISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWD----VYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHS-FRI-QKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTN--VYFYVNITS 2790
            + L +  P  T+IGSL       ++   +    L   S   ++DSK G + TT   IDR+ +    +  +D  C        T  +  + + P  I  E I+ + D NDN P F SP+  ++IPE+    +L+ +P+AVD+DS  NG+  Y+LS   D +  F   +  +     P + +I  LDRE  + Y+L++ V +  +   ++S   ++ V+D NDN P F                 +   + EN      +    A D D G N  I YS+           T +  +     T  I ++  +D E  E+  +   ++A D G   +S+   +TI++ D NDN P I  +             ISE+    T + +  VSD+D      ++C ++ +   + +      +     Y L      DYE+ +   ++++ +D   P L+ T + K+++ D NDN P ++     VN  E +     +I V ATD+DS    +L ++I E+     F    I+   G + +   +DRE   +  + +   D           +   +    + I+++D NDN P++      F + EN+P  + V  +   D D+  ++ VTL F+E ++  F   N        TI      +RE ++  T RL+A D G P R ++V +   +LD NDN+P +  P N+S+   T L  S+  +  +  ++A+D D G+N+ L Y I      N H  F+I   +GEI    + +     G+  L + + D G P   T   V+ YVN T+
Sbjct:   43 YKLSEEQPPNTLIGSLAADLGLPDSGHLYK---LEVGSPYLRVDSKTGEIYTTEIPIDRETLSDCRNLFEDDKCFLEFEVSITDMVKGIGLGPRLI--EGIIEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKF-------------EKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASD------TVQRLLRIDRSTGIIYVKGLVDRE--EDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLF---EINSNTGEIRVRNQLDREDVERYEFGVAAADK---------GVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTL-FVEPDNGKFIIQNG-----TGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKPANSSY---THLKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGG---NPHGLFQISHNSGEIKL-AQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYVNETT 798          

HSP 2 Score: 102.449 bits (254), Expect = 1.724e-21
Identity = 142/609 (23.32%), Postives = 245/609 (40.23%), Query Frame = 1
Query:  718 PNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSL-IHNEPHMTLIKPL-DRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVS--DDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLR-------LNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEK--SPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRY--PSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESE---SQTFDESNYWFGIVNNT--IFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKS 2484
            P + S  + + + D+NDN P F        +PE++          A D D+  NG   YSL   S+T    L I     +  +K L DRE   +  L  YV  + R   S S   QV +S  D NDN P       + + I +   ++FV  I E+  +   +      D DEGEN+ +   ++             F +   SE+A  R R         LDYE  ++  I   I+A D+G P  S++ SL + + DINDN P  +      N   +N   + V+ +        ++ + +   +   +   F++  +  ++   N +   D E        +   DK  P  T T    I + D NDN P++    Y  +V E       +  V  +D+D  +  ++   +     P    FI I +  G +  + S DRE+     + +   D  D            S+   +TI++ D NDN+P    P+  ++  +  + P ++ VE ++  D D           + +E   + T    +  F I +N+  I +      +HK    L ++  D G P R T   +H  + +  +N  +++ 
Sbjct:  242 PRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQRLLRIDRSTGIIYVKGLVDREEDNL--LKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAI-----EIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAG---------DVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRI--EIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRNQL---DREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFVE----PDNGKFI-IQNGTGTILSSISFDREKESTYTFRLKAVDAGD---------PPRSSYVGVTINVLDENDNAPYVTKPANSSYTHLKPSSPPDTPVEVVKAEDID---------AGVNAELYYTITGGNPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYVNETTNNVTLIEG 806          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 232.261 bits (591), Expect = 9.947e-62
Identity = 211/807 (26.15%), Postives = 362/807 (44.86%), Query Frame = 1
Query:  472 FNLIDVTPKETIIGSLLQSENSQNTKISFNNVVLRSYSDLFKIDSK-GNL-TTLTHIDRDDICIRLSCCKDSIC--------TIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLS---DPSNTFNYSLIHNE----PHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPN---------RISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWD----VYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHS-FRI-QKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTN--VYFYVNITS 2790
            + L +  P  T+IGSL       ++   +    L   S   ++DSK G + TT   IDR+ +    +  +D  C        T  +  + + P  I  E I+ + D NDN P F SP+  ++IPE+    +L+ +P+AVD+DS  NG+  Y+LS   D +  F   +  +     P + +I  LDRE  + Y+L++ V +  +   ++S   ++ V+D NDN P F                 +   + EN      +    A D D G N  I YS+        + V     I+    T  I ++  +D E  E+  +   ++A D G   +S+   +TI++ D NDN P I  +             ISE+    T + +  VSD+D      ++C ++ +   + +      +     Y L      DYE+ +   ++++ +D   P L+ T + K+++ D NDN P ++     VN  E +     +I V ATD+DS    +L ++I E+     F    I+   G + +   +DRE   +  + +   D           +   +    + I+++D NDN P++      F + EN+P  + V  +   D D+  ++ VTL F+E ++  F   N        TI      +RE ++  T RL+A D G P R ++V +   +LD NDN+P +  P N+S+   T L  S+  +  +  ++A+D D G+N+ L Y I      N H  F+I   +GEI    + +     G+  L + + D G P   T   V+ YVN T+
Sbjct:   43 YKLSEEQPPNTLIGSLAADLGLPDSGHLYK---LEVGSPYLRVDSKTGEIYTTEIPIDRETLSDCRNLFEDDKCFLEFEVSITDMVKGIGLGPRLI--EGIIEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKF-------------EKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQAS----DTVQRLLRIDR--STGIIYVKGLVDRE--EDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLF---EINSNTGEIRVRNQLDREDVERYEFGVAAADK---------GVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTL-FVEPDNGKFIIQNG-----TGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKPANSSY---THLKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGG---NPHGLFQISHNSGEIKL-AQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYVNETT 798          

HSP 2 Score: 102.449 bits (254), Expect = 1.797e-21
Identity = 146/610 (23.93%), Postives = 251/610 (41.15%), Query Frame = 1
Query:  718 PNSISYEIILNIKDENDNRPTFVSPLTVINIPE-SAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSL-IHNEPHMTLIKPL-DRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVS--DDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLR-------LNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEK--SPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSP--RYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESE---SQTFDESNYWFGIVNNT--IFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKS 2484
            P + S  + + + D+NDN P F        +PE S    S+ ++  A D D+  NG   YSL   S+T    L I     +  +K L DRE   +  L  YV  + R   S S   QV +S  D NDN P       + + I +   ++FV  I E+  +   +      D DEGEN+ +   ++             F +   SE+A  R R         LDYE  ++  I   I+A D+G P  S++ SL + + DINDN P  +      N   +N   + V+ +        ++ + +   +   +   F++  +  ++   N +   D E  R+E   +   DK  P  T T    I + D NDN P++    Y  +V E       +  V  +D+D  +  ++   +     P    FI I +  G +  + S DRE+     + +   D  D            S+   +TI++ D NDN+P    P+  ++  +  + P ++ VE ++  D D           + +E   + T    +  F I +N+  I +      +HK    L ++  D G P R T   +H  + +  +N  +++ 
Sbjct:  242 PRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQV-RANDADTGANGDIDYSLHQASDTVQRLLRIDRSTGIIYVKGLVDREEDNL--LKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAI-----EIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAG---------DVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRI--EIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRNQLDREDVE--RYE-FGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFVE----PDNGKFI-IQNGTGTILSSISFDREKESTYTFRLKAVDAGD---------PPRSSYVGVTINVLDENDNAPYVTKPANSSYTHLKPSSPPDTPVEVVKAEDID---------AGVNAELYYTITGGNPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYVNETTNNVTLIEG 806          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000005371.1 (SMESG000005371.1)

HSP 1 Score: 2078.52 bits (5384), Expect = 0.000e+0
Identity = 1046/1048 (99.81%), Postives = 1048/1048 (100.00%), Query Frame = 1
Query:  397 MKISHLVNILFSLNYVFLKKTNQIEFNLIDVTPKETIIGSLLQSENSQNTKISFNNVVLRSYSDLFKIDSKGNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNITSASSPTAEAYMXXXXXXXXXXXXXXXXXXXXXAAIFWVRFRVSNDTPINDQEEFYEREHLNKENNQYSLNNIGKAFTQNSYENNRLNTYEAFQGYHHDSYVQSRNHNNYSHNTMNETFEKPILTACGGCMLYQTVPHQFNRLRHSNITDYNNTLLSTNQKTLMLQGCIDNDYKTIPNIQSTALMVEPNFSDSGKGGSVEDLNTRQISGISTFTNSSIVNTSSANAKLFCQKSNFELKRNPYSYDKSEETMF 3540
            MKISHLVNILFSLNYVFLKKTNQIEFNLIDVTPKETIIGSLLQSENSQNTKISFNNVVLRSYSDLFKIDSKGNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITE+SPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIES+SQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNITSASSPTAEAYMSNIVILILIIVCSLALIVSLIAAIFWVRFRVSNDTPINDQEEFYEREHLNKENNQYSLNNIGKAFTQNSYENNRLNTYEAFQGYHHDSYVQSRNHNNYSHNTMNETFEKPILTACGGCMLYQTVPHQFNRLRHSNITDYNNTLLSTNQKTLMLQGCIDNDYKTIPNIQSTALMVEPNFSDSGKGGSVEDLNTRQISGISTFTNSSIVNTSSANAKLFCQKSNFELKRNPYSYDKSEETMF
Sbjct:    1 MKISHLVNILFSLNYVFLKKTNQIEFNLIDVTPKETIIGSLLQSENSQNTKISFNNVVLRSYSDLFKIDSKGNLTTLTHIDRDDICIRLSCCKDSICTIKMTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITERSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESDSQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNITSASSPTAEAYMSNIVILILIIVCSLALIVSLIAAIFWVRFRVSNDTPINDQEEFYEREHLNKENNQYSLNNIGKAFTQNSYENNRLNTYEAFQGYHHDSYVQSRNHNNYSHNTMNETFEKPILTACGGCMLYQTVPHQFNRLRHSNITDYNNTLLSTNQKTLMLQGCIDNDYKTIPNIQSTALMVEPNFSDSGKGGSVEDLNTRQISGISTFTNSSIVNTSSANAKLFCQKSNFELKRNPYSYDKSEETMF 1048          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000008875.1 (SMESG000008875.1)

HSP 1 Score: 285.034 bits (728), Expect = 4.640e-80
Identity = 247/818 (30.20%), Postives = 391/818 (47.80%), Query Frame = 1
Query:  412 LVNILFSLNYV-FLKKTNQIEFNLIDVTPKETIIGSLLQSENSQ----NTKISFNNVVLRSYSDLFKIDSKGNLTTLTHIDRD---DICIRLSCCKDSICTIKMTAVLIFPN---SISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTF-NYSLIHNEPHMTLIKPLDRETI--EIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTEL-FASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKT-GEILTNWESYETLKI-----GIFYLHISIYDSGTPSL-STNVYFYVNITSASS 2799
            L +++F ++    + + + I   L D  PK T +G++ +  N Q    N  I         + + FK+   G++ T   IDRD   +IC  LSCC   IC  +  A+L + +   +++++I   I DENDN P F      IN+ E  +   +  LP A D DS  NG+  YSLS+    F   S+    P + ++  L+ E +    ++L L  +++  Q  + SLF  +   D NDNKP F           I Y ++    +KEN T +  I    A D DEGEN KI+Y     D+  P  +  KFS+     T +I+L   LDYE   ++ I   I A D G PQ S S  + I+  DINDN P+I       I EN +  T +   +V D D +  + + CN  + S   F+L     +   +     FDYE S    + + C D   P +    +  I I DENDN P +T+ ++   + E S  N+F+ + +ATD DS  FGK+ + + +A   K F    I+   G +YL  S+DRE    L + +  TD                   K++I + DINDN PR  S K    + EN PI +++  +E  D D+  +  VT   IE+E Q       +  + NN IF+K+ ++RE  + I LRL+  D+G PK  ++  +   I+D+NDN PIL+ P     + +  L + +T+ N  I  + A D D+  N  + ++I+  +      F++ +T G I + W       I     G++ ++I + DS +  + ST  +FY+ I   S+
Sbjct:    3 LFHVIFCISLADAIAEEHSINMKLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQKNYRM-SLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLF--ITTIDRNDNKPIFTD---------ILYRKT----VKENTTYTIPILQVQAKDLDEGENGKISYRF---DTLTPQEINDKFSLNKL--TGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSV-HNKVKCN--KNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAG-NKEF---VINISTGYIYLYNSLDREVKEMLEFFVYATDG-----------GGLEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVT---IENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWETITISIIDINDNDPILEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIM-DDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRSTKSHFYLTIREYSA 776          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000008875.1 (SMESG000008875.1)

HSP 1 Score: 285.034 bits (728), Expect = 7.286e-80
Identity = 247/818 (30.20%), Postives = 391/818 (47.80%), Query Frame = 1
Query:  412 LVNILFSLNYV-FLKKTNQIEFNLIDVTPKETIIGSLLQSENSQ----NTKISFNNVVLRSYSDLFKIDSKGNLTTLTHIDRD---DICIRLSCCKDSICTIKMTAVLIFPN---SISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSDPSNTF-NYSLIHNEPHMTLIKPLDRETI--EIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTEL-FASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKT-GEILTNWESYETLKI-----GIFYLHISIYDSGTPSL-STNVYFYVNITSASS 2799
            L +++F ++    + + + I   L D  PK T +G++ +  N Q    N  I         + + FK+   G++ T   IDRD   +IC  LSCC   IC  +  A+L + +   +++++I   I DENDN P F      IN+ E  +   +  LP A D DS  NG+  YSLS+    F   S+    P + ++  L+ E +    ++L L  +++  Q  + SLF  +   D NDNKP F           I Y ++    +KEN T +  I    A D DEGEN KI+Y     D+  P  +  KFS+     T +I+L   LDYE   ++ I   I A D G PQ S S  + I+  DINDN P+I       I EN +  T +   +V D D +  + + CN  + S   F+L     +   +     FDYE S    + + C D   P +    +  I I DENDN P +T+ ++   + E S  N+F+ + +ATD DS  FGK+ + + +A   K F    I+   G +YL  S+DRE    L + +  TD                   K++I + DINDN PR  S K    + EN PI +++  +E  D D+  +  VT   IE+E Q       +  + NN IF+K+ ++RE  + I LRL+  D+G PK  ++  +   I+D+NDN PIL+ P     + +  L + +T+ N  I  + A D D+  N  + ++I+  +      F++ +T G I + W       I     G++ ++I + DS +  + ST  +FY+ I   S+
Sbjct:    3 LFHVIFCISLADAIAEEHSINMKLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQKNYRM-SLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLF--ITTIDRNDNKPIFTD---------ILYRKT----VKENTTYTIPILQVQAKDLDEGENGKISYRF---DTLTPQEINDKFSLNKL--TGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSV-HNKVKCN--KNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAG-NKEF---VINISTGYIYLYNSLDREVKEMLEFFVYATDG-----------GGLEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVT---IENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWETITISIIDINDNDPILEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIM-DDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRSTKSHFYLTIREYSA 776          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000008875.1 (SMESG000008875.1)

HSP 1 Score: 284.263 bits (726), Expect = 8.295e-80
Identity = 247/818 (30.20%), Postives = 391/818 (47.80%), Query Frame = 1
Query:  412 LVNILFSLNYV-FLKKTNQIEFNLIDVTPKETIIGSLLQSENSQ----NTKISFNNVVLRSYSDLFKIDSKGNLTTLTHIDRD---DICIRLSCCKDSICTIKMTAVLIFPN---SISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSD-PSNTFNYSLIHNEPHMTLIKPLDRETI--EIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTEL-FASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKT-GEILTNWESYETLKI-----GIFYLHISIYDSGTPSL-STNVYFYVNITSASS 2799
            L +++F ++    + + + I   L D  PK T +G++ +  N Q    N  I         + + FK+   G++ T   IDRD   +IC  LSCC   IC  +  A+L + +   +++++I   I DENDN P F      IN+ E  +   +  LP A D DS  NG+  YSLS+     F  S+    P + ++  L+ E +    ++L L  +++  Q  + SLF  +   D NDNKP F           I Y ++    +KEN T +  I    A D DEGEN KI+Y     D+  P  +  KFS+     T +I+L   LDYE   ++ I   I A D G PQ S S  + I+  DINDN P+I       I EN +  T +   +V D D +  + + CN  + S   F+L     +   +     FDYE S    + + C D   P +    +  I I DENDN P +T+ ++   + E S  N+F+ + +ATD DS  FGK+ + + +A   K F    I+   G +YL  S+DRE    L + +  TD                   K++I + DINDN PR  S K    + EN PI +++  +E  D D+  +  VT   IE+E Q       +  + NN IF+K+ ++RE  + I LRL+  D+G PK  ++  +   I+D+NDN PIL+ P     + +  L + +T+ N  I  + A D D+  N  + ++I+  +      F++ +T G I + W       I     G++ ++I + DS +  + ST  +FY+ I   S+
Sbjct:    3 LFHVIFCISLADAIAEEHSINMKLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQKNYRM-SLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRGGQFETMSLF--ITTIDRNDNKPIFTD---------ILYRKT----VKENTTYTIPILQVQAKDLDEGENGKISYRF---DTLTPQEINDKFSLNKL--TGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSV-HNKVKCN--KNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAG-NKEF---VINISTGYIYLYNSLDREVKEMLEFFVYATDG-----------GGLEASVKVSITVMDINDNPPRLKSPKI-LTVLENEPIGTLIGNVEVFDLDDGENARVT---IENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGRPKLTSWETITISIIDINDNDPILEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIM-DDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRSTKSHFYLTIREYSA 776          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000044059.1 (SMESG000044059.1)

HSP 1 Score: 281.567 bits (719), Expect = 8.919e-80
Identity = 246/791 (31.10%), Postives = 381/791 (48.17%), Query Frame = 1
Query:  490 TPKETIIGSLLQSENSQNTKISFNNVVLRS----YSDLFKIDSKGNLTTLTHIDRD---DICIRLSCCKDSICTIKMTAVLIFPNS---ISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKLPMAVDKDSPGNGIDRYSLSD-PSNTFNYSLIHNEPHMTLIKPLDRETI--EIYNLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSESFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTKFSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTINLLDINDNFPQITEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNLSEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQTTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKFGKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTDNFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPINSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKNELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNNSFIPNTEL-FASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFRIQKT-GEILTNWESYETLKI-----GIFYLHISIYDSGTPSL-STNVYFYVNITSASS 2799
             P  T +G++ +  N Q     +N +V  S    + D FKI   G++ T   IDRD   +IC  LSCC   IC  +  A+L   ++   ++++I   I DENDN P F      IN+ E  +   +  LP A D DS  NG+  YSLS+     F  S+    P + ++  L+ E +    ++L L  ++K  Q  + SLF  +   D NDNKP F  L          Y ++    +KEN T +  I    A D DEGEN KI+Y   S  S+    +  KFS+     T +I+L   LDYE   ++     I A D G PQ S S  + I+  DINDN P+I       I EN +  T +   +V D D +  + + C +   +   F+L     D   +     FDYE S  + + + C D   P +T   +  I I DENDN P +T+ ++   + E S  N+F+ + +ATD DS  FGK+ + + +    KTF+   I+   G +YL  S+DRE   +L + +  TD                   K++I + DINDN P+  S K    + EN  I +++  +E  D D+  +  VT   IE+E         +F + NN IF+K+ ++RE    I LRL+  D G PK  ++  +   I+DVNDN PIL+ PP    + +  L + +T  N  I  + A D D+G N  + ++I+  +      F++ +T G I + W   +   I     G++ L+I + DS +  + ST  +FY+ I + S+
Sbjct:   30 VPISTNVGNIFKMLNYQQFYERYNIIVGTSTFTNFDDFFKIFKSGDIITTKFIDRDNWEEICGPLSCCLKEICKFQANAILYIQSAKPAVTFKINFEIFDENDNPPKFNLFWFNINVLEEHKHYRV-SLPTAYDLDSSINGVYNYSLSENHKRFFQLSMEKGYPELLILSALNFENLNERKFHLQLTAFDKGGQFETISLF--ITTIDLNDNKPIFTELL---------YQKT----VKENTTYTIPILQVQAKDLDEGENGKISYRFGSLTSHE---IKDKFSLNKL--TGEIKLLQKLDYEIYSDQLKEFTIEAIDEGSPQLSGSCKIEIHSSDINDNSPRIEILKNVSIPENKQIVTPIMSIYVHDDDSVHSE-VKCKIRNNN---FRLHSSQVDSLTIYMERSFDYENSNIQQIDIKCFDSGIPRMTTYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLNDMG-NKTFS---INTSTGYIYLYNSLDREVKEKLEFFVYATDG-----------GGLEASVKVSITVMDINDNPPKLKSPKL-LNVLENEQIGTLIGNVEVFDLDDGENARVT---IENEFHKNLLFYSYFKLDNNKIFIKSSIDREKVPQIFLRLKLVDYGRPKLTSWETITIFIIDVNDNDPILEYPPEGEIMSSRLLIYVNTSINSFILNLLARDSDFGENGEIRFRIM-DDCNGSSYFQVNETSGAIYSTWSCRDGQFISCPIAGLYRLNIELKDSSSIIVRSTKSHFYLTIRNYSA 775          
The following BLAST results are available for this feature:
BLAST of Protocadherin-9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH92.456e-7028.01protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH99.754e-7028.08protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH99.962e-7028.08protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH91.234e-6928.08protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH11Y6.262e-6929.57protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-11.978e-3925.23FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-13.442e-3424.53FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-12.612e-2521.27CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
cdh-44.608e-2424.09Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI... [more]
hmr-11.050e-2122.36Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stan2.974e-4425.54gene:FBgn0024836 transcript:FBtr0304900[more]
stan3.076e-4425.54gene:FBgn0024836 transcript:FBtr0304899[more]
stan3.076e-4425.54gene:FBgn0024836 transcript:FBtr0300578[more]
stan3.617e-4425.54gene:FBgn0024836 transcript:FBtr0303223[more]
stan3.617e-4425.54gene:FBgn0024836 transcript:FBtr0088214[more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CT030123.17.408e-6926.56protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.19.587e-6926.49protocadherin 1b [Source:NCBI gene;Acc:572016][more]
pcdh1b1.260e-6826.49protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-... [more]
CT030123.11.262e-6826.56protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.11.362e-6826.49protocadherin 1b [Source:NCBI gene;Acc:572016][more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vapa3.662e-7028.46VAMP associated protein A [Source:Xenbase;Acc:XB-G... [more]
ENSXETT00000047804.12.518e-6727.52protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047798.12.967e-6727.52protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047801.13.122e-6727.52protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
pcdh179.972e-6325.00protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh91.797e-7027.82protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh11x1.336e-6928.77protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh92.457e-6927.75protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh92.475e-6927.75protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh11x2.718e-6928.77protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9HC56|PCDH9_HUMAN4.784e-6928.08Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 P... [more]
sp|Q9BZA8|PC11Y_HUMAN2.269e-6729.57Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 ... [more]
sp|Q71M42|PC11X_PANTR3.801e-6729.57Protocadherin-11 X-linked OS=Pan troglodytes OX=95... [more]
sp|Q6WYY1|PC11X_PANPA4.228e-6729.57Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
sp|Q6X862|PC11X_GORGO5.277e-6729.45Protocadherin-11 X-linked OS=Gorilla gorilla goril... [more]
back to top
BLAST of Protocadherin-9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A419QEP19.937e-9328.98Protocadherin-11 X-linked OS=Clonorchis sinensis O... [more]
H2KPP41.528e-9228.98Protocadherin-11 Y-linked (Fragment) OS=Clonorchis... [more]
A0A5J4NPD48.884e-9230.66Protocadherin delta 1 OS=Paragonimus westermani OX... [more]
A0A183A4X01.523e-9129.77Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A2H1CV874.521e-8929.88Cadherin domain protein OS=Fasciola hepatica OX=61... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh92.207e-6628.31protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh92.897e-6628.31protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh1b3.191e-6426.69protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-... [more]
pcdh111.382e-6227.34protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh114.276e-6227.06protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh119.039e-5725.38protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000010725.11.830e-4824.75pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
ENSPMAT00000006996.14.873e-4025.35pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 g... [more]
si:ch211-199f5.11.500e-3722.63protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000008517.11.007e-3624.08pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461894.111e-5427.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354124.408e-5326.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348158.369e-4025.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404701.212e-3724.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482371.918e-3727.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh91.150e-6327.58protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh92.485e-6327.58protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh94.185e-6327.58protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh1b5.636e-6226.02protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
pcdh1b9.947e-6226.15protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
back to top
BLAST of Protocadherin-9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005371.10.000e+099.81SMESG000005371.1[more]
SMESG000008875.14.640e-8030.20SMESG000008875.1[more]
SMESG000008875.17.286e-8030.20SMESG000008875.1[more]
SMESG000008875.18.295e-8030.20SMESG000008875.1[more]
SMESG000044059.18.919e-8031.10SMESG000044059.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032428 ID=SMED30032428|Name=Protocadherin-9|organism=Schmidtea mediterranea sexual|type=transcript|length=3642bp
AACCAAAAATGATTTTTTTCGAAACACCGAATTAAGCAATTACCATATTC
ACATTGTTAATGAAAAGAGCGCTTTATCGAAATTTAAAAACTAGAATGAG
AGTTTTATTTTTCCACTCAAACACATGTGCTGAAGATTAATTTCACATGC
TAAGAAGAAAACGAAAGAGTGACGTCTGATGTTTTTAGTTCTCAACGCAT
GTAGACATCCCAGATAAATGGGATACAAAATATAAATTTTAGCTGAACAT
GATTGGTTAAAAAAGCAAATAATTGAGAAATCTTATAACTGGTGGTAGTA
TTGAATCTAGTAATTCAATTGAATCAGGCATCTTATTTCATTGTTTATTG
TTAAAATTGAATTATCTGGGTCAATCGTGTTTCGAAATGATCTAATATGA
AAATCAGTCATTTGGTTAACATTCTATTTTCGCTAAATTATGTATTTTTG
AAGAAAACAAACCAAATTGAGTTCAACCTTATAGATGTCACTCCAAAAGA
AACAATCATAGGAAGCCTTTTACAATCAGAAAACAGTCAAAACACCAAGA
TTTCTTTTAATAATGTCGTTTTAAGAAGTTACAGTGATCTTTTTAAAATA
GATTCAAAAGGAAATTTAACCACATTGACTCACATAGACCGGGATGATAT
TTGCATTCGATTATCTTGTTGTAAAGATTCGATATGTACAATAAAAATGA
CAGCTGTTCTGATTTTCCCCAACTCCATTTCCTATGAAATCATTTTGAAT
ATCAAAGATGAAAATGATAATAGACCAACATTTGTCAGTCCACTCACTGT
CATCAATATTCCAGAATCAGCAGAATTGCAGTCACTGTATAAATTGCCTA
TGGCAGTTGATAAAGATTCTCCAGGAAACGGAATCGACAGGTACAGCTTA
TCTGATCCATCTAACACATTTAATTACAGTTTGATTCATAACGAACCACA
TATGACTTTAATAAAGCCATTAGATCGAGAGACTATAGAGATATATAATT
TATCATTATATGTTTATGAAAAACAAAGACAAATGTTTAGTAATTCATTA
TTCTTTCAGGTAAAGGTTTCTGACGACAATGACAATAAACCGTATTTTGT
AACATTAAATTCAGATTTTAAATATATTCCAATAAATTATTCAGAATCGT
TTGTAATTTATATTAAAGAAAATCAAACCCTAAGTCAAGAAATATACTCA
TTTCATGCTTTAGACAATGATGAGGGAGAAAATTCCAAAATTGCCTATAG
CATATCATCAAGAGACAGTTATCCTCCAAACGTAGTGACGACAAAGTTCA
GCATAGAATCACCTTCAGAAACTGCTAAAATTCGATTGAGATTAAATTTA
GATTACGAAAACCAAGAAGAAAGACACATCATCCTTGTAATATTAGCCAC
TGACAATGGGAAACCCCAAAGATCCGCAAGTGTAAGTCTAACAATAAATC
TTCTTGATATTAATGACAATTTCCCTCAAATCACTGAAAAATCTCCAAAC
CGAATATCAGAAAACGACAAGAGAGAGACAGTTTTAAAAATATTTCACGT
CAGTGACAAAGATCTAATTTCAAAAGACAATATCAGTTGTAATTTGAGTG
AAGAATCAAAAAGAAAATTCAAATTGACAAAACATTTTTGGGATGTTTAT
AATTTAAACAACATTATTCCATTTGACTATGAAAAGTCCAGACATGAAAC
GGTTCAGTTAATTTGCATTGACAAAGCTGAACCTGAGTTAACTCAAACAA
CAAATTTCAAAATTGAAATCTTTGATGAAAATGACAATATTCCTCAATGG
ACCCAAAAGGAATATCATGTAAATGTCGAAGAGTGTTCCAATTCCAATAA
ATTCATTATCAAAGTAAACGCAACAGATTCTGATAGTGAGAAATTCGGGA
AATTATATTTCAATATTACTGAAGCCGATATTCCTAAAACCTTCAATTTC
ATTCGAATAGATCATCAAAACGGCAATGTCTACCTAACAACGTCCATAGA
CCGTGAAAGGTTTCCGCAATTGGTTTACAACATCACCGTCACTGATAACT
TTGACAGACATCCCGATTTTAATACAAATATAACCCAATTTTCTAATAAA
ACTAAATTAACGATAGACATTAAAGATATCAATGACAATTCTCCTAGATA
TCCTTCACAGAAAACCCATTTCAAAATTCCAGAAAATTTACCCATCAATT
CCATTGTGGAAAAGTTGGAATTCGTTGATGATGATGAATACCCATCCAAT
GTTGTGACGCTGAAATTCATTGAAAGTGAAAGTCAAACTTTCGACGAGTC
CAATTATTGGTTTGGTATTGTTAACAATACAATTTTTGTAAAGAATGAAT
TAAATAGAGAACATAAAAACAACATAACTCTTAGACTTCAAGCTGAGGAT
AATGGGAGTCCAAAGAGAAGGACGTTTGTGAATTTACATTTTGAAATTTT
AGATGTAAATGACAATTCTCCGATTTTAAAAAGTCCACCAAATAACTCAT
TTATTCCGAACACCGAACTGTTTGCCTCTACTGAAAAAAATAAAATCATT
GCTAAAATCGAGGCAGATGATCCCGATTATGGGTTAAATAGCACCTTGAA
TTACAAAATTCTCCATTCAAATTTGACCAACAAGCACAGTTTTCGAATTC
AGAAAACCGGAGAAATACTTACGAATTGGGAAAGCTATGAAACTCTCAAA
ATAGGAATTTTCTATCTTCACATTTCAATTTATGACAGTGGAACACCCTC
TCTATCTACAAATGTGTATTTTTATGTAAATATTACGAGTGCCTCGAGTC
CAACAGCAGAGGCTTACATGAGCAATATTGTCATATTAATTTTAATTATT
GTGTGCAGTTTGGCTTTAATTGTTTCTTTAATTGCTGCCATATTCTGGGT
TCGTTTTCGCGTTTCAAATGATACCCCAATTAATGATCAAGAGGAATTTT
ACGAACGAGAACATCTTAATAAAGAGAACAATCAGTATTCGTTGAATAAC
ATAGGTAAAGCTTTCACGCAAAATTCCTACGAAAATAACCGACTTAATAC
GTATGAAGCTTTTCAGGGATATCATCACGATTCATATGTTCAGAGTCGAA
ATCATAATAACTATTCGCACAATACAATGAATGAAACTTTCGAGAAACCG
ATTTTAACAGCGTGTGGCGGTTGTATGCTTTACCAAACGGTGCCCCATCA
GTTCAATCGACTCAGACATTCAAATATTACAGATTATAACAACACTTTAT
TATCTACTAATCAAAAAACATTGATGTTACAAGGTTGTATAGATAATGAT
TATAAAACCATTCCAAATATCCAGTCTACTGCTTTAATGGTTGAACCGAA
CTTTTCCGACAGTGGTAAAGGAGGCAGTGTCGAAGATTTGAACACTCGCC
AAATAAGTGGAATATCCACTTTTACAAATTCCTCTATTGTAAATACATCA
TCGGCCAATGCAAAATTATTTTGCCAAAAATCAAATTTTGAATTAAAACG
TAACCCATATTCATATGACAAATCTGAAGAAACGATGTTTTAATTTTTGA
ATTTTTGTACAAAAAAATTTTATTTTATTTTCCAACATTTATATTAATTG
AAAAAAAAATTGAAATCGTTTATTTCTGGTCTGATTTTTTTT
back to top

protein sequence of SMED30032428-orf-1

>SMED30032428-orf-1 ID=SMED30032428-orf-1|Name=SMED30032428-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1049bp
MKISHLVNILFSLNYVFLKKTNQIEFNLIDVTPKETIIGSLLQSENSQNT
KISFNNVVLRSYSDLFKIDSKGNLTTLTHIDRDDICIRLSCCKDSICTIK
MTAVLIFPNSISYEIILNIKDENDNRPTFVSPLTVINIPESAELQSLYKL
PMAVDKDSPGNGIDRYSLSDPSNTFNYSLIHNEPHMTLIKPLDRETIEIY
NLSLYVYEKQRQMFSNSLFFQVKVSDDNDNKPYFVTLNSDFKYIPINYSE
SFVIYIKENQTLSQEIYSFHALDNDEGENSKIAYSISSRDSYPPNVVTTK
FSIESPSETAKIRLRLNLDYENQEERHIILVILATDNGKPQRSASVSLTI
NLLDINDNFPQITEKSPNRISENDKRETVLKIFHVSDKDLISKDNISCNL
SEESKRKFKLTKHFWDVYNLNNIIPFDYEKSRHETVQLICIDKAEPELTQ
TTNFKIEIFDENDNIPQWTQKEYHVNVEECSNSNKFIIKVNATDSDSEKF
GKLYFNITEADIPKTFNFIRIDHQNGNVYLTTSIDRERFPQLVYNITVTD
NFDRHPDFNTNITQFSNKTKLTIDIKDINDNSPRYPSQKTHFKIPENLPI
NSIVEKLEFVDDDEYPSNVVTLKFIESESQTFDESNYWFGIVNNTIFVKN
ELNREHKNNITLRLQAEDNGSPKRRTFVNLHFEILDVNDNSPILKSPPNN
SFIPNTELFASTEKNKIIAKIEADDPDYGLNSTLNYKILHSNLTNKHSFR
IQKTGEILTNWESYETLKIGIFYLHISIYDSGTPSLSTNVYFYVNITSAS
SPTAEAYMSNIVILILIIVCSLALIVSLIAAIFWVRFRVSNDTPINDQEE
FYEREHLNKENNQYSLNNIGKAFTQNSYENNRLNTYEAFQGYHHDSYVQS
RNHNNYSHNTMNETFEKPILTACGGCMLYQTVPHQFNRLRHSNITDYNNT
LLSTNQKTLMLQGCIDNDYKTIPNIQSTALMVEPNFSDSGKGGSVEDLNT
RQISGISTFTNSSIVNTSSANAKLFCQKSNFELKRNPYSYDKSEETMF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0000418head
PLANA:0002056medial muscle cell
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 564..583
score: 36.49
coord: 468..497
score: 30.62
coord: 642..668
score: 21.05
coord: 676..693
score: 40.49
coord: 583..596
score: 22.75
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 383..466
e-value: 0.0022
score: 27.3
coord: 607..692
e-value: 1.3E-9
score: 47.9
coord: 721..804
e-value: 0.1
score: 13.9
coord: 37..127
e-value: 0.16
score: 11.8
coord: 151..232
e-value: 9.4E-7
score: 38.4
coord: 490..583
e-value: 8.7E-10
score: 48.5
coord: 269..360
e-value: 1.1E-19
score: 81.4
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 473..558
e-value: 6.6E-9
score: 36.1
coord: 591..684
e-value: 1.3E-8
score: 35.2
coord: 135..212
e-value: 4.1E-7
score: 30.4
coord: 253..352
e-value: 1.5E-14
score: 54.2
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 691..806
e-value: 1.2E-12
score: 50.1
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 232..358
e-value: 4.9E-22
score: 80.5
coord: 359..463
e-value: 8.4E-13
score: 50.7
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 464..580
e-value: 3.1E-20
score: 74.7
coord: 123..231
e-value: 3.9E-16
score: 61.5
coord: 581..690
e-value: 5.1E-19
score: 70.8
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 24..121
e-value: 1.3E-5
score: 27.3
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 563..909
coord: 22..552
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 469..585
score: 20.437
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 370..468
score: 12.216
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 45..129
score: 9.234
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 718..804
score: 11.405
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 130..234
score: 16.951
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 586..694
score: 18.552
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 248..362
score: 22.936
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 711..797
e-value: 3.01584E-10
score: 56.1678
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 472..581
e-value: 2.55111E-16
score: 73.5017
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 591..690
e-value: 3.62149E-16
score: 72.7313
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 135..230
e-value: 2.66642E-11
score: 58.8641
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 369..464
e-value: 3.60819E-8
score: 50.0046
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 251..358
e-value: 2.48133E-23
score: 93.1469
NoneNo IPR availableTMHMMTMhelixcoord: 813..835
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 117..127
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 350..360
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 456..466
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 251..355
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 687..797
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 355..460
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 118..252
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 462..554
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 573..704