pou4l-1

Overview
Namepou4l-1 (AIX99546.1)
Smed IDSMED30032426
Length (bp)1462
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of pou4l-1 (SMED30032426) t-SNE clustered cells

Violin plots show distribution of expression levels for pou4l-1 (SMED30032426) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of pou4l-1 (SMED30032426) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for pou4l-1 (SMED30032426) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032426

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30032426SMESG000013430.1 dd_Smed_v4_15555_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032426SMESG000013430.1 dd_Smed_v4_15555_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30032426SMESG000013430.1 dd_Smed_v4_15555_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30032426SMESG000013430.1 dd_Smed_v4_15555_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30032426SMESG000013430.1 KJ187188smed_ncbi_20200123PMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30032426SMESG000013430.1 KJ187188smed_ncbi_20200123PMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of pou4l-1 vs. Ensembl Human
Match: POU4F3 (POU class 4 homeobox 3 [Source:HGNC Symbol;Acc:HGNC:9220])

HSP 1 Score: 239.965 bits (611), Expect = 1.436e-74
Identity = 125/160 (78.12%), Postives = 140/160 (87.50%), Query Frame = 2
Query:  854 LNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVN 1333
            +  DPRELE F+ERFKQRRIKLGVTQADVG AL NLK+ GVGSLSQSTICRFESLTLSHNNM+ALKP+LQAWLEEAE    E+   P+++N S +RKRKRTSI   EKRSLEAYFA+QPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKRMK+S V+
Sbjct:  180 VESDPRELEAFAERFKQRRIKLGVTQADVGAALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNSKPELFNGS-ERKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH 338          
BLAST of pou4l-1 vs. Ensembl Human
Match: POU4F1 (POU class 4 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9218])

HSP 1 Score: 236.113 bits (601), Expect = 4.229e-72
Identity = 125/158 (79.11%), Postives = 138/158 (87.34%), Query Frame = 2
Query:  857 NYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTV 1330
            + DPRELE F+ERFKQRRIKLGVTQADVG AL NLK+ GVGSLSQSTICRFESLTLSHNNM+ALKPILQAWLEEAE    E++  P+++N   ++KRKRTSI   EKRSLEAYFAVQPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKRMKFS  
Sbjct:  262 DTDPRELEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEGAQREKMNKPELFNGG-EKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSAT 418          
BLAST of pou4l-1 vs. Ensembl Human
Match: POU4F2 (POU class 4 homeobox 2 [Source:HGNC Symbol;Acc:HGNC:9219])

HSP 1 Score: 234.958 bits (598), Expect = 7.224e-72
Identity = 123/158 (77.85%), Postives = 141/158 (89.24%), Query Frame = 2
Query:  854 LNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFST 1327
            ++ DPR+LE F+ERFKQRRIKLGVTQADVG AL NLK+ GVGSLSQSTICRFESLTLSHNNM+ALKPILQAWLEEAE+   E+L  P+++N + ++KRKRTSI   EKRSLEAYFA+QPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKRMK+S 
Sbjct:  251 VDADPRDLEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEKSHREKLTKPELFNGA-EKKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSA 407          
BLAST of pou4l-1 vs. Ensembl Human
Match: POU3F2 (POU class 3 homeobox 2 [Source:HGNC Symbol;Acc:HGNC:9215])

HSP 1 Score: 136.346 bits (342), Expect = 1.393e-34
Identity = 83/161 (51.55%), Postives = 106/161 (65.84%), Query Frame = 2
Query:  833 PHPIQDQLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRM 1315
            PH  +D    D  +LE F+++FKQRRIKLG TQADVG ALG L  +     SQ+TICRFE+L LS  NM  LKP+L  WLEEA+  +        I      RK KRTSI  + K +LE++F   P+PS+++I  +AD L L+K VVRVWFCN+RQK+KRM
Sbjct:  258 PHSDEDTPTSD--DLEQFAKQFKQRRIKLGFTQADVGLALGTLYGN---VFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRK-KRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRM 412          
BLAST of pou4l-1 vs. Ensembl Human
Match: POU3F3 (POU class 3 homeobox 3 [Source:HGNC Symbol;Acc:HGNC:9216])

HSP 1 Score: 135.961 bits (341), Expect = 3.739e-34
Identity = 84/162 (51.85%), Postives = 107/162 (66.05%), Query Frame = 2
Query:  833 PHPIQDQLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSL-SQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRM 1315
            PH  +D    D  +LE F+++FKQRRIKLG TQADVG ALG L     G++ SQ+TICRFE+L LS  NM  LKP+L  WLEEA+           I      RK KRTSI  + K +LE++F   P+PS+++I  +AD L L+K VVRVWFCN+RQK+KRM
Sbjct:  310 PHSDEDTPTSD--DLEQFAKQFKQRRIKLGFTQADVGLALGTL----YGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRK-KRTSIEVSVKGALESHFLKCPKPSAQEITNLADSLQLEKEVVRVWFCNRRQKEKRM 464          
BLAST of pou4l-1 vs. Ensembl Celegans
Match: unc-86 (Transcription factor unc-86 [Source:UniProtKB/Swiss-Prot;Acc:P13528])

HSP 1 Score: 207.608 bits (527), Expect = 3.875e-63
Identity = 111/160 (69.38%), Postives = 127/160 (79.38%), Query Frame = 2
Query:  839 PIQDQLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYN--DSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKR 1312
            P    ++ DPR+LE F+E FKQRRIKLGVTQADVGKAL +LK+ GVGSLSQSTICRFESLTLSHNNMVALKPIL +WLE+AE    ++    DI     + D+KRKRTSI   EKR LE +F  QPRPS E+IA IAD+L+LKKNVVRVWFCNQRQKQKR
Sbjct:   95 PPTSDMDTDPRQLETFAEHFKQRRIKLGVTQADVGKALAHLKMPGVGSLSQSTICRFESLTLSHNNMVALKPILHSWLEKAEEAMKQKDTIGDINGILPNTDKKRKRTSIAAPEKRELEQFFKQQPRPSGERIASIADRLDLKKNVVRVWFCNQRQKQKR 254          
BLAST of pou4l-1 vs. Ensembl Celegans
Match: unc-86 (Transcription factor unc-86 [Source:UniProtKB/Swiss-Prot;Acc:P13528])

HSP 1 Score: 207.608 bits (527), Expect = 1.862e-62
Identity = 111/160 (69.38%), Postives = 127/160 (79.38%), Query Frame = 2
Query:  839 PIQDQLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYN--DSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKR 1312
            P    ++ DPR+LE F+E FKQRRIKLGVTQADVGKAL +LK+ GVGSLSQSTICRFESLTLSHNNMVALKPIL +WLE+AE    ++    DI     + D+KRKRTSI   EKR LE +F  QPRPS E+IA IAD+L+LKKNVVRVWFCNQRQKQKR
Sbjct:  151 PPTSDMDTDPRQLETFAEHFKQRRIKLGVTQADVGKALAHLKMPGVGSLSQSTICRFESLTLSHNNMVALKPILHSWLEKAEEAMKQKDTIGDINGILPNTDKKRKRTSIAAPEKRELEQFFKQQPRPSGERIASIADRLDLKKNVVRVWFCNQRQKQKR 310          
BLAST of pou4l-1 vs. Ensembl Celegans
Match: ceh-6 (Homeobox protein ceh-6 [Source:UniProtKB/Swiss-Prot;Acc:P20268])

HSP 1 Score: 125.946 bits (315), Expect = 9.267e-32
Identity = 79/161 (49.07%), Postives = 104/161 (64.60%), Query Frame = 2
Query:  866 PRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSL-SQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRK-RTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVNLDH 1342
            P +LE F+++FKQRRIKLG TQADVG ALG L     G++ SQ+TICRFE+L LS  NM  LKP+L  WLEEA+          +       RKRK RTSI    K  LE +F    +P++++I Q+A +L L+K VVRVWFCN+RQK+KR+  +  +  H
Sbjct:  192 PDDLEGFAKQFKQRRIKLGYTQADVGVALGTL----YGNIFSQTTICRFEALQLSFKNMCKLKPLLFKWLEEADSTTGSPNSTFEKMTGQAGRKRKKRTSIEVNVKSRLEFHFQSNQKPNAQEITQVAMELQLEKEVVRVWFCNRRQKEKRIAPNQYDAPH 348          
BLAST of pou4l-1 vs. Ensembl Celegans
Match: ceh-18 (Homeobox protein ceh-18 [Source:UniProtKB/Swiss-Prot;Acc:P41934])

HSP 1 Score: 107.071 bits (266), Expect = 1.610e-24
Identity = 68/190 (35.79%), Postives = 98/190 (51.58%), Query Frame = 2
Query:  860 YDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDS--------------------------------------LDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRM 1315
             D  ELE F++ FK++RIK G TQ DVG ALG  K  G    SQ+TI RFE+L LS  NM  L+P+L+ WL + E          D+ +                                        + R+RKRT++   ++ +L+ +FA+ PRP  +K+  IA+ L L ++VVRVWFCN+RQK +R+
Sbjct:  291 IDMNELEAFAQTFKKQRIKFGFTQGDVGVALG--KRYGT-DFSQTTISRFEALNLSFKNMCKLRPLLKEWLADVEMAIEGGATVTDLIDKKTIHNGNHHTIHHVDIHETSISNSISSVTASSLLSREQHVKRRRKRTNLDMNQRNALDTFFALNPRPDHDKMTDIANSLELDRDVVRVWFCNRRQKMRRV 477          
BLAST of pou4l-1 vs. Ensembl Celegans
Match: ceh-18 (Homeobox protein ceh-18 [Source:UniProtKB/Swiss-Prot;Acc:P41934])

HSP 1 Score: 106.686 bits (265), Expect = 1.832e-24
Identity = 68/190 (35.79%), Postives = 98/190 (51.58%), Query Frame = 2
Query:  860 YDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDS--------------------------------------LDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRM 1315
             D  ELE F++ FK++RIK G TQ DVG ALG  K  G    SQ+TI RFE+L LS  NM  L+P+L+ WL + E          D+ +                                        + R+RKRT++   ++ +L+ +FA+ PRP  +K+  IA+ L L ++VVRVWFCN+RQK +R+
Sbjct:  293 IDMNELEAFAQTFKKQRIKFGFTQGDVGVALG--KRYGT-DFSQTTISRFEALNLSFKNMCKLRPLLKEWLADVEMAIEGGATVTDLIDKKTIHNGNHHTIHHVDIHETSISNSISSVTASSLLSREQHVKRRRKRTNLDMNQRNALDTFFALNPRPDHDKMTDIANSLELDRDVVRVWFCNRRQKMRRV 479          
BLAST of pou4l-1 vs. Ensembl Fly
Match: acj6 (gene:FBgn0000028 transcript:FBtr0305192)

HSP 1 Score: 227.639 bits (579), Expect = 6.894e-70
Identity = 125/162 (77.16%), Postives = 138/162 (85.19%), Query Frame = 2
Query:  836 HPIQDQLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYN--DSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRM 1315
            HP  D    DPRELE F+ERFKQRRIKLGVTQADVGKAL NLKL GVG+LSQSTICRFESLTLSHNNM+ALKPILQAWLEEAE QA  + ++PD  +   + ++KRKRTSI   EKRSLEAYFAVQPRPS EKIA IA+KL+LKKNVVRVWFCNQRQKQKR+
Sbjct:  183 HPDTDT---DPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRI 341          
BLAST of pou4l-1 vs. Ensembl Fly
Match: acj6 (gene:FBgn0000028 transcript:FBtr0305193)

HSP 1 Score: 227.254 bits (578), Expect = 1.016e-69
Identity = 125/162 (77.16%), Postives = 138/162 (85.19%), Query Frame = 2
Query:  836 HPIQDQLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYN--DSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRM 1315
            HP  D    DPRELE F+ERFKQRRIKLGVTQADVGKAL NLKL GVG+LSQSTICRFESLTLSHNNM+ALKPILQAWLEEAE QA  + ++PD  +   + ++KRKRTSI   EKRSLEAYFAVQPRPS EKIA IA+KL+LKKNVVRVWFCNQRQKQKR+
Sbjct:  194 HPDTDT---DPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRI 352          
BLAST of pou4l-1 vs. Ensembl Fly
Match: acj6 (gene:FBgn0000028 transcript:FBtr0305191)

HSP 1 Score: 227.254 bits (578), Expect = 1.019e-69
Identity = 125/162 (77.16%), Postives = 138/162 (85.19%), Query Frame = 2
Query:  836 HPIQDQLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYN--DSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRM 1315
            HP  D    DPRELE F+ERFKQRRIKLGVTQADVGKAL NLKL GVG+LSQSTICRFESLTLSHNNM+ALKPILQAWLEEAE QA  + ++PD  +   + ++KRKRTSI   EKRSLEAYFAVQPRPS EKIA IA+KL+LKKNVVRVWFCNQRQKQKR+
Sbjct:  190 HPDTDT---DPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRI 348          
BLAST of pou4l-1 vs. Ensembl Fly
Match: acj6 (gene:FBgn0000028 transcript:FBtr0305196)

HSP 1 Score: 227.254 bits (578), Expect = 1.659e-69
Identity = 125/162 (77.16%), Postives = 138/162 (85.19%), Query Frame = 2
Query:  836 HPIQDQLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYN--DSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRM 1315
            HP  D    DPRELE F+ERFKQRRIKLGVTQADVGKAL NLKL GVG+LSQSTICRFESLTLSHNNM+ALKPILQAWLEEAE QA  + ++PD  +   + ++KRKRTSI   EKRSLEAYFAVQPRPS EKIA IA+KL+LKKNVVRVWFCNQRQKQKR+
Sbjct:  202 HPDTDT---DPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRI 360          
BLAST of pou4l-1 vs. Ensembl Fly
Match: acj6 (gene:FBgn0000028 transcript:FBtr0074015)

HSP 1 Score: 226.868 bits (577), Expect = 3.560e-69
Identity = 125/162 (77.16%), Postives = 138/162 (85.19%), Query Frame = 2
Query:  836 HPIQDQLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYN--DSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRM 1315
            HP  D    DPRELE F+ERFKQRRIKLGVTQADVGKAL NLKL GVG+LSQSTICRFESLTLSHNNM+ALKPILQAWLEEAE QA  + ++PD  +   + ++KRKRTSI   EKRSLEAYFAVQPRPS EKIA IA+KL+LKKNVVRVWFCNQRQKQKR+
Sbjct:  220 HPDTD---TDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRI 378          
BLAST of pou4l-1 vs. Ensembl Zebrafish
Match: pou4f1 (POU class 4 homeobox 1 [Source:ZFIN;Acc:ZDB-GENE-000523-2])

HSP 1 Score: 240.35 bits (612), Expect = 1.178e-74
Identity = 127/159 (79.87%), Postives = 140/159 (88.05%), Query Frame = 2
Query:  857 NYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVN 1333
            + DPRELE F+ERFKQRRIKLGVTQADVG AL NLK+ GVGSLSQSTICRFESLTLSHNNM+ALKPILQAWLEEAE    E++  PDI+N S ++KRKRTSI   EKRSLEAYFAVQPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKR+KFS  +
Sbjct:  211 DTDPRELEAFAERFKQRRIKLGVTQADVGGALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEGAQREKMSKPDIFNGS-EKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRLKFSAAH 368          
BLAST of pou4l-1 vs. Ensembl Zebrafish
Match: pou4f3 (POU class 4 homeobox 3 [Source:NCBI gene;Acc:30534])

HSP 1 Score: 237.654 bits (605), Expect = 4.372e-74
Identity = 125/160 (78.12%), Postives = 140/160 (87.50%), Query Frame = 2
Query:  854 LNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVN 1333
            +  DPRELE F+ERFKQRRIKLGVTQADVG AL NLK+ GVGSLSQSTICRFESLTLSHNNM+ALKP+LQAWLEEAE    E+   PD++N + +RKRKRTSI   EKRSLEAYFA+QPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKRMK+S V+
Sbjct:  173 VESDPRELEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNGKPDLFNGN-ERKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH 331          
BLAST of pou4l-1 vs. Ensembl Zebrafish
Match: zgc:158291 (zgc:158291 [Source:ZFIN;Acc:ZDB-GENE-061215-70])

HSP 1 Score: 237.654 bits (605), Expect = 6.671e-74
Identity = 127/157 (80.89%), Postives = 138/157 (87.90%), Query Frame = 2
Query:  863 DPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVN 1333
            DPRELE F+ERFKQRRIKLGVTQADVG AL NLK+ GVG LSQSTICRFESLTLSHNNMVALKPIL+AWLEEAER   E++  P+I+N   D+KRKRTSI   EKRSLEAYFAVQPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKRMKFS  +
Sbjct:  188 DPRELESFAERFKQRRIKLGVTQADVGSALANLKIPGVGCLSQSTICRFESLTLSHNNMVALKPILEAWLEEAERAQREKMAKPEIFNGG-DKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATH 343          
BLAST of pou4l-1 vs. Ensembl Zebrafish
Match: zgc:158291 (zgc:158291 [Source:ZFIN;Acc:ZDB-GENE-061215-70])

HSP 1 Score: 237.654 bits (605), Expect = 6.671e-74
Identity = 127/157 (80.89%), Postives = 138/157 (87.90%), Query Frame = 2
Query:  863 DPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVN 1333
            DPRELE F+ERFKQRRIKLGVTQADVG AL NLK+ GVG LSQSTICRFESLTLSHNNMVALKPIL+AWLEEAER   E++  P+I+N   D+KRKRTSI   EKRSLEAYFAVQPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKRMKFS  +
Sbjct:  188 DPRELESFAERFKQRRIKLGVTQADVGSALANLKIPGVGCLSQSTICRFESLTLSHNNMVALKPILEAWLEEAERAQREKMAKPEIFNGG-DKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATH 343          
BLAST of pou4l-1 vs. Ensembl Zebrafish
Match: pou4f2 (POU class 4 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-040401-1])

HSP 1 Score: 230.72 bits (587), Expect = 1.442e-71
Identity = 122/159 (76.73%), Postives = 141/159 (88.68%), Query Frame = 2
Query:  854 LNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTV 1330
            ++ DPR+LE F+ERFKQRRIKLGVTQADVG AL +LK+ GVGSLSQSTICRFESLTLSHNNM+ALKPILQAWLEEAE+   E+L  P+++N + ++KRKRTSI   EKRSLEAYFA+QPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKRMK+S  
Sbjct:  161 VDADPRDLEAFAERFKQRRIKLGVTQADVGSALASLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEKSHREKLNKPELFNGA-EKKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAC 318          
BLAST of pou4l-1 vs. Ensembl Xenopus
Match: rnf220.1 (ring finger protein 220, gene 1 [Source:Xenbase;Acc:XB-GENE-485089])

HSP 1 Score: 239.965 bits (611), Expect = 1.172e-74
Identity = 126/175 (72.00%), Postives = 145/175 (82.86%), Query Frame = 2
Query:  833 PHPIQ--------DQLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVN 1333
            PHP+         + +  DPRELE F+ERFKQRRIKLGVTQADVG AL NLK+ GVGSLSQSTICRFESLTLSHNNM+ALKP+LQAWL+EAE    E+   P+++N S +RKRKRTSI   EKRSLEAYF++QPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKRMK+S V+
Sbjct:  164 PHPVSSHNGMSCINDVESDPRELEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLDEAEAAYREKNAKPELFNSS-ERKRKRTSIAAPEKRSLEAYFSIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH 337          
BLAST of pou4l-1 vs. Ensembl Xenopus
Match: POU4F1 (POU class 4 homeobox 1 [Source:NCBI gene;Acc:100488759])

HSP 1 Score: 236.884 bits (603), Expect = 4.091e-73
Identity = 126/156 (80.77%), Postives = 137/156 (87.82%), Query Frame = 2
Query:  863 DPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTV 1330
            DPRELE F+ERFKQRRIKLGVTQADVG AL NLK+ GVGSLSQSTICRFESLTLSHNNM+ALKPILQAWLEEAE    E+L  P+++N   ++KRKRTSI   EKRSLEAYFAVQPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKRMKFS  
Sbjct:  216 DPRELEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEGAQREKLNKPELFNGG-EKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSAT 370          
BLAST of pou4l-1 vs. Ensembl Xenopus
Match: pou4f1.2 (POU class 4 homeobox 1 [Source:NCBI gene;Acc:100037865])

HSP 1 Score: 236.884 bits (603), Expect = 1.655e-72
Identity = 126/154 (81.82%), Postives = 136/154 (88.31%), Query Frame = 2
Query:  863 DPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFS 1324
            DPRELE F+ERFKQRRIKLGVTQADVG AL NLK+ GVG LSQSTICRFESLTLSHNNMVALKPIL+AWLEEAER   E++  P+I+    D+KRKRTSI   EKRSLEAYFAVQPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKRMKFS
Sbjct:  257 DPRELESFAERFKQRRIKLGVTQADVGSALANLKIPGVGCLSQSTICRFESLTLSHNNMVALKPILEAWLEEAERAQREKMAKPEIFTGG-DKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFS 409          
BLAST of pou4l-1 vs. Ensembl Xenopus
Match: ppp2r2a (protein phosphatase 2 regulatory subunit B, alpha [Source:Xenbase;Acc:XB-GENE-971147])

HSP 1 Score: 233.417 bits (594), Expect = 1.301e-71
Identity = 123/157 (78.34%), Postives = 141/157 (89.81%), Query Frame = 2
Query:  854 LNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFS 1324
            ++ DPR+LE F+ERFKQRRIKLGVTQADVG AL NLK+ GVGSLSQSTICRFESLTLSHNNM+ALKPILQAWLEEAE+   E+L  P+++N + ++KRKRTSI   EKRSLEAYFA+QPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKRMK+S
Sbjct:  221 VDADPRDLEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEKSHREKLTKPELFNGA-EKKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYS 376          
BLAST of pou4l-1 vs. Ensembl Xenopus
Match: POU1F1 (POU class 1 homeobox 1 [Source:NCBI gene;Acc:100492413])

HSP 1 Score: 134.035 bits (336), Expect = 3.937e-35
Identity = 87/183 (47.54%), Postives = 120/183 (65.57%), Query Frame = 2
Query:  839 PIQDQLNYDP---RELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSL---DRKRKR-TSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMK-------FSTVNLDHH 1345
            PI + ++ D    RELE F+  FK RRIKLG TQ +VG+AL  +  S     SQ+TICRFE+L LS  N   LK IL  WL+EAE+  A       +YN+ +   +RKRKR T+I+ A K +LE++F  Q +PSS++I ++A+ LNL+K VVRVWFCN+RQ++KR+K       FS+ + DHH
Sbjct:  119 PIDEPIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGS---EFSQTTICRFENLQLSFKNACKLKSILSKWLDEAEQVGA-------LYNEKIGGNERKRKRRTTISIAAKEALESHFGEQSKPSSQEIMRMAEGLNLEKEVVRVWFCNRRQREKRVKTSLHQNSFSSFSKDHH 291          
BLAST of pou4l-1 vs. Ensembl Mouse
Match: Pou4f3 (POU domain, class 4, transcription factor 3 [Source:MGI Symbol;Acc:MGI:102523])

HSP 1 Score: 240.35 bits (612), Expect = 4.502e-76
Identity = 125/160 (78.12%), Postives = 140/160 (87.50%), Query Frame = 2
Query:  854 LNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVN 1333
            +  DPRELE F+ERFKQRRIKLGVTQADVG AL NLK+ GVGSLSQSTICRFESLTLSHNNM+ALKP+LQAWLEEAE    E+   P+++N S +RKRKRTSI   EKRSLEAYFA+QPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKRMK+S V+
Sbjct:   98 VESDPRELEAFAERFKQRRIKLGVTQADVGAALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNSKPELFNGS-ERKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH 256          
BLAST of pou4l-1 vs. Ensembl Mouse
Match: Pou4f3 (POU domain, class 4, transcription factor 3 [Source:MGI Symbol;Acc:MGI:102523])

HSP 1 Score: 239.965 bits (611), Expect = 9.342e-75
Identity = 125/160 (78.12%), Postives = 140/160 (87.50%), Query Frame = 2
Query:  854 LNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVN 1333
            +  DPRELE F+ERFKQRRIKLGVTQADVG AL NLK+ GVGSLSQSTICRFESLTLSHNNM+ALKP+LQAWLEEAE    E+   P+++N S +RKRKRTSI   EKRSLEAYFA+QPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKRMK+S V+
Sbjct:  180 VESDPRELEAFAERFKQRRIKLGVTQADVGAALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNSKPELFNGS-ERKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH 338          
BLAST of pou4l-1 vs. Ensembl Mouse
Match: Pou4f1 (POU domain, class 4, transcription factor 1 [Source:MGI Symbol;Acc:MGI:102525])

HSP 1 Score: 235.728 bits (600), Expect = 3.373e-72
Identity = 125/158 (79.11%), Postives = 138/158 (87.34%), Query Frame = 2
Query:  857 NYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTV 1330
            + DPRELE F+ERFKQRRIKLGVTQADVG AL NLK+ GVGSLSQSTICRFESLTLSHNNM+ALKPILQAWLEEAE    E++  P+++N   ++KRKRTSI   EKRSLEAYFAVQPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKRMKFS  
Sbjct:  264 DTDPRELEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEGAQREKMNKPELFNGG-EKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSAT 420          
BLAST of pou4l-1 vs. Ensembl Mouse
Match: Pou4f2 (POU domain, class 4, transcription factor 2 [Source:MGI Symbol;Acc:MGI:102524])

HSP 1 Score: 235.343 bits (599), Expect = 4.710e-72
Identity = 123/158 (77.85%), Postives = 141/158 (89.24%), Query Frame = 2
Query:  854 LNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFST 1327
            ++ DPR+LE F+ERFKQRRIKLGVTQADVG AL NLK+ GVGSLSQSTICRFESLTLSHNNM+ALKPILQAWLEEAE+   E+L  P+++N + ++KRKRTSI   EKRSLEAYFA+QPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKRMK+S 
Sbjct:  253 VDADPRDLEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEKSHREKLTKPELFNGA-EKKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSA 409          
BLAST of pou4l-1 vs. Ensembl Mouse
Match: Pou3f2 (POU domain, class 3, transcription factor 2 [Source:MGI Symbol;Acc:MGI:101895])

HSP 1 Score: 136.346 bits (342), Expect = 9.859e-35
Identity = 83/161 (51.55%), Postives = 106/161 (65.84%), Query Frame = 2
Query:  833 PHPIQDQLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRM 1315
            PH  +D    D  +LE F+++FKQRRIKLG TQADVG ALG L  +     SQ+TICRFE+L LS  NM  LKP+L  WLEEA+  +        I      RK KRTSI  + K +LE++F   P+PS+++I  +AD L L+K VVRVWFCN+RQK+KRM
Sbjct:  260 PHSDEDTPTSD--DLEQFAKQFKQRRIKLGFTQADVGLALGTLYGN---VFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRK-KRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRM 414          
BLAST of pou4l-1 vs. UniProt/SwissProt
Match: sp|Q63955|PO4F3_MOUSE (POU domain, class 4, transcription factor 3 OS=Mus musculus OX=10090 GN=Pou4f3 PE=1 SV=2)

HSP 1 Score: 239.965 bits (611), Expect = 6.535e-74
Identity = 125/160 (78.12%), Postives = 140/160 (87.50%), Query Frame = 2
Query:  854 LNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVN 1333
            +  DPRELE F+ERFKQRRIKLGVTQADVG AL NLK+ GVGSLSQSTICRFESLTLSHNNM+ALKP+LQAWLEEAE    E+   P+++N S +RKRKRTSI   EKRSLEAYFA+QPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKRMK+S V+
Sbjct:  180 VESDPRELEAFAERFKQRRIKLGVTQADVGAALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNSKPELFNGS-ERKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH 338          
BLAST of pou4l-1 vs. UniProt/SwissProt
Match: sp|Q15319|PO4F3_HUMAN (POU domain, class 4, transcription factor 3 OS=Homo sapiens OX=9606 GN=POU4F3 PE=1 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 6.894e-74
Identity = 125/160 (78.12%), Postives = 140/160 (87.50%), Query Frame = 2
Query:  854 LNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVN 1333
            +  DPRELE F+ERFKQRRIKLGVTQADVG AL NLK+ GVGSLSQSTICRFESLTLSHNNM+ALKP+LQAWLEEAE    E+   P+++N S +RKRKRTSI   EKRSLEAYFA+QPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKRMK+S V+
Sbjct:  180 VESDPRELEAFAERFKQRRIKLGVTQADVGAALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNSKPELFNGS-ERKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH 338          
BLAST of pou4l-1 vs. UniProt/SwissProt
Match: sp|D3ZTL1|PO4F3_RAT (POU domain, class 4, transcription factor 3 OS=Rattus norvegicus OX=10116 GN=Pou4f3 PE=2 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 7.273e-74
Identity = 125/160 (78.12%), Postives = 140/160 (87.50%), Query Frame = 2
Query:  854 LNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVN 1333
            +  DPRELE F+ERFKQRRIKLGVTQADVG AL NLK+ GVGSLSQSTICRFESLTLSHNNM+ALKP+LQAWLEEAE    E+   P+++N S +RKRKRTSI   EKRSLEAYFA+QPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKRMK+S V+
Sbjct:  180 VESDPRELEAFAERFKQRRIKLGVTQADVGAALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNSKPELFNGS-ERKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH 338          
BLAST of pou4l-1 vs. UniProt/SwissProt
Match: sp|Q90435|PO4F3_DANRE (POU domain, class 4, transcription factor 3 OS=Danio rerio OX=7955 GN=pou4f3 PE=2 SV=2)

HSP 1 Score: 237.654 bits (605), Expect = 3.301e-73
Identity = 125/160 (78.12%), Postives = 140/160 (87.50%), Query Frame = 2
Query:  854 LNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVN 1333
            +  DPRELE F+ERFKQRRIKLGVTQADVG AL NLK+ GVGSLSQSTICRFESLTLSHNNM+ALKP+LQAWLEEAE    E+   PD++N + +RKRKRTSI   EKRSLEAYFA+QPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKRMK+S V+
Sbjct:  173 VESDPRELEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNGKPDLFNGN-ERKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH 331          
BLAST of pou4l-1 vs. UniProt/SwissProt
Match: sp|Q91998|BRN3_CHICK (Brain-specific homeobox/POU domain protein 3 OS=Gallus gallus OX=9031 GN=BRN3 PE=2 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 5.571e-73
Identity = 127/160 (79.38%), Postives = 137/160 (85.62%), Query Frame = 2
Query:  851 QLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTV 1330
            +   DPRELE F+ERFKQRRIKLGVTQADVG AL NLK+ GVG LSQSTICRFESLTLSHNNMVALKPIL+AWLEEAER   E++  P+IY    D+KRKRTSI   EKRSLEAYFAVQPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKRMKFS  
Sbjct:  182 ETETDPRELESFAERFKQRRIKLGVTQADVGSALANLKIPGVGCLSQSTICRFESLTLSHNNMVALKPILEAWLEEAERAQREKMTKPEIYTGG-DKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSAT 340          
BLAST of pou4l-1 vs. TrEMBL
Match: A0A0A1CRK9 (POU domain protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=pou4l-1 PE=2 SV=1)

HSP 1 Score: 660.603 bits (1703), Expect = 0.000e+0
Identity = 391/391 (100.00%), Postives = 391/391 (100.00%), Query Frame = 2
Query:  179 MEDFYDTKYLESSVALSSDIGNENLSYHSNHNNLYRNSWRCGAGSGHFFGSLENNILAARNDQFVNDITKSSAFHSSFLRHPDSLNPAAPSLYGFDHLAMXXXXXXXXXXXXXXXXXXGQLSSPPSNIYSNIGLTXXXXXIGYPMDAKLFAGISQNTHMYNSMPGNSILSRYPNMAAMASFTHSTANYCLXXXXXXXXXXXXXXXXXXXXXXXXXFTLPHPIQDQLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVNLDHHSG 1351
            MEDFYDTKYLESSVALSSDIGNENLSYHSNHNNLYRNSWRCGAGSGHFFGSLENNILAARNDQFVNDITKSSAFHSSFLRHPDSLNPAAPSLYGFDHLAMSNSQAPVSSTSSSQFFSNGQLSSPPSNIYSNIGLTSSSSSIGYPMDAKLFAGISQNTHMYNSMPGNSILSRYPNMAAMASFTHSTANYCLPNQNNVSPPSQVSSAASSHSVSPQQFTLPHPIQDQLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPILQAWLEEAERQAAERLKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVNLDHHSG
Sbjct:    1 MEDFYDTKYLESSVALSSDIGNENLSYHSNHNNLYRNSWRCGAGSGHFFGSLENNILAARNDQFVNDITKSSAFHSSFLRHPDSLNPAAPSLYGFDHLAMSNSQAPVSSTSSSQFFSNGQLSSPPSNIYSNIGLTSSSSSIGYPMDAKLFAGISQNTHMYNSMPGNSILSRYPNMAAMASFTHSTANYCLPNQNNVSPPSQVSSAASSHSVSPQQFTLPHPIQDQLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPILQAWLEEAERQAAERLKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVNLDHHSG 391          
BLAST of pou4l-1 vs. TrEMBL
Match: Q94553 (Transcription factor (Fragment) OS=Girardia tigrina OX=6162 GN=GtPOU-4 PE=3 SV=2)

HSP 1 Score: 369.007 bits (946), Expect = 1.365e-122
Identity = 255/290 (87.93%), Postives = 263/290 (90.69%), Query Frame = 2
Query:  416 RHPDSLNPAAPSLYGFDHLAMXXXXXXXXXXXXXXXXXXGQLSSPPSNIYSNIGLTX------XXXXIGYPMDAKLFAGISQNTHMYNSMPGNSILSRYPNMAAMASFTHSTANYCLXXXXXXXXXXXXXXXXXXXXXXXXXFTLPHPIQDQLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKN 1267
            RHPDSLNPAAPSLYGFDHL M+NSQAPVSSTSSSQFFSNGQLSSPPSNIYSNIGL +      +  ++ Y  + +  A I        SMPGNSILSRYPNMAAMAS  H+TANYCLPNQNNVSPPSQVSSAASSHSVSPQQFTLPHPIQDQLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPILQAWLEEAERQAAERLKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKN
Sbjct:    1 RHPDSLNPAAPSLYGFDHLTMTNSQAPVSSTSSSQFFSNGQLSSPPSNIYSNIGLQAHLHQLDTRWTLNYSREFRKIASIC-----IISMPGNSILSRYPNMAAMASLQHTTANYCLPNQNNVSPPSQVSSAASSHSVSPQQFTLPHPIQDQLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPILQAWLEEAERQAAERLKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKN 285          
BLAST of pou4l-1 vs. TrEMBL
Match: A0A267ER71 (POU domain protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000992g3 PE=3 SV=1)

HSP 1 Score: 271.166 bits (692), Expect = 1.974e-82
Identity = 142/168 (84.52%), Postives = 153/168 (91.07%), Query Frame = 2
Query:  833 PHPIQDQLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVNL 1336
            P P   +L+YDPRELE F+ERFKQRRIKLGVTQADVGKALGNLKL GVGSLSQSTICRFESLTLSHNNM+ALKP+LQAWLEEAE  A ERLKNPD Y D LD+KRKRTSITDAEKRSLEAYF VQPRPSSEKI+QIA+KLNLKKNVVRVWFCNQRQKQKRMKF++  +
Sbjct:  248 PQPPVGELDYDPRELEAFAERFKQRRIKLGVTQADVGKALGNLKLPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEHVAMERLKNPDFYGDGLDKKRKRTSITDAEKRSLEAYFHVQPRPSSEKISQIAEKLNLKKNVVRVWFCNQRQKQKRMKFASPGM 415          
BLAST of pou4l-1 vs. TrEMBL
Match: A0A094ZFM2 (POU domain protein OS=Schistosoma haematobium OX=6185 GN=MS3_11446 PE=3 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 6.136e-81
Identity = 139/172 (80.81%), Postives = 159/172 (92.44%), Query Frame = 2
Query:  836 HPIQDQLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVNLDHHSG 1351
            HP++  L+Y+PRELE FSE FKQRRIKLGVTQADVGKALGNLK+SGVGSLSQSTICRFESLTLSHNNMVALKP+LQAWLEEAE +A+ RL +P+IY+   +R+RKRTSITD+EKRSLEA+F++QPRPSSEKIAQIA+KLNLKKNVVRVWFCNQRQKQKRMKFST+ + HHS 
Sbjct:   99 HPVE--LDYNPRELEAFSELFKQRRIKLGVTQADVGKALGNLKISGVGSLSQSTICRFESLTLSHNNMVALKPVLQAWLEEAEAEASSRLNHPNIYDLDEERRRKRTSITDSEKRSLEAFFSIQPRPSSEKIAQIAEKLNLKKNVVRVWFCNQRQKQKRMKFSTLGMLHHSA 268          
BLAST of pou4l-1 vs. TrEMBL
Match: A0A3P8GTS8 (POU domain protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS3607 PE=3 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 2.574e-80
Identity = 134/167 (80.24%), Postives = 156/167 (93.41%), Query Frame = 2
Query:  851 QLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVNLDHHSG 1351
            +++Y+PRELE FSE FKQRRIKLGVTQADVGKALGNLK++GVGSLSQSTICRFESLTLSHNNMVALKP+LQAWLEEAE  AAER ++P+IY+   +++RKRTSITD+EKRSLEA+F+VQPRPSSEKI+QIA+KLNL+KNVVRVWFCNQRQKQKRMKFST+ L HH+ 
Sbjct:   26 EVDYNPRELEAFSELFKQRRIKLGVTQADVGKALGNLKIAGVGSLSQSTICRFESLTLSHNNMVALKPVLQAWLEEAEADAAERSRHPEIYDPEEEKRRKRTSITDSEKRSLEAFFSVQPRPSSEKISQIAEKLNLRKNVVRVWFCNQRQKQKRMKFSTLGLLHHAA 192          
BLAST of pou4l-1 vs. Ensembl Cavefish
Match: zgc:158291 (brain-specific homeobox/POU domain protein 3-like [Source:NCBI gene;Acc:103033167])

HSP 1 Score: 238.81 bits (608), Expect = 2.775e-74
Identity = 127/157 (80.89%), Postives = 139/157 (88.54%), Query Frame = 2
Query:  863 DPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVN 1333
            DPRELE F+ERFKQRRIKLGVTQADVG AL NLK+ GVG LSQSTICRFESLTLSHNNMVALKPIL+AWLEEAER   E++  P+I+N + D+KRKRTSI   EKRSLEAYFAVQPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKRMKFS  +
Sbjct:  199 DPRELESFAERFKQRRIKLGVTQADVGAALANLKIPGVGCLSQSTICRFESLTLSHNNMVALKPILEAWLEEAERAQREKMTKPEIFNGA-DKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATH 354          
BLAST of pou4l-1 vs. Ensembl Cavefish
Match: pou4f1 (POU class 4 homeobox 1 [Source:NCBI gene;Acc:103044015])

HSP 1 Score: 237.654 bits (605), Expect = 1.591e-73
Identity = 125/159 (78.62%), Postives = 139/159 (87.42%), Query Frame = 2
Query:  857 NYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVN 1333
            + DPRELE F+ERFKQRRIKLGVTQADVG AL NLK+ GVGSLSQSTICRFESLTLSHNNM+ALKPILQAWLEEAE    E++  P+I+N   ++KRKRTSI   EKRSLEAYFAVQPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKR+KFS  +
Sbjct:  223 DTDPRELEAFAERFKQRRIKLGVTQADVGGALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEGAQREKMSKPEIFNGG-EKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRLKFSAAH 380          
BLAST of pou4l-1 vs. Ensembl Cavefish
Match: pou4f2 (POU class 4 homeobox 2 [Source:NCBI gene;Acc:103047395])

HSP 1 Score: 234.187 bits (596), Expect = 1.149e-71
Identity = 122/159 (76.73%), Postives = 140/159 (88.05%), Query Frame = 2
Query:  854 LNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTV 1330
            ++ DPR+LE F+ERFKQRRIKLGVTQADVG AL NLK+ GVGSLSQSTICRFESLTLSHNNM+ALKPIL AWLEEAE+   E+L  P+++N + ++KRKRTSI   EKRSLEAYFA+QPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKRMK+S  
Sbjct:  265 VDADPRDLEAFAERFKQRRIKLGVTQADVGAALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILHAWLEEAEKSHREKLSKPELFNGA-EKKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAC 422          
BLAST of pou4l-1 vs. Ensembl Cavefish
Match: pou4f3 (POU class 4 homeobox 3 [Source:NCBI gene;Acc:103036569])

HSP 1 Score: 216.853 bits (551), Expect = 5.246e-66
Identity = 115/163 (70.55%), Postives = 131/163 (80.37%), Query Frame = 2
Query:  854 LNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIY---NDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVN 1333
            +  DPRELE F+ERFKQRR+KLGVTQADVG AL +L + GVG+LSQSTICRFESLTLSHNNM+AL+P+LQAWL+EAE +    L    +        +RKRKRTSI   EKRSLEAYFA+QPRPSSEKIA IA+KL LKKNVVRVWFCNQRQKQKRMK+S   
Sbjct:  171 VESDPRELEAFAERFKQRRVKLGVTQADVGAALASLNMPGVGALSQSTICRFESLTLSHNNMIALRPVLQAWLDEAEAERRRALGANGVAPMGGLGAERKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLELKKNVVRVWFCNQRQKQKRMKYSATQ 333          
BLAST of pou4l-1 vs. Ensembl Cavefish
Match: POU3F4 (POU class 3 homeobox 4 [Source:NCBI gene;Acc:103039910])

HSP 1 Score: 132.88 bits (333), Expect = 2.166e-34
Identity = 80/149 (53.69%), Postives = 101/149 (67.79%), Query Frame = 2
Query:  872 ELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSL-SQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRM 1315
            ELE F+++FKQRRIKLG TQADVG ALG L     G++ SQ+TICRFE+L LS  NM  LKP+L  WLEEA+           I      RK KRTSI  + K  LE +F   P+P++++I+ +AD L L+K VVRVWFCN+RQK+KRM
Sbjct:  185 ELEQFAKQFKQRRIKLGFTQADVGLALGTL----YGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPSSIDKIAAQGRKRK-KRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRM 328          
BLAST of pou4l-1 vs. Ensembl Sea Lamprey
Match: pou4f2 (POU class 4 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-040401-1])

HSP 1 Score: 243.047 bits (619), Expect = 1.653e-76
Identity = 127/157 (80.89%), Postives = 139/157 (88.54%), Query Frame = 2
Query:  863 DPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVN 1333
            DPRELE F+ERFKQRRIKLGVTQADVG ALGNLK+ GVGSLSQSTICRFESLTLSHNNM+ALKPILQAWLEEAE+    +   PD++N   ++KRKRTSI   EKRSLEAYFAVQPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKRMKFS V+
Sbjct:  207 DPRELEAFAERFKQRRIKLGVTQADVGSALGNLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEKAHRNKQTKPDLFNGG-EKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSAVH 362          
BLAST of pou4l-1 vs. Ensembl Sea Lamprey
Match: pou2f1b (POU class 2 homeobox 1b [Source:ZFIN;Acc:ZDB-GENE-030131-2422])

HSP 1 Score: 120.939 bits (302), Expect = 1.080e-30
Identity = 73/159 (45.91%), Postives = 101/159 (63.52%), Query Frame = 2
Query:  863 DPR---ELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXX-----XXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRM 1315
            DPR   ELE+F++ FKQRRIKLG TQ DVG A+G  KL G    SQ+TI RFE+L LS  NM  LKP+L+          A+     +  +P        R++KRTSI    + +LE  F    +P+SE+++ IA++L+++K VVRVWFCN+RQK+KR+
Sbjct:  208 DPRDLEELEVFAKMFKQRRIKLGFTQGDVGLAMG--KLYG-NDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDTEHIPADSSPGNQNASPSGLEGLGRRRKKRTSIDTHVRVALEKSFLENCKPTSEELSMIAEQLHMEKEVVRVWFCNRRQKEKRI 363          
BLAST of pou4l-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002675.1 (pep scaffold:Pmarinus_7.0:GL479714:4410:5816:-1 gene:ENSPMAG00000002443.1 transcript:ENSPMAT00000002675.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.1965 bits (217), Expect = 9.890e-21
Identity = 61/164 (37.20%), Postives = 93/164 (56.71%), Query Frame = 2
Query:  863 DPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVG-SLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPD--IYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVNLDHH 1345
            D  E+  F++ FK RR+ LG+TQ  VG+AL     +  G + SQS ICRFE L L+  +   ++PIL+ W+ EAE +           I ++   R+++RTS T      L A+F V   P+S ++ QIA++L   + VVR+WFCN+RQ    +K +   + HH
Sbjct:    4 DLEEIREFAKVFKLRRLALGLTQTQVGQALS----AAEGPAYSQSAICRFEKLDLTPKSAQKMRPILERWMGEAEARHRMGTHTLTDFIGSEPSKRRKRRTSFTQEALVILNAHFDVGMHPTSAEMTQIAEQLGYDREVVRIWFCNKRQA---LKNTIKQIKHH 160          
BLAST of pou4l-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009070.1 (pep scaffold:Pmarinus_7.0:GL476573:36580:49436:1 gene:ENSPMAG00000008205.1 transcript:ENSPMAT00000009070.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.8113 bits (216), Expect = 1.632e-19
Identity = 58/153 (37.91%), Postives = 87/153 (56.86%), Query Frame = 2
Query:  857 NYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKN-PDIYNDSLDRKRKR-TSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQK 1309
            N    E+  F+  FK RR+ +G+TQ  VG+A+ + +     + SQS ICRFE L ++  +   +KP+L+ W+ EAE +    L++  D       RKR+R TS T     +L AYF     PS +++  IA+ L  ++ VVRVWFCN+RQ  K
Sbjct:  148 NMKLEEIREFARAFKIRRLSMGLTQTQVGQAMSSTE---APAYSQSAICRFEKLDITPKSAQKIKPVLERWMAEAEARQRTGLQSLSDFVGSEPSRKRRRRTSFTPQALEALNAYFERNTHPSGQEMTAIAEHLCYEREVVRVWFCNKRQMLK 297          
BLAST of pou4l-1 vs. Ensembl Sea Lamprey
Match: pou6f2 (POU class 6 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-091118-71])

HSP 1 Score: 83.9593 bits (206), Expect = 2.823e-18
Identity = 61/156 (39.10%), Postives = 89/156 (57.05%), Query Frame = 2
Query:  848 DQLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKN-PDIYNDSLDRKRKR-TSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQK 1309
            D +N +  E+  F+  FK RR+ LG+TQ  VG+AL   +     + SQS ICRFE L ++  +   +KP+L+ W+EEAE +    L++  D       +KRKR TS T      L A+F     PS +++  IA++L   + VVRVWFCN+RQ  K
Sbjct:  139 DGVNLE--EMREFARAFKIRRLSLGLTQTQVGQALSAAEGP---AYSQSAICRFEKLDITPKSAQKIKPVLERWMEEAEARKQAGLQSLSDFVGGEPSKKRKRRTSFTPQALELLNAHFERNTHPSGQEMTAIAERLCYDREVVRVWFCNKRQALK 289          
BLAST of pou4l-1 vs. Ensembl Yeast
Match: YOX1 (Homeobox transcriptional repressor; binds to Mcm1p and to early cell cycle boxes (ECBs) in the promoters of cell cycle-regulated genes expressed in M/G1 phase; expression is cell cycle-regulated; phosphorylated by Cdc28p; relocalizes from nucleus to cytoplasm upon DNA replication stress; YOX1 has a paralog, YHP1, that arose from the whole genome duplication [Source:SGD;Acc:S000004489])

HSP 1 Score: 49.2914 bits (116), Expect = 7.348e-7
Identity = 28/74 (37.84%), Postives = 41/74 (55.41%), Query Frame = 2
Query: 1106 KNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFST 1327
            K P I N  L R RKR   +  E   L+A F   P PS EK  ++A+  ++ +  V++WF N+RQ  KR + +T
Sbjct:  166 KEPKIDNAPLAR-RKRRRTSSQELSILQAEFEKCPAPSKEKRIELAESCHMTEKAVQIWFQNKRQAVKRQRIAT 238          
BLAST of pou4l-1 vs. Ensembl Nematostella
Match: EDO47033 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNB5])

HSP 1 Score: 215.698 bits (548), Expect = 1.885e-68
Identity = 117/155 (75.48%), Postives = 132/155 (85.16%), Query Frame = 2
Query:  863 DPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFST 1327
            +PRELE F+ERFKQRRIKLGVTQADVG AL +LK+ GVGSLSQSTICRFESLTLSHNNM+ALKP+L AWLEEAE+    +  N     +S D+KRKRTSI  AEKRSLEAYFA+ PRPSS+KIA IA+KL+L KNVVRVWFCNQRQK+KRMKFS 
Sbjct:    2 NPRELEWFAERFKQRRIKLGVTQADVGSALAHLKIPGVGSLSQSTICRFESLTLSHNNMMALKPVLTAWLEEAEKAYKTKQCNSAFLPNS-DKKRKRTSIGAAEKRSLEAYFAMNPRPSSDKIASIAEKLDLSKNVVRVWFCNQRQKKKRMKFSV 155          
BLAST of pou4l-1 vs. Ensembl Nematostella
Match: EDO33532 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRV9])

HSP 1 Score: 129.028 bits (323), Expect = 4.246e-35
Identity = 83/165 (50.30%), Postives = 110/165 (66.67%), Query Frame = 2
Query:  830 LPHPIQDQLNYDPR--ELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSL-SQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRM 1315
            L H I D  +  P   +LE F+++FKQRRIKLG TQADVG ALG L     G++ SQ+TICRFE+L LS  NM  LKP+LQ WLEEA+          D    +  +++KRTSI  A K +LE +F   P+P++++I+ +A+ L L K VVRVWFCN+RQK+KRM
Sbjct:   25 LQHDILDADDDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTL----YGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADNNNGATG-GVDKLATTGRKRKKRTSIEVAVKGALENHFCKSPKPTAQEISALAENLGLDKEVVRVWFCNRRQKEKRM 184          
BLAST of pou4l-1 vs. Ensembl Nematostella
Match: EDO43881 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXQ0])

HSP 1 Score: 119.398 bits (298), Expect = 8.010e-32
Identity = 74/160 (46.25%), Postives = 104/160 (65.00%), Query Frame = 2
Query:  866 PRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGS-LSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXX----XXXKNPD-----IYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRM 1315
            P EL  F+++F+QRR+ LG TQADVG ALG L     G+ LSQ+TICRFE+L LS  NM  LKP+LQ WL+E +  ++    E+ +NP       +N    ++++RT I    K  LE +F   PRPS+  I+ +A+ L L + VVRVWFCN+RQK++R+
Sbjct:    6 PDELSTFAKQFRQRRVALGFTQADVGVALGTL----YGNVLSQTTICRFEALQLSLKNMCKLKPLLQKWLQETDASSSGHEGEKQQNPSNFAFATHNGPYKKRKRRTIIEKNVKGVLENHFEKMPRPSTSDISSLAESLGLDREVVRVWFCNRRQKERRV 161          
BLAST of pou4l-1 vs. Ensembl Nematostella
Match: EDO38767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC36])

HSP 1 Score: 118.627 bits (296), Expect = 1.628e-31
Identity = 80/166 (48.19%), Postives = 106/166 (63.86%), Query Frame = 2
Query:  863 DP---RELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVNLDHHSG 1351
            DP   RELE F+ +FK RRIKLG TQ +VG AL  +  +     SQ+TICRFE+L LS  N   LKPIL  WLEEAER      +          R+++RT+I  A K +LE +F  Q +PSS +I +IAD L L K VVRVWFCN+RQ++KR+K +++N+ +  G
Sbjct:    2 DPSKLRELEEFATQFKLRRIKLGFTQTNVGAALAAVHGT---DFSQTTICRFENLQLSFKNACKLKPILARWLEEAERSGGACGEKFGAER----RRKRRTTIGLAAKEALENHFMKQTKPSSPEIVRIADGLRLDKEVVRVWFCNRRQREKRVK-TSLNIHNFMG 159          
BLAST of pou4l-1 vs. Ensembl Nematostella
Match: EDO30968 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ94])

HSP 1 Score: 108.227 bits (269), Expect = 5.082e-28
Identity = 69/149 (46.31%), Postives = 96/149 (64.43%), Query Frame = 2
Query:  899 KQRRIKLGVTQADVGKALGNLKLSGVGS-LSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXX----XXXKNPD-----IYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRM 1315
            +QRR+ LG TQADVG ALG L     G+ LSQ+TICRFE+L LS  NM  LKP+LQ WL+E +  ++    E+ +NP       +N    ++++RT I    K  LE +F   PRPS+  I+ +A+ L L + VVRVWFCN+RQK++R+
Sbjct:    1 RQRRVALGFTQADVGVALGTL----YGNVLSQTTICRFEALQLSLKNMCKLKPLLQKWLQETDASSSGHEGEKQQNPSNFAFATHNGPYKKRKRRTIIEKNVKGVLENHFEKMPRPSTSDISSLAESLGLDREVVRVWFCNRRQKERRV 145          
BLAST of pou4l-1 vs. Ensembl Medaka
Match: pou4f3 (POU class 4 homeobox 3 [Source:NCBI gene;Acc:101171765])

HSP 1 Score: 239.195 bits (609), Expect = 2.144e-74
Identity = 125/162 (77.16%), Postives = 141/162 (87.04%), Query Frame = 2
Query:  848 DQLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVN 1333
            + +  DPRELE F+ERFKQRRIKLGVTQADVG AL NLK+ GVGSLSQSTICRFESLTLSHNNM+ALKP+LQAWLEEAE    E+   PD++N + +RKRKRTSI   EKRSLEAYFA+QPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKRMK+S V+
Sbjct:  200 NDVESDPRELEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKSNKPDLFNGN-ERKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH 360          
BLAST of pou4l-1 vs. Ensembl Medaka
Match: pou4f1 (POU class 4 homeobox 1 [Source:NCBI gene;Acc:101156638])

HSP 1 Score: 239.195 bits (609), Expect = 3.026e-74
Identity = 126/159 (79.25%), Postives = 139/159 (87.42%), Query Frame = 2
Query:  857 NYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVN 1333
            + DPRELE F+ERFKQRRIKLGVTQADVG AL NLK+ GVGSLSQSTICRFESLTLSHNNM+ALKPILQAWLEEAE    E++  PDI+N   ++KRKRTSI   EKRSLEAYFAVQPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKR+KFS  +
Sbjct:  213 DTDPRELEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEGAQREKMSKPDIFNGG-EKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRLKFSAAH 370          
BLAST of pou4l-1 vs. Ensembl Medaka
Match: zgc:158291 (brain-specific homeobox/POU domain protein 3 [Source:NCBI gene;Acc:101157964])

HSP 1 Score: 237.654 bits (605), Expect = 7.813e-74
Identity = 127/157 (80.89%), Postives = 138/157 (87.90%), Query Frame = 2
Query:  863 DPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVN 1333
            DPRELE F+ERFKQRRIKLGVTQADVG AL NLK+ GVG LSQSTICRFESLTLSHNNMVALKPIL+AWLEEAER   E++  P+I+N   D+KRKRTSI   EKRSLEAYFAVQPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKRMKFS  +
Sbjct:  193 DPRELESFAERFKQRRIKLGVTQADVGAALANLKIPGVGCLSQSTICRFESLTLSHNNMVALKPILEAWLEEAERAQREKMSKPEIFNGG-DKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATH 348          
BLAST of pou4l-1 vs. Ensembl Medaka
Match: pou4f2 (POU class 4 homeobox 2 [Source:NCBI gene;Acc:101156468])

HSP 1 Score: 234.187 bits (596), Expect = 4.202e-72
Identity = 124/166 (74.70%), Postives = 144/166 (86.75%), Query Frame = 2
Query:  833 PHPIQDQLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTV 1330
            PH   + ++ DPR+LE F+ERFKQRRIKLGVTQADVG AL +LK+ GVGSLSQSTICRFESLTLSHNNM+ALKPILQAWLEEAE+   E+L  P+++N + ++KRKRTSI   EKRSLEAYFA+QPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKRMK+S  
Sbjct:  216 PHMGMNDVDADPRDLEAFAERFKQRRIKLGVTQADVGSALASLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEKSHREKLNKPELFNGA-EKKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAC 380          
BLAST of pou4l-1 vs. Ensembl Medaka
Match: pou4f2 (POU class 4 homeobox 2 [Source:NCBI gene;Acc:101156468])

HSP 1 Score: 233.417 bits (594), Expect = 2.835e-71
Identity = 124/166 (74.70%), Postives = 144/166 (86.75%), Query Frame = 2
Query:  833 PHPIQDQLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTV 1330
            PH   + ++ DPR+LE F+ERFKQRRIKLGVTQADVG AL +LK+ GVGSLSQSTICRFESLTLSHNNM+ALKPILQAWLEEAE+   E+L  P+++N + ++KRKRTSI   EKRSLEAYFA+QPRPSSEKIA IA+KL+LKKNVVRVWFCNQRQKQKRMK+S  
Sbjct:  261 PHMGMNDVDADPRDLEAFAERFKQRRIKLGVTQADVGSALASLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEKSHREKLNKPELFNGA-EKKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAC 425          
BLAST of pou4l-1 vs. Planmine SMEST
Match: SMESG000013430.1 (SMESG000013430.1)

HSP 1 Score: 660.603 bits (1703), Expect = 0.000e+0
Identity = 391/391 (100.00%), Postives = 391/391 (100.00%), Query Frame = 2
Query:  179 MEDFYDTKYLESSVALSSDIGNENLSYHSNHNNLYRNSWRCGAGSGHFFGSLENNILAARNDQFVNDITKSSAFHSSFLRHPDSLNPAAPSLYGFDHLAMXXXXXXXXXXXXXXXXXXGQLSSPPSNIYSNIGLTXXXXXIGYPMDAKLFAGISQNTHMYNSMPGNSILSRYPNMAAMASFTHSTANYCLXXXXXXXXXXXXXXXXXXXXXXXXXFTLPHPIQDQLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVNLDHHSG 1351
            MEDFYDTKYLESSVALSSDIGNENLSYHSNHNNLYRNSWRCGAGSGHFFGSLENNILAARNDQFVNDITKSSAFHSSFLRHPDSLNPAAPSLYGFDHLAMSNSQAPVSSTSSSQFFSNGQLSSPPSNIYSNIGLTSSSSSIGYPMDAKLFAGISQNTHMYNSMPGNSILSRYPNMAAMASFTHSTANYCLPNQNNVSPPSQVSSAASSHSVSPQQFTLPHPIQDQLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPILQAWLEEAERQAAERLKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVNLDHHSG
Sbjct:    1 MEDFYDTKYLESSVALSSDIGNENLSYHSNHNNLYRNSWRCGAGSGHFFGSLENNILAARNDQFVNDITKSSAFHSSFLRHPDSLNPAAPSLYGFDHLAMSNSQAPVSSTSSSQFFSNGQLSSPPSNIYSNIGLTSSSSSIGYPMDAKLFAGISQNTHMYNSMPGNSILSRYPNMAAMASFTHSTANYCLPNQNNVSPPSQVSSAASSHSVSPQQFTLPHPIQDQLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPILQAWLEEAERQAAERLKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVNLDHHSG 391          
BLAST of pou4l-1 vs. Planmine SMEST
Match: SMESG000030759.1 (SMESG000030759.1)

HSP 1 Score: 246.128 bits (627), Expect = 3.846e-77
Identity = 131/177 (74.01%), Postives = 150/177 (84.75%), Query Frame = 2
Query:  830 LPHPIQ----DQLNYDPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVNLDHHS 1348
            +  PIQ      + Y+ RELE F+E FKQRRIKL VTQADVG+ALGNLKL+GVGSLSQSTICRFESLTLSHNNM+ALKP+LQ WLE+AE +A ERL   D ++D  +RKRKRTSITD+EKRSLEA+F +QPRPSSEKI QIA+KLNLKKNVVRVWFCNQRQKQKRMKFST+   H+S
Sbjct:  177 MQQPIQVVNQGDIEYETRELEAFAEWFKQRRIKLRVTQADVGRALGNLKLAGVGSLSQSTICRFESLTLSHNNMIALKPVLQTWLEDAETEAKERLNGSDAFSDIDERKRKRTSITDSEKRSLEAFFTIQPRPSSEKIIQIAEKLNLKKNVVRVWFCNQRQKQKRMKFSTLGFQHNS 353          
BLAST of pou4l-1 vs. Planmine SMEST
Match: SMESG000076173.1 (SMESG000076173.1)

HSP 1 Score: 133.65 bits (335), Expect = 5.889e-34
Identity = 78/148 (52.70%), Postives = 102/148 (68.92%), Query Frame = 2
Query:  872 ELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRM 1315
            ELE F++ FKQRRIKLG TQADVG ALGNL  S     SQ+TICRFE+L LS  NM  L+P+L  WL+EA+          D    +  +++KRTSI    K +LE++F+ Q +P+++ I Q+AD L L+K VVRVWFCN+RQK+KRM
Sbjct:  214 ELEQFAKIFKQRRIKLGFTQADVGLALGNLYGS---VFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAP-SGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRM 357          
BLAST of pou4l-1 vs. Planmine SMEST
Match: SMESG000057970.1 (SMESG000057970.1)

HSP 1 Score: 122.865 bits (307), Expect = 8.855e-30
Identity = 78/149 (52.35%), Postives = 101/149 (67.79%), Query Frame = 2
Query:  872 ELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSL-SQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRM 1315
            +LE F++ FKQRRIKLG TQADVG ALG L     G++ SQ+TICRFE+L LS  NM  L+P+LQ WL EA+  +        I   S  RK KRTSI    K  LE+ F    +PS++ I+ +A+KL+L+K VVRVWFCN+RQK+KR+
Sbjct:  272 DLEQFAKMFKQRRIKLGYTQADVGLALGTL----YGNVFSQTTICRFEALQLSFKNMCKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRK-KRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRI 415          
BLAST of pou4l-1 vs. Planmine SMEST
Match: SMESG000008858.1 (SMESG000008858.1)

HSP 1 Score: 119.398 bits (298), Expect = 1.668e-28
Identity = 72/151 (47.68%), Postives = 102/151 (67.55%), Query Frame = 2
Query:  863 DPRELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSL-SQSTICRFESLTLSHNNMVALKPIXXXXXXXXXXXXXXXXKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKR 1312
            D RELE F++ FKQRRIKLG TQADVG ALG L     G++ SQ+TICRFE+L LS  NM  L+P+L  WLEEA+   +  + N +   +   +++KRT+I    K  LE+ F   P+P++  I  +++++ + K VVRVWFCN+RQK+K+
Sbjct:  312 DCRELEQFAKTFKQRRIKLGFTQADVGLALGTL----YGNVFSQTTICRFEALQLSFKNMNKLRPLLSKWLEEADLSLSNTVVNVEKLANQNRQRKKRTNIEMNTKDILESSFNKDPKPTAAHIISLSERILMDKEVVRVWFCNRRQKEKK 458          
The following BLAST results are available for this feature:
BLAST of pou4l-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
POU4F31.436e-7478.13POU class 4 homeobox 3 [Source:HGNC Symbol;Acc:HGN... [more]
POU4F14.229e-7279.11POU class 4 homeobox 1 [Source:HGNC Symbol;Acc:HGN... [more]
POU4F27.224e-7277.85POU class 4 homeobox 2 [Source:HGNC Symbol;Acc:HGN... [more]
POU3F21.393e-3451.55POU class 3 homeobox 2 [Source:HGNC Symbol;Acc:HGN... [more]
POU3F33.739e-3451.85POU class 3 homeobox 3 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of pou4l-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-863.875e-6369.38Transcription factor unc-86 [Source:UniProtKB/Swi... [more]
unc-861.862e-6269.38Transcription factor unc-86 [Source:UniProtKB/Swi... [more]
ceh-69.267e-3249.07Homeobox protein ceh-6 [Source:UniProtKB/Swiss-Pr... [more]
ceh-181.610e-2435.79Homeobox protein ceh-18 [Source:UniProtKB/Swiss-P... [more]
ceh-181.832e-2435.79Homeobox protein ceh-18 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of pou4l-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acj66.894e-7077.16gene:FBgn0000028 transcript:FBtr0305192[more]
acj61.016e-6977.16gene:FBgn0000028 transcript:FBtr0305193[more]
acj61.019e-6977.16gene:FBgn0000028 transcript:FBtr0305191[more]
acj61.659e-6977.16gene:FBgn0000028 transcript:FBtr0305196[more]
acj63.560e-6977.16gene:FBgn0000028 transcript:FBtr0074015[more]
back to top
BLAST of pou4l-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pou4f11.178e-7479.87POU class 4 homeobox 1 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
pou4f34.372e-7478.13POU class 4 homeobox 3 [Source:NCBI gene;Acc:30534... [more]
zgc:1582916.671e-7480.89zgc:158291 [Source:ZFIN;Acc:ZDB-GENE-061215-70][more]
zgc:1582916.671e-7480.89zgc:158291 [Source:ZFIN;Acc:ZDB-GENE-061215-70][more]
pou4f21.442e-7176.73POU class 4 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of pou4l-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf220.11.172e-7472.00ring finger protein 220, gene 1 [Source:Xenbase;Ac... [more]
POU4F14.091e-7380.77POU class 4 homeobox 1 [Source:NCBI gene;Acc:10048... [more]
pou4f1.21.655e-7281.82POU class 4 homeobox 1 [Source:NCBI gene;Acc:10003... [more]
ppp2r2a1.301e-7178.34protein phosphatase 2 regulatory subunit B, alpha ... [more]
POU1F13.937e-3547.54POU class 1 homeobox 1 [Source:NCBI gene;Acc:10049... [more]
back to top
BLAST of pou4l-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pou4f34.502e-7678.13POU domain, class 4, transcription factor 3 [Sourc... [more]
Pou4f39.342e-7578.13POU domain, class 4, transcription factor 3 [Sourc... [more]
Pou4f13.373e-7279.11POU domain, class 4, transcription factor 1 [Sourc... [more]
Pou4f24.710e-7277.85POU domain, class 4, transcription factor 2 [Sourc... [more]
Pou3f29.859e-3551.55POU domain, class 3, transcription factor 2 [Sourc... [more]
back to top
BLAST of pou4l-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q63955|PO4F3_MOUSE6.535e-7478.13POU domain, class 4, transcription factor 3 OS=Mus... [more]
sp|Q15319|PO4F3_HUMAN6.894e-7478.13POU domain, class 4, transcription factor 3 OS=Hom... [more]
sp|D3ZTL1|PO4F3_RAT7.273e-7478.13POU domain, class 4, transcription factor 3 OS=Rat... [more]
sp|Q90435|PO4F3_DANRE3.301e-7378.13POU domain, class 4, transcription factor 3 OS=Dan... [more]
sp|Q91998|BRN3_CHICK5.571e-7379.38Brain-specific homeobox/POU domain protein 3 OS=Ga... [more]
back to top
BLAST of pou4l-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0A1CRK90.000e+0100.00POU domain protein (Fragment) OS=Schmidtea mediter... [more]
Q945531.365e-12287.93Transcription factor (Fragment) OS=Girardia tigrin... [more]
A0A267ER711.974e-8284.52POU domain protein OS=Macrostomum lignano OX=28230... [more]
A0A094ZFM26.136e-8180.81POU domain protein OS=Schistosoma haematobium OX=6... [more]
A0A3P8GTS82.574e-8080.24POU domain protein OS=Echinostoma caproni OX=27848... [more]
back to top
BLAST of pou4l-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1582912.775e-7480.89brain-specific homeobox/POU domain protein 3-like ... [more]
pou4f11.591e-7378.62POU class 4 homeobox 1 [Source:NCBI gene;Acc:10304... [more]
pou4f21.149e-7176.73POU class 4 homeobox 2 [Source:NCBI gene;Acc:10304... [more]
pou4f35.246e-6670.55POU class 4 homeobox 3 [Source:NCBI gene;Acc:10303... [more]
POU3F42.166e-3453.69POU class 3 homeobox 4 [Source:NCBI gene;Acc:10303... [more]
back to top
BLAST of pou4l-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pou4f21.653e-7680.89POU class 4 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
pou2f1b1.080e-3045.91POU class 2 homeobox 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000002675.19.890e-2137.20pep scaffold:Pmarinus_7.0:GL479714:4410:5816:-1 ge... [more]
ENSPMAT00000009070.11.632e-1937.91pep scaffold:Pmarinus_7.0:GL476573:36580:49436:1 g... [more]
pou6f22.823e-1839.10POU class 6 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of pou4l-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YOX17.348e-737.84Homeobox transcriptional repressor; binds to Mcm1p... [more]
back to top
BLAST of pou4l-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO470331.885e-6875.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO335324.246e-3550.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438818.010e-3246.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387671.628e-3148.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO309685.082e-2846.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of pou4l-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pou4f32.144e-7477.16POU class 4 homeobox 3 [Source:NCBI gene;Acc:10117... [more]
pou4f13.026e-7479.25POU class 4 homeobox 1 [Source:NCBI gene;Acc:10115... [more]
zgc:1582917.813e-7480.89brain-specific homeobox/POU domain protein 3 [Sour... [more]
pou4f24.202e-7274.70POU class 4 homeobox 2 [Source:NCBI gene;Acc:10115... [more]
pou4f22.835e-7174.70POU class 4 homeobox 2 [Source:NCBI gene;Acc:10115... [more]
back to top
BLAST of pou4l-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013430.10.000e+0100.00SMESG000013430.1[more]
SMESG000030759.13.846e-7774.01SMESG000030759.1[more]
SMESG000076173.15.889e-3452.70SMESG000076173.1[more]
SMESG000057970.18.855e-3052.35SMESG000057970.1[more]
SMESG000008858.11.668e-2847.68SMESG000008858.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30032426
GenBankAIX99546.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032426 ID=SMED30032426|Name=pou4l-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1462bp
AATATGCTAAATCGTGTTAATTGACCGTAGCCTGACTGTTTAATTATTAA
AGCTATACTTTAGACTTACTTGTCAACTGCGACCTAGTTTGAATATTTTA
GTGCTCTTCAAAATTAACGATTTATTCGAAAGGGGAAAAAAATCAATTCC
TCACAATAAAAAATATTTGCCGCAATTAATGGAAGATTTTTACGATACCA
AGTATCTGGAATCCTCGGTGGCTTTGTCGTCGGATATCGGAAATGAGAAT
CTCTCTTATCATTCTAATCATAACAATCTCTACAGAAACAGCTGGAGATG
TGGAGCGGGATCTGGACATTTTTTCGGATCTTTAGAAAACAATATTCTTG
CAGCAAGAAACGACCAATTCGTGAATGATATTACGAAATCTTCTGCTTTT
CATTCGAGTTTCCTACGACATCCGGATTCCTTAAATCCAGCCGCACCATC
GTTGTATGGGTTTGATCATCTAGCAATGTCGAATAGTCAAGCTCCAGTTA
GCTCAACTTCATCATCTCAGTTTTTCTCAAACGGTCAGTTATCATCTCCT
CCATCAAATATTTATTCAAATATTGGCCTAACGAGTTCATCCTCCTCAAT
CGGATATCCGATGGATGCTAAATTATTTGCCGGAATTTCACAAAACACAC
ACATGTATAATTCAATGCCTGGAAATAGCATTTTAAGTCGCTATCCTAAC
ATGGCGGCAATGGCCTCATTTACACACTCCACTGCCAACTATTGCTTGCC
GAATCAGAACAATGTCAGCCCCCCAAGTCAAGTTAGCAGTGCCGCTAGCA
GTCATTCGGTGAGCCCTCAACAATTTACCTTGCCACATCCAATACAAGAT
CAACTCAATTATGATCCGAGAGAATTAGAAATCTTTTCCGAGAGGTTTAA
ACAGCGTCGAATTAAACTCGGAGTCACACAAGCTGATGTTGGTAAAGCGT
TAGGAAATCTCAAACTCAGCGGAGTCGGTTCATTGAGCCAAAGTACAATT
TGTCGGTTTGAATCATTGACTCTTAGTCACAACAATATGGTGGCTCTAAA
ACCAATTTTACAAGCATGGCTCGAAGAAGCTGAAAGACAGGCGGCTGAAA
GACTGAAAAATCCAGACATCTACAACGACAGTCTTGACAGGAAACGTAAA
CGAACCTCTATCACAGACGCAGAGAAACGATCTCTCGAAGCTTATTTTGC
CGTCCAACCTCGACCATCAAGTGAGAAAATAGCCCAAATCGCCGACAAAT
TAAACCTGAAAAAGAACGTCGTTCGAGTTTGGTTTTGCAATCAAAGACAG
AAACAGAAACGGATGAAATTTTCCACAGTAAATCTCGATCATCATTCTGG
ATAAATATTTCTCGCTTGATCAGCGATTTATTTGAACAAAAAAAAATTAT
TTTCGACATTATCCGTCCGTTTTGATGAATCTATTGCCCTAATCGAAATT
CTCCACCATGAT
back to top

protein sequence of SMED30032426-orf-1

>SMED30032426-orf-1 ID=SMED30032426-orf-1|Name=SMED30032426-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=392bp
MEDFYDTKYLESSVALSSDIGNENLSYHSNHNNLYRNSWRCGAGSGHFFG
SLENNILAARNDQFVNDITKSSAFHSSFLRHPDSLNPAAPSLYGFDHLAM
SNSQAPVSSTSSSQFFSNGQLSSPPSNIYSNIGLTSSSSSIGYPMDAKLF
AGISQNTHMYNSMPGNSILSRYPNMAAMASFTHSTANYCLPNQNNVSPPS
QVSSAASSHSVSPQQFTLPHPIQDQLNYDPRELEIFSERFKQRRIKLGVT
QADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPILQAWLEE
AERQAAERLKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEK
IAQIADKLNLKKNVVRVWFCNQRQKQKRMKFSTVNLDHHSG*
back to top
Aliases
The feature 'pou4l-1' has the following synonyms
Synonym
pou4*
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000025nervous system
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR015584POU4-TF1
IPR001387Cro/C1-type_HTH
IPR013847POU
IPR001356Homeobox_dom
IPR000327POU_dom
IPR009057Homeobox-like_sf
IPR010982Lambda_DNA-bd_dom_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013847POU domainPRINTSPR00028POUDOMAINcoord: 320..340
score: 45.09
coord: 244..261
score: 74.13
coord: 355..370
score: 72.01
coord: 270..283
score: 78.72
coord: 286..301
score: 64.45
IPR000327POU-specific domainSMARTSM00352poucoord: 225..302
e-value: 2.4E-47
score: 173.3
IPR000327POU-specific domainPFAMPF00157Poucoord: 231..302
e-value: 1.5E-29
score: 101.8
IPR000327POU-specific domainPROSITEPS00035POU_1coord: 243..255
IPR000327POU-specific domainPROSITEPS00465POU_2coord: 270..283
IPR000327POU-specific domainPROSITEPS51179POU_3coord: 225..302
score: 46.835
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 321..383
e-value: 1.2E-19
score: 81.3
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 322..378
e-value: 1.3E-18
score: 66.6
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 319..379
score: 17.443
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 322..380
e-value: 8.82358E-18
score: 74.5872
IPR010982Lambda repressor-like, DNA-binding domain superfamilyGENE3DG3DSA:1.10.260.40coord: 228..311
e-value: 1.3E-31
score: 110.2
IPR010982Lambda repressor-like, DNA-binding domain superfamilySUPERFAMILYSSF47413lambda repressor-like DNA-binding domainscoord: 227..302
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 324..371
e-value: 1.4E-20
score: 74.9
NoneNo IPR availablePANTHERPTHR11636POU DOMAINcoord: 153..383
IPR015584POU domain, class 4, transcription factor 1PANTHERPTHR11636:SF42POU DOMAIN, CLASS 4, TRANSCRIPTION FACTOR 1coord: 153..383
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 354..377
IPR001387Cro/C1-type helix-turn-helix domainCDDcd00093HTH_XREcoord: 237..279
e-value: 3.80003E-4
score: 36.377
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 315..380