NUAK family kinase 1

Overview
NameNUAK family kinase 1
Smed IDSMED30032412
Length (bp)1540
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NUAK family kinase 1 (SMED30032412) t-SNE clustered cells

Violin plots show distribution of expression levels for NUAK family kinase 1 (SMED30032412) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NUAK family kinase 1 (SMED30032412) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NUAK family kinase 1 (SMED30032412) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032412

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30032412SMESG000054249.1 SmedASXL_062311SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30032412SMESG000054249.1 dd_Smed_v6_45526_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NUAK family kinase 1 vs. Ensembl Human
Match: PHKG2 (phosphorylase kinase catalytic subunit gamma 2 [Source:HGNC Symbol;Acc:HGNC:8931])

HSP 1 Score: 69.707 bits (169), Expect = 5.498e-17
Identity = 48/177 (27.12%), Postives = 84/177 (47.46%), Query Frame = 2
Query:  665 KFCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNK---EISAYLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            +F +KY   +       S +  C  +   ++   K+ ++   +   E    ++     E  IL   +  P I+ + + + +   + +V +    G+L  Y  E   LSE + ++IM  LL+A+ FLH N I+H D+K ENILLDD   ++L DF  S  +   +K   + GT  Y +
Sbjct:   19 EFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEVTAERLSPEQLEEVREATRRETHILRQVAGHPHIITLIDSYESSSFMFLVFDLMRKGELFDYLTEKVALSEKETRSIMRSLLEAVSFLHANNIVHRDLKPENILLDDNMQIRLSDFGFSCHLEPGEKLRELCGTPGYLA 195          

HSP 2 Score: 32.7278 bits (73), Expect = 5.498e-17
Identity = 11/24 (45.83%), Postives = 21/24 (87.50%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKHNFF 1468
            +S++L+ +P+ R+TA++AL+H FF
Sbjct:  268 ISRLLQVDPEARLTAEQALQHPFF 291          

HSP 3 Score: 25.409 bits (54), Expect = 5.498e-17
Identity = 9/22 (40.91%), Postives = 15/22 (68.18%), Query Frame = 1
Query: 1228 KPSDIWSAGIIMPILVIGNLPF 1293
            K  D+W+ G+I+  L+ G+ PF
Sbjct:  212 KEVDLWACGVILFTLLAGSPPF 233          
BLAST of NUAK family kinase 1 vs. Ensembl Human
Match: PHKG2 (phosphorylase kinase catalytic subunit gamma 2 [Source:HGNC Symbol;Acc:HGNC:8931])

HSP 1 Score: 69.3218 bits (168), Expect = 6.917e-17
Identity = 48/177 (27.12%), Postives = 84/177 (47.46%), Query Frame = 2
Query:  665 KFCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNK---EISAYLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            +F +KY   +       S +  C  +   ++   K+ ++   +   E    ++     E  IL   +  P I+ + + + +   + +V +    G+L  Y  E   LSE + ++IM  LL+A+ FLH N I+H D+K ENILLDD   ++L DF  S  +   +K   + GT  Y +
Sbjct:   19 EFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEVTAERLSPEQLEEVREATRRETHILRQVAGHPHIITLIDSYESSSFMFLVFDLMRKGELFDYLTEKVALSEKETRSIMRSLLEAVSFLHANNIVHRDLKPENILLDDNMQIRLSDFGFSCHLEPGEKLRELCGTPGYLA 195          

HSP 2 Score: 32.7278 bits (73), Expect = 6.917e-17
Identity = 11/24 (45.83%), Postives = 21/24 (87.50%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKHNFF 1468
            +S++L+ +P+ R+TA++AL+H FF
Sbjct:  268 ISRLLQVDPEARLTAEQALQHPFF 291          

HSP 3 Score: 25.409 bits (54), Expect = 6.917e-17
Identity = 9/22 (40.91%), Postives = 15/22 (68.18%), Query Frame = 1
Query: 1228 KPSDIWSAGIIMPILVIGNLPF 1293
            K  D+W+ G+I+  L+ G+ PF
Sbjct:  212 KEVDLWACGVILFTLLAGSPPF 233          
BLAST of NUAK family kinase 1 vs. Ensembl Human
Match: NUAK2 (NUAK family kinase 2 [Source:HGNC Symbol;Acc:HGNC:29558])

HSP 1 Score: 77.411 bits (189), Expect = 1.065e-16
Identity = 39/88 (44.32%), Postives = 54/88 (61.36%), Query Frame = 2
Query:  863 PFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEIS 1126
            P I+ I E F N   I+IVMEY S GDL  Y  E   LSE + +    Q++ A+ + H+N ++H D+KLENILLD    +K+ DF +S
Sbjct:  110 PHIIAIHEVFENSSKIVIVMEYASRGDLYDYISERQQLSEREARHFFRQIVSAVHYCHQNRVVHRDLKLENILLDANGNIKIADFGLS 197          

HSP 2 Score: 29.6462 bits (65), Expect = 1.065e-16
Identity = 11/20 (55.00%), Postives = 15/20 (75.00%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPFD 1296
            D WS G+++ ILV G +PFD
Sbjct:  232 DSWSLGVLLYILVHGTMPFD 251          
BLAST of NUAK family kinase 1 vs. Ensembl Human
Match: NUAK2 (NUAK family kinase 2 [Source:HGNC Symbol;Acc:HGNC:29558])

HSP 1 Score: 77.411 bits (189), Expect = 1.126e-16
Identity = 39/88 (44.32%), Postives = 54/88 (61.36%), Query Frame = 2
Query:  863 PFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEIS 1126
            P I+ I E F N   I+IVMEY S GDL  Y  E   LSE + +    Q++ A+ + H+N ++H D+KLENILLD    +K+ DF +S
Sbjct:  154 PHIIAIHEVFENSSKIVIVMEYASRGDLYDYISERQQLSEREARHFFRQIVSAVHYCHQNRVVHRDLKLENILLDANGNIKIADFGLS 241          

HSP 2 Score: 29.261 bits (64), Expect = 1.126e-16
Identity = 11/20 (55.00%), Postives = 15/20 (75.00%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPFD 1296
            D WS G+++ ILV G +PFD
Sbjct:  276 DSWSLGVLLYILVHGTMPFD 295          
BLAST of NUAK family kinase 1 vs. Ensembl Human
Match: NUAK1 (NUAK family kinase 1 [Source:HGNC Symbol;Acc:HGNC:14311])

HSP 1 Score: 78.9518 bits (193), Expect = 1.263e-16
Identity = 48/129 (37.21%), Postives = 78/129 (60.47%), Query Frame = 2
Query:  740 KILKNKSVAKVYDLINNKEISAYLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEIS 1126
            +++  KS+ K  D I +++   +++R    EI I++  +  P I+ I E F N+  I+I+MEY S G+L  Y  E   LSE + +    Q++ A+ + HKN ++H D+KLENILLDD   +K+ DF +S
Sbjct:   79 RVVAIKSIRK--DKIKDEQDMVHIRR----EIEIMSSLN-HPHIISIYEVFENKDKIVIIMEYASKGELYDYISERRRLSERETRHFFRQIVSAVHYCHKNGVVHRDLKLENILLDDNCNIKIADFGLS 200          

HSP 2 Score: 28.1054 bits (61), Expect = 1.263e-16
Identity = 9/20 (45.00%), Postives = 14/20 (70.00%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPFD 1296
            D W+ G+++  LV G +PFD
Sbjct:  235 DSWALGVLLYTLVYGTMPFD 254          
BLAST of NUAK family kinase 1 vs. Ensembl Celegans
Match: unc-82 (pep chromosome:WBcel235:IV:7431348:7444648:1 gene:WBGene00006814.1 transcript:B0496.3i.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-82)

HSP 1 Score: 75.0998 bits (183), Expect = 2.017e-16
Identity = 42/108 (38.89%), Postives = 61/108 (56.48%), Query Frame = 2
Query:  863 PFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            P I+ I E F N+  II+VMEY S G+L  Y    G+L E + + I  Q+  A+ + HK+ + H D+KLENILLD     K+ DF +S+   D +      G+ +Y S
Sbjct:  133 PNIIQIYEVFENKDKIILVMEYSSGGELYDYVSRCGSLPEAEARRIFRQITSAVLYCHKHRVAHRDLKLENILLDQNNNAKIADFGLSNYFADKNLLTTFCGSPLYAS 240          

HSP 2 Score: 29.6462 bits (65), Expect = 2.017e-16
Identity = 11/20 (55.00%), Postives = 15/20 (75.00%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPFD 1296
            D WS GI++  LV G++PFD
Sbjct:  255 DCWSLGILLYTLVYGSMPFD 274          
BLAST of NUAK family kinase 1 vs. Ensembl Celegans
Match: unc-82 (pep chromosome:WBcel235:IV:7425729:7444660:1 gene:WBGene00006814.1 transcript:B0496.3g.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-82)

HSP 1 Score: 75.0998 bits (183), Expect = 2.192e-16
Identity = 42/108 (38.89%), Postives = 61/108 (56.48%), Query Frame = 2
Query:  863 PFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            P I+ I E F N+  II+VMEY S G+L  Y    G+L E + + I  Q+  A+ + HK+ + H D+KLENILLD     K+ DF +S+   D +      G+ +Y S
Sbjct:  116 PNIIQIYEVFENKDKIILVMEYSSGGELYDYVSRCGSLPEAEARRIFRQITSAVLYCHKHRVAHRDLKLENILLDQNNNAKIADFGLSNYFADKNLLTTFCGSPLYAS 223          

HSP 2 Score: 29.6462 bits (65), Expect = 2.192e-16
Identity = 11/20 (55.00%), Postives = 15/20 (75.00%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPFD 1296
            D WS GI++  LV G++PFD
Sbjct:  238 DCWSLGILLYTLVYGSMPFD 257          
BLAST of NUAK family kinase 1 vs. Ensembl Celegans
Match: unc-82 (pep chromosome:WBcel235:IV:7428926:7444648:1 gene:WBGene00006814.1 transcript:B0496.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-82)

HSP 1 Score: 75.0998 bits (183), Expect = 2.208e-16
Identity = 42/108 (38.89%), Postives = 61/108 (56.48%), Query Frame = 2
Query:  863 PFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            P I+ I E F N+  II+VMEY S G+L  Y    G+L E + + I  Q+  A+ + HK+ + H D+KLENILLD     K+ DF +S+   D +      G+ +Y S
Sbjct:  116 PNIIQIYEVFENKDKIILVMEYSSGGELYDYVSRCGSLPEAEARRIFRQITSAVLYCHKHRVAHRDLKLENILLDQNNNAKIADFGLSNYFADKNLLTTFCGSPLYAS 223          

HSP 2 Score: 29.6462 bits (65), Expect = 2.208e-16
Identity = 11/20 (55.00%), Postives = 15/20 (75.00%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPFD 1296
            D WS GI++  LV G++PFD
Sbjct:  238 DCWSLGILLYTLVYGSMPFD 257          
BLAST of NUAK family kinase 1 vs. Ensembl Celegans
Match: unc-82 (pep chromosome:WBcel235:IV:7428926:7444648:1 gene:WBGene00006814.1 transcript:B0496.3f.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-82)

HSP 1 Score: 75.0998 bits (183), Expect = 2.209e-16
Identity = 42/108 (38.89%), Postives = 61/108 (56.48%), Query Frame = 2
Query:  863 PFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            P I+ I E F N+  II+VMEY S G+L  Y    G+L E + + I  Q+  A+ + HK+ + H D+KLENILLD     K+ DF +S+   D +      G+ +Y S
Sbjct:  116 PNIIQIYEVFENKDKIILVMEYSSGGELYDYVSRCGSLPEAEARRIFRQITSAVLYCHKHRVAHRDLKLENILLDQNNNAKIADFGLSNYFADKNLLTTFCGSPLYAS 223          

HSP 2 Score: 29.6462 bits (65), Expect = 2.209e-16
Identity = 11/20 (55.00%), Postives = 15/20 (75.00%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPFD 1296
            D WS GI++  LV G++PFD
Sbjct:  238 DCWSLGILLYTLVYGSMPFD 257          
BLAST of NUAK family kinase 1 vs. Ensembl Celegans
Match: unc-82 (pep chromosome:WBcel235:IV:7425729:7444660:1 gene:WBGene00006814.1 transcript:B0496.3h.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-82)

HSP 1 Score: 75.0998 bits (183), Expect = 2.247e-16
Identity = 42/108 (38.89%), Postives = 61/108 (56.48%), Query Frame = 2
Query:  863 PFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            P I+ I E F N+  II+VMEY S G+L  Y    G+L E + + I  Q+  A+ + HK+ + H D+KLENILLD     K+ DF +S+   D +      G+ +Y S
Sbjct:  116 PNIIQIYEVFENKDKIILVMEYSSGGELYDYVSRCGSLPEAEARRIFRQITSAVLYCHKHRVAHRDLKLENILLDQNNNAKIADFGLSNYFADKNLLTTFCGSPLYAS 223          

HSP 2 Score: 29.6462 bits (65), Expect = 2.247e-16
Identity = 11/20 (55.00%), Postives = 15/20 (75.00%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPFD 1296
            D WS GI++  LV G++PFD
Sbjct:  238 DCWSLGILLYTLVYGSMPFD 257          
BLAST of NUAK family kinase 1 vs. Ensembl Fly
Match: PhKgamma (gene:FBgn0011754 transcript:FBtr0301501)

HSP 1 Score: 82.0333 bits (201), Expect = 8.297e-20
Identity = 53/177 (29.94%), Postives = 85/177 (48.02%), Query Frame = 2
Query:  668 FCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNKEISA----YLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            F  KY   E       ST+  C +K    +  AK+ DL    E       ++      EI IL      P+I+D+ + F +   + +V E C  G+L  Y      LSE K +TIM Q+ + + ++H   I+H D+K ENILLD+   +K+ DF  + ++ + +K   + GT  Y +
Sbjct:   19 FYAKYEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHRDLKPENILLDENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLA 195          

HSP 2 Score: 27.335 bits (59), Expect = 8.297e-20
Identity = 10/19 (52.63%), Postives = 14/19 (73.68%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPF 1293
            DIW+ G+IM  L++G  PF
Sbjct:  215 DIWACGVIMFTLLVGCPPF 233          

HSP 3 Score: 26.9498 bits (58), Expect = 8.297e-20
Identity = 11/22 (50.00%), Postives = 15/22 (68.18%), Query Frame = 2
Query: 1403 KMLKFNPKKRITAKKALKHNFF 1468
            K L  +P +RIT K+ L+H FF
Sbjct:  270 KCLVVDPSQRITVKEVLRHPFF 291          
BLAST of NUAK family kinase 1 vs. Ensembl Fly
Match: PhKgamma (gene:FBgn0011754 transcript:FBtr0301500)

HSP 1 Score: 82.0333 bits (201), Expect = 8.297e-20
Identity = 53/177 (29.94%), Postives = 85/177 (48.02%), Query Frame = 2
Query:  668 FCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNKEISA----YLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            F  KY   E       ST+  C +K    +  AK+ DL    E       ++      EI IL      P+I+D+ + F +   + +V E C  G+L  Y      LSE K +TIM Q+ + + ++H   I+H D+K ENILLD+   +K+ DF  + ++ + +K   + GT  Y +
Sbjct:   19 FYAKYEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHRDLKPENILLDENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLA 195          

HSP 2 Score: 27.335 bits (59), Expect = 8.297e-20
Identity = 10/19 (52.63%), Postives = 14/19 (73.68%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPF 1293
            DIW+ G+IM  L++G  PF
Sbjct:  215 DIWACGVIMFTLLVGCPPF 233          

HSP 3 Score: 26.9498 bits (58), Expect = 8.297e-20
Identity = 11/22 (50.00%), Postives = 15/22 (68.18%), Query Frame = 2
Query: 1403 KMLKFNPKKRITAKKALKHNFF 1468
            K L  +P +RIT K+ L+H FF
Sbjct:  270 KCLVVDPSQRITVKEVLRHPFF 291          
BLAST of NUAK family kinase 1 vs. Ensembl Fly
Match: PhKgamma (gene:FBgn0011754 transcript:FBtr0090002)

HSP 1 Score: 81.6481 bits (200), Expect = 1.342e-19
Identity = 53/177 (29.94%), Postives = 85/177 (48.02%), Query Frame = 2
Query:  668 FCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNKEISA----YLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            F  KY   E       ST+  C +K    +  AK+ DL    E       ++      EI IL      P+I+D+ + F +   + +V E C  G+L  Y      LSE K +TIM Q+ + + ++H   I+H D+K ENILLD+   +K+ DF  + ++ + +K   + GT  Y +
Sbjct:   19 FYAKYEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHRDLKPENILLDENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLA 195          

HSP 2 Score: 27.335 bits (59), Expect = 1.342e-19
Identity = 10/19 (52.63%), Postives = 14/19 (73.68%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPF 1293
            DIW+ G+IM  L++G  PF
Sbjct:  215 DIWACGVIMFTLLVGCPPF 233          

HSP 3 Score: 26.9498 bits (58), Expect = 1.342e-19
Identity = 11/24 (45.83%), Postives = 16/24 (66.67%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKHNFF 1468
            + K L  +P +RIT K+ L+H FF
Sbjct:  268 IRKCLVVDPSQRITVKEVLRHPFF 291          
BLAST of NUAK family kinase 1 vs. Ensembl Fly
Match: PhKgamma (gene:FBgn0011754 transcript:FBtr0343648)

HSP 1 Score: 81.6481 bits (200), Expect = 1.342e-19
Identity = 53/177 (29.94%), Postives = 85/177 (48.02%), Query Frame = 2
Query:  668 FCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNKEISA----YLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            F  KY   E       ST+  C +K    +  AK+ DL    E       ++      EI IL      P+I+D+ + F +   + +V E C  G+L  Y      LSE K +TIM Q+ + + ++H   I+H D+K ENILLD+   +K+ DF  + ++ + +K   + GT  Y +
Sbjct:   19 FYAKYEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHRDLKPENILLDENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLA 195          

HSP 2 Score: 27.335 bits (59), Expect = 1.342e-19
Identity = 10/19 (52.63%), Postives = 14/19 (73.68%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPF 1293
            DIW+ G+IM  L++G  PF
Sbjct:  215 DIWACGVIMFTLLVGCPPF 233          

HSP 3 Score: 26.9498 bits (58), Expect = 1.342e-19
Identity = 11/24 (45.83%), Postives = 16/24 (66.67%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKHNFF 1468
            + K L  +P +RIT K+ L+H FF
Sbjct:  268 IRKCLVVDPSQRITVKEVLRHPFF 291          
BLAST of NUAK family kinase 1 vs. Ensembl Fly
Match: PhKgamma (gene:FBgn0011754 transcript:FBtr0343587)

HSP 1 Score: 81.6481 bits (200), Expect = 1.378e-19
Identity = 53/177 (29.94%), Postives = 85/177 (48.02%), Query Frame = 2
Query:  668 FCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNKEISA----YLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            F  KY   E       ST+  C +K    +  AK+ DL    E       ++      EI IL      P+I+D+ + F +   + +V E C  G+L  Y      LSE K +TIM Q+ + + ++H   I+H D+K ENILLD+   +K+ DF  + ++ + +K   + GT  Y +
Sbjct:   19 FYAKYEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHRDLKPENILLDENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLA 195          

HSP 2 Score: 27.335 bits (59), Expect = 1.378e-19
Identity = 10/19 (52.63%), Postives = 14/19 (73.68%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPF 1293
            DIW+ G+IM  L++G  PF
Sbjct:  215 DIWACGVIMFTLLVGCPPF 233          

HSP 3 Score: 26.9498 bits (58), Expect = 1.378e-19
Identity = 11/24 (45.83%), Postives = 16/24 (66.67%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKHNFF 1468
            + K L  +P +RIT K+ L+H FF
Sbjct:  268 IRKCLVVDPSQRITVKEVLRHPFF 291          
BLAST of NUAK family kinase 1 vs. Ensembl Zebrafish
Match: phkg1a (phosphorylase kinase, gamma 1a (muscle) [Source:ZFIN;Acc:ZDB-GENE-061103-385])

HSP 1 Score: 69.707 bits (169), Expect = 3.505e-18
Identity = 59/179 (32.96%), Postives = 82/179 (45.81%), Query Frame = 2
Query:  668 FCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDL-----INNKEISAYLKRNAE-TEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            F +KY   E       S +  C  K    +   KV D+     +N +EI     RNA   EI IL        I+ + + F  +    +V +    G+L  Y  E   LSE + + IM  LL+ + FLH   I+H D+K ENILLDD   +KL DF  + +I    K N V GT  Y +
Sbjct:   16 FYQKYDPKEILGRGVSSVVRRCIHKRTTQEYAVKVIDITPSDKMNTEEIEEI--RNATIKEIDILKKVCGQENIIQLKDCFETKAFFFLVFDLMKKGELFDYLTEKVTLSEKETRKIMRSLLEVVQFLHSQNIVHRDLKPENILLDDNMNIKLTDFGFAVQIAPGQKLNEVCGTPGYLA 192          

HSP 2 Score: 33.113 bits (74), Expect = 3.505e-18
Identity = 15/24 (62.50%), Postives = 17/24 (70.83%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKHNFF 1468
            +SKML  NP+KR TA  AL H FF
Sbjct:  265 ISKMLVVNPEKRFTATDALNHPFF 288          

HSP 3 Score: 28.4906 bits (62), Expect = 3.505e-18
Identity = 11/19 (57.89%), Postives = 15/19 (78.95%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPF 1293
            D+WSAG+IM  L+ G+ PF
Sbjct:  212 DLWSAGVIMFTLLAGSPPF 230          
BLAST of NUAK family kinase 1 vs. Ensembl Zebrafish
Match: phkg1a (phosphorylase kinase, gamma 1a (muscle) [Source:ZFIN;Acc:ZDB-GENE-061103-385])

HSP 1 Score: 69.707 bits (169), Expect = 3.505e-18
Identity = 59/179 (32.96%), Postives = 82/179 (45.81%), Query Frame = 2
Query:  668 FCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDL-----INNKEISAYLKRNAE-TEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            F +KY   E       S +  C  K    +   KV D+     +N +EI     RNA   EI IL        I+ + + F  +    +V +    G+L  Y  E   LSE + + IM  LL+ + FLH   I+H D+K ENILLDD   +KL DF  + +I    K N V GT  Y +
Sbjct:   16 FYQKYDPKEILGRGVSSVVRRCIHKRTTQEYAVKVIDITPSDKMNTEEIEEI--RNATIKEIDILKKVCGQENIIQLKDCFETKAFFFLVFDLMKKGELFDYLTEKVTLSEKETRKIMRSLLEVVQFLHSQNIVHRDLKPENILLDDNMNIKLTDFGFAVQIAPGQKLNEVCGTPGYLA 192          

HSP 2 Score: 33.113 bits (74), Expect = 3.505e-18
Identity = 15/24 (62.50%), Postives = 17/24 (70.83%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKHNFF 1468
            +SKML  NP+KR TA  AL H FF
Sbjct:  265 ISKMLVVNPEKRFTATDALNHPFF 288          

HSP 3 Score: 28.4906 bits (62), Expect = 3.505e-18
Identity = 11/19 (57.89%), Postives = 15/19 (78.95%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPF 1293
            D+WSAG+IM  L+ G+ PF
Sbjct:  212 DLWSAGVIMFTLLAGSPPF 230          
BLAST of NUAK family kinase 1 vs. Ensembl Zebrafish
Match: phkg1a (phosphorylase kinase, gamma 1a (muscle) [Source:ZFIN;Acc:ZDB-GENE-061103-385])

HSP 1 Score: 69.707 bits (169), Expect = 3.505e-18
Identity = 59/179 (32.96%), Postives = 82/179 (45.81%), Query Frame = 2
Query:  668 FCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDL-----INNKEISAYLKRNAE-TEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            F +KY   E       S +  C  K    +   KV D+     +N +EI     RNA   EI IL        I+ + + F  +    +V +    G+L  Y  E   LSE + + IM  LL+ + FLH   I+H D+K ENILLDD   +KL DF  + +I    K N V GT  Y +
Sbjct:   16 FYQKYDPKEILGRGVSSVVRRCIHKRTTQEYAVKVIDITPSDKMNTEEIEEI--RNATIKEIDILKKVCGQENIIQLKDCFETKAFFFLVFDLMKKGELFDYLTEKVTLSEKETRKIMRSLLEVVQFLHSQNIVHRDLKPENILLDDNMNIKLTDFGFAVQIAPGQKLNEVCGTPGYLA 192          

HSP 2 Score: 33.113 bits (74), Expect = 3.505e-18
Identity = 15/24 (62.50%), Postives = 17/24 (70.83%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKHNFF 1468
            +SKML  NP+KR TA  AL H FF
Sbjct:  265 ISKMLVVNPEKRFTATDALNHPFF 288          

HSP 3 Score: 28.4906 bits (62), Expect = 3.505e-18
Identity = 11/19 (57.89%), Postives = 15/19 (78.95%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPF 1293
            D+WSAG+IM  L+ G+ PF
Sbjct:  212 DLWSAGVIMFTLLAGSPPF 230          
BLAST of NUAK family kinase 1 vs. Ensembl Zebrafish
Match: phkg2 (phosphorylase kinase, gamma 2 (testis) [Source:ZFIN;Acc:ZDB-GENE-040426-825])

HSP 1 Score: 72.4034 bits (176), Expect = 4.562e-17
Identity = 54/177 (30.51%), Postives = 86/177 (48.59%), Query Frame = 2
Query:  665 KFCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNKEISAYL---KRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            +F +KY   E       S +  C  K    +   K+ ++   K     L   K +   EI +LNL    P I+ + + + +   I +V +    G+L  Y  E   LSE + +++M  LL+A+ +LH   I+H D+K ENILLDD  +LKL DF  S ++   +K   + GT  Y +
Sbjct:   19 EFYQKYDPKEVIGRGVSSVVRRCVHKHTGQEFAVKIIEITAEKMTEQQLEEVKSSTLKEIHVLNLVKGHPSIITLIDSYESTAFIFLVFDLMRRGELFDYLTEKVTLSEKETRSMMRALLEAVQYLHALNIVHRDLKPENILLDDQGHLKLSDFGFSVQLGPDEKLRELCGTPGYLA 195          

HSP 2 Score: 28.1054 bits (61), Expect = 4.562e-17
Identity = 11/24 (45.83%), Postives = 17/24 (70.83%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKHNFF 1468
            +S++L   P  R+TA++AL H FF
Sbjct:  268 ISRLLVVEPTLRLTAEQALAHPFF 291          

HSP 3 Score: 26.5646 bits (57), Expect = 4.562e-17
Identity = 10/28 (35.71%), Postives = 16/28 (57.14%), Query Frame = 1
Query: 1210 NKENIDKPSDIWSAGIIMPILVIGNLPF 1293
              E   K  D+W+ G+I+  L+ G+ PF
Sbjct:  206 THEGYGKEVDLWACGVILFTLLAGSPPF 233          
BLAST of NUAK family kinase 1 vs. Ensembl Zebrafish
Match: sik1 (salt-inducible kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9446])

HSP 1 Score: 66.2402 bits (160), Expect = 1.886e-16
Identity = 44/146 (30.14%), Postives = 75/146 (51.37%), Query Frame = 2
Query:  680 YHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNKEISAYLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDF 1117
            Y II +      + + L   K+ K +   K+ D    +  SA L++    E+ I+ L +  P I+ + +    +  + IV EY  NG++  Y    G +SE + +   WQ+L A+ + H++ I+H D+K EN+LLD    +KL DF
Sbjct:   26 YEIIRTLGKGNFAVVKLARHKVTKTQVAIKIID--KTRLNSANLEK-IYREVQIMKLLN-HPHIIKLYQVMETKDMLYIVTEYAKNGEMFDYLTSNGRMSENEARKKFWQILTAVDYCHRHHIVHRDLKTENLLLDANMNIKLADF 167          

HSP 2 Score: 35.4242 bits (80), Expect = 1.886e-16
Identity = 16/38 (42.11%), Postives = 24/38 (63.16%), Query Frame = 1
Query: 1186 PEMALKVLNKENIDKPS-DIWSAGIIMPILVIGNLPFD 1296
            P  A +V   +  + P  DIWS G+++ +LV G+LPFD
Sbjct:  187 PYAAPEVFEGKEYEGPQLDIWSLGVVLYVLVCGSLPFD 224          

HSP 3 Score: 23.483 bits (49), Expect = 1.886e-16
Identity = 16/52 (30.77%), Postives = 24/52 (46.15%), Query Frame = 2
Query: 1337 DLVSFYKQLCIAFFHIIFFPMS--------KMLKFNPKKRITAKKALKHNFF 1468
             L +  +++    F I FF MS        KML  +P KRIT  +  +H + 
Sbjct:  227 SLPALRQRVTEGRFRIPFF-MSQDCENLIRKMLVVDPAKRITIAQIKQHRWM 277          
BLAST of NUAK family kinase 1 vs. Ensembl Xenopus
Match: itga11 (integrin subunit alpha 11 [Source:Xenbase;Acc:XB-GENE-483822])

HSP 1 Score: 80.4925 bits (197), Expect = 1.142e-17
Identity = 51/124 (41.13%), Postives = 75/124 (60.48%), Query Frame = 2
Query:  755 KSVAKVYDLINNKEISAYLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEIS 1126
            KS+ K  D I +++   +++R  ETEI + +LC   P I+ I E F N   I+IVMEY S GDL  Y  E   LS+ + +    Q++ A+ + H N I+H D+KLENILLD+   +K+ DF +S
Sbjct:   81 KSIRK--DRIKDEQDMLHIRR--ETEI-MSSLCH--PHIISIYEVFENSSKIVIVMEYASQGDLYDYISERQRLSDHEARRFFRQIVSAVQYCHANGIVHRDLKLENILLDENKNVKIADFGLS 197          

HSP 2 Score: 29.6462 bits (65), Expect = 1.142e-17
Identity = 11/25 (44.00%), Postives = 18/25 (72.00%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPFDEENTR 1311
            D WS G+++ ILV G +PFD ++ +
Sbjct:  232 DSWSLGVLLYILVHGCMPFDGQDYK 256          
BLAST of NUAK family kinase 1 vs. Ensembl Xenopus
Match: phkg1 (phosphorylase kinase, gamma 1 (muscle) [Source:NCBI gene;Acc:448255])

HSP 1 Score: 71.2478 bits (173), Expect = 1.392e-17
Identity = 55/181 (30.39%), Postives = 85/181 (46.96%), Query Frame = 2
Query:  653 QFPLKFCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINN---KEISAYLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            Q   +F EKY   E       S +  C  K  +     K+ D+  +    E  A L+ +   EI IL   S +P ++ + + + +     +V +    G+L  Y  E   LSE + + IM  LL+ +  LH   I+H D+K ENILLDD   +KL DF  S +I + +K   + GT  Y +
Sbjct:   11 QTSQEFYEKYEPKEILGRGVSSVVRRCIFKPSREDFAVKIIDITGDHLSSEQIAELRDSTVKEIDILKKVSGFPNVIQLKDSYESHTFFFLVFDLMRRGELFDYLTEKVTLSEKETRKIMRSLLEVVSKLHAYNIVHRDLKPENILLDDDMNIKLTDFGFSCQIQEGEKLKEICGTPGYLA 191          

HSP 2 Score: 29.6462 bits (65), Expect = 1.392e-17
Identity = 11/24 (45.83%), Postives = 19/24 (79.17%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKHNFF 1468
            ++++L  NP++R+TA +AL H FF
Sbjct:  264 IARLLVVNPERRLTADEALIHPFF 287          

HSP 3 Score: 28.8758 bits (63), Expect = 1.392e-17
Identity = 12/28 (42.86%), Postives = 16/28 (57.14%), Query Frame = 1
Query: 1210 NKENIDKPSDIWSAGIIMPILVIGNLPF 1293
            N     K  D+WS G+IM  L+ G+ PF
Sbjct:  202 NHSGYGKQVDMWSCGVIMYTLLAGSPPF 229          
BLAST of NUAK family kinase 1 vs. Ensembl Xenopus
Match: phkg1 (phosphorylase kinase, gamma 1 (muscle) [Source:NCBI gene;Acc:448255])

HSP 1 Score: 70.8626 bits (172), Expect = 1.554e-17
Identity = 55/181 (30.39%), Postives = 85/181 (46.96%), Query Frame = 2
Query:  653 QFPLKFCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINN---KEISAYLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            Q   +F EKY   E       S +  C  K  +     K+ D+  +    E  A L+ +   EI IL   S +P ++ + + + +     +V +    G+L  Y  E   LSE + + IM  LL+ +  LH   I+H D+K ENILLDD   +KL DF  S +I + +K   + GT  Y +
Sbjct:   11 QTSQEFYEKYEPKEILGRGVSSVVRRCIFKPSREDFAVKIIDITGDHLSSEQIAELRDSTVKEIDILKKVSGFPNVIQLKDSYESHTFFFLVFDLMRRGELFDYLTEKVTLSEKETRKIMRSLLEVVSKLHAYNIVHRDLKPENILLDDDMNIKLTDFGFSCQIQEGEKLKEICGTPGYLA 191          

HSP 2 Score: 30.0314 bits (66), Expect = 1.554e-17
Identity = 11/24 (45.83%), Postives = 19/24 (79.17%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKHNFF 1468
            ++++L  NP++R+TA +AL H FF
Sbjct:  264 IARLLVVNPERRLTADEALIHPFF 287          

HSP 3 Score: 28.8758 bits (63), Expect = 1.554e-17
Identity = 12/28 (42.86%), Postives = 16/28 (57.14%), Query Frame = 1
Query: 1210 NKENIDKPSDIWSAGIIMPILVIGNLPF 1293
            N     K  D+WS G+IM  L+ G+ PF
Sbjct:  202 NHSGYGKQVDMWSCGVIMYTLLAGSPPF 229          
BLAST of NUAK family kinase 1 vs. Ensembl Xenopus
Match: phkg1 (phosphorylase kinase, gamma 1 (muscle) [Source:NCBI gene;Acc:448255])

HSP 1 Score: 70.0922 bits (170), Expect = 2.945e-17
Identity = 53/168 (31.55%), Postives = 82/168 (48.81%), Query Frame = 2
Query:  698 FYFSR--KSTIYLCEDKILKNKSVAKVYDLINN---KEISAYLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            FYF R   S +  C  K  +     K+ D+  +    E  A L+ +   EI IL   S +P ++ + + + +     +V +    G+L  Y  E   LSE + + IM  LL+ +  LH   I+H D+K ENILLDD   +KL DF  S +I + +K   + GT  Y +
Sbjct:   34 FYFFRGVSSVVRRCIFKPSREDFAVKIIDITGDHLSSEQIAELRDSTVKEIDILKKVSGFPNVIQLKDSYESHTFFFLVFDLMRRGELFDYLTEKVTLSEKETRKIMRSLLEVVSKLHAYNIVHRDLKPENILLDDDMNIKLTDFGFSCQIQEGEKLKEICGTPGYLA 201          

HSP 2 Score: 29.6462 bits (65), Expect = 2.945e-17
Identity = 11/24 (45.83%), Postives = 19/24 (79.17%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKHNFF 1468
            ++++L  NP++R+TA +AL H FF
Sbjct:  274 IARLLVVNPERRLTADEALIHPFF 297          

HSP 3 Score: 28.8758 bits (63), Expect = 2.945e-17
Identity = 12/28 (42.86%), Postives = 16/28 (57.14%), Query Frame = 1
Query: 1210 NKENIDKPSDIWSAGIIMPILVIGNLPF 1293
            N     K  D+WS G+IM  L+ G+ PF
Sbjct:  212 NHSGYGKQVDMWSCGVIMYTLLAGSPPF 239          
BLAST of NUAK family kinase 1 vs. Ensembl Xenopus
Match: phkg1 (phosphorylase kinase, gamma 1 (muscle) [Source:NCBI gene;Acc:448255])

HSP 1 Score: 69.707 bits (169), Expect = 3.095e-17
Identity = 53/173 (30.64%), Postives = 84/173 (48.55%), Query Frame = 2
Query:  683 HIIESFYFSR--KSTIYLCEDKILKNKSVAKVYDLINN---KEISAYLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            ++   FYF R   S +  C  K  +     K+ D+  +    E  A L+ +   EI IL   S +P ++ + + + +     +V +    G+L  Y  E   LSE + + IM  LL+ +  LH   I+H D+K ENILLDD   +KL DF  S +I + +K   + GT  Y +
Sbjct:   17 YVFNVFYFFRGVSSVVRRCIFKPSREDFAVKIIDITGDHLSSEQIAELRDSTVKEIDILKKVSGFPNVIQLKDSYESHTFFFLVFDLMRRGELFDYLTEKVTLSEKETRKIMRSLLEVVSKLHAYNIVHRDLKPENILLDDDMNIKLTDFGFSCQIQEGEKLKEICGTPGYLA 189          

HSP 2 Score: 30.0314 bits (66), Expect = 3.095e-17
Identity = 11/24 (45.83%), Postives = 19/24 (79.17%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKHNFF 1468
            ++++L  NP++R+TA +AL H FF
Sbjct:  262 IARLLVVNPERRLTADEALIHPFF 285          

HSP 3 Score: 28.8758 bits (63), Expect = 3.095e-17
Identity = 12/28 (42.86%), Postives = 16/28 (57.14%), Query Frame = 1
Query: 1210 NKENIDKPSDIWSAGIIMPILVIGNLPF 1293
            N     K  D+WS G+IM  L+ G+ PF
Sbjct:  200 NHSGYGKQVDMWSCGVIMYTLLAGSPPF 227          
BLAST of NUAK family kinase 1 vs. Ensembl Mouse
Match: Phkg2 (phosphorylase kinase, gamma 2 (testis) [Source:MGI Symbol;Acc:MGI:1916211])

HSP 1 Score: 68.1662 bits (165), Expect = 6.355e-17
Identity = 48/177 (27.12%), Postives = 85/177 (48.02%), Query Frame = 2
Query:  665 KFCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNK---EISAYLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            +F +KY   +       S +  C  +   ++   K+ ++   +   E    ++     E+ IL   +  P I+ + + + +   + +V +    G+L  Y  E   LSE + ++IM  LL+A+ FLH N I+H D+K ENILLDD   ++L DF  S  +   +K   + GT  Y +
Sbjct:   19 EFYQKYDPKDIIGRGVSSVVRRCVHRATGDEFAVKIMEVSAERLSLEQLEEVRDATRREMHILRQVAGHPHIITLIDSYESSSFMFLVFDLMRKGELFDYLTEKVALSEKETRSIMRSLLEAVSFLHANNIVHRDLKPENILLDDNMQIRLSDFGFSCHLEAGEKLRELCGTPGYLA 195          

HSP 2 Score: 33.4982 bits (75), Expect = 6.355e-17
Identity = 12/24 (50.00%), Postives = 21/24 (87.50%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKHNFF 1468
            +SK+L+ +P+ R+TA++AL+H FF
Sbjct:  268 ISKLLQVDPEARLTAEQALQHPFF 291          

HSP 3 Score: 25.409 bits (54), Expect = 6.355e-17
Identity = 9/22 (40.91%), Postives = 15/22 (68.18%), Query Frame = 1
Query: 1228 KPSDIWSAGIIMPILVIGNLPF 1293
            K  D+W+ G+I+  L+ G+ PF
Sbjct:  212 KEVDLWACGVILFTLLAGSPPF 233          
BLAST of NUAK family kinase 1 vs. Ensembl Mouse
Match: Phkg2 (phosphorylase kinase, gamma 2 (testis) [Source:MGI Symbol;Acc:MGI:1916211])

HSP 1 Score: 68.1662 bits (165), Expect = 6.355e-17
Identity = 48/177 (27.12%), Postives = 85/177 (48.02%), Query Frame = 2
Query:  665 KFCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNK---EISAYLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            +F +KY   +       S +  C  +   ++   K+ ++   +   E    ++     E+ IL   +  P I+ + + + +   + +V +    G+L  Y  E   LSE + ++IM  LL+A+ FLH N I+H D+K ENILLDD   ++L DF  S  +   +K   + GT  Y +
Sbjct:   19 EFYQKYDPKDIIGRGVSSVVRRCVHRATGDEFAVKIMEVSAERLSLEQLEEVRDATRREMHILRQVAGHPHIITLIDSYESSSFMFLVFDLMRKGELFDYLTEKVALSEKETRSIMRSLLEAVSFLHANNIVHRDLKPENILLDDNMQIRLSDFGFSCHLEAGEKLRELCGTPGYLA 195          

HSP 2 Score: 33.4982 bits (75), Expect = 6.355e-17
Identity = 12/24 (50.00%), Postives = 21/24 (87.50%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKHNFF 1468
            +SK+L+ +P+ R+TA++AL+H FF
Sbjct:  268 ISKLLQVDPEARLTAEQALQHPFF 291          

HSP 3 Score: 25.409 bits (54), Expect = 6.355e-17
Identity = 9/22 (40.91%), Postives = 15/22 (68.18%), Query Frame = 1
Query: 1228 KPSDIWSAGIIMPILVIGNLPF 1293
            K  D+W+ G+I+  L+ G+ PF
Sbjct:  212 KEVDLWACGVILFTLLAGSPPF 233          
BLAST of NUAK family kinase 1 vs. Ensembl Mouse
Match: Nuak2 (NUAK family, SNF1-like kinase, 2 [Source:MGI Symbol;Acc:MGI:1921387])

HSP 1 Score: 76.2554 bits (186), Expect = 9.158e-17
Identity = 40/88 (45.45%), Postives = 53/88 (60.23%), Query Frame = 2
Query:  863 PFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEIS 1126
            P I+ I E F N   I+IVMEY S GDL  Y  E   LSE   +    Q++ A+ + H+N I+H D+KLENILLD    +K+ DF +S
Sbjct:  114 PHIIAIHEVFENSSKIVIVMEYASRGDLYDYISERPRLSERDARHFFRQIVSALHYCHQNGIVHRDLKLENILLDANGNIKIADFGLS 201          

HSP 2 Score: 30.4166 bits (67), Expect = 9.158e-17
Identity = 11/25 (44.00%), Postives = 18/25 (72.00%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPFDEENTR 1311
            D WS G+++ ILV G +PFD ++ +
Sbjct:  236 DSWSLGVLLYILVHGTMPFDGQDHK 260          
BLAST of NUAK family kinase 1 vs. Ensembl Mouse
Match: Nuak1 (NUAK family, SNF1-like kinase, 1 [Source:MGI Symbol;Acc:MGI:1925226])

HSP 1 Score: 78.1814 bits (191), Expect = 2.949e-16
Identity = 39/88 (44.32%), Postives = 56/88 (63.64%), Query Frame = 2
Query:  863 PFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEIS 1126
            P I+ I E F N+  I+I+MEY S G+L  Y  E   LSE + +    Q++ A+ + HKN ++H D+KLENILLDD   +K+ DF +S
Sbjct:  114 PHIISIYEVFENKDKIVIIMEYASKGELYDYISERRRLSERETRHFFRQIVSAVHYCHKNGVVHRDLKLENILLDDNCNIKIADFGLS 201          

HSP 2 Score: 26.9498 bits (58), Expect = 2.949e-16
Identity = 8/20 (40.00%), Postives = 14/20 (70.00%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPFD 1296
            D W+ G+++  L+ G +PFD
Sbjct:  236 DSWALGVLLYTLIYGTMPFD 255          
BLAST of NUAK family kinase 1 vs. Ensembl Mouse
Match: Plk2 (polo like kinase 2 [Source:MGI Symbol;Acc:MGI:1099790])

HSP 1 Score: 66.2402 bits (160), Expect = 2.432e-15
Identity = 47/167 (28.14%), Postives = 84/167 (50.30%), Query Frame = 2
Query:  731 CEDKILKNKSVAKVY---DLINNKEISA-----------YLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFD-KRNLVRGTLIYFS 1186
            C  K+L     AK Y   DL NNK  +A           + +   + EI +  L      ++    YF ++ +I I++EYCS   ++   K    L+E +V+  + Q++  + +LH+ EI+H D+KL N  +++   LK+ DF +++R+   + +R  + GT  Y S
Sbjct:   80 CRGKVLGKGGFAKCYEMTDLTNNKVYAAKIIPHSRVAKPHQREKIDKEIELHRLLH-HKHVVQFYHYFEDKENIYILLEYCSRRSMAHILKARKVLTEPEVRYYLRQIVSGLKYLHEQEILHRDLKLGNFFINEAMELKVGDFGLAARLEPLEHRRRTICGTPNYLS 245          

HSP 2 Score: 35.4242 bits (80), Expect = 2.432e-15
Identity = 15/44 (34.09%), Postives = 27/44 (61.36%), Query Frame = 1
Query: 1201 KVLNKENIDKPSDIWSAGIIMPILVIGNLPFDEENTR--F*CVK 1326
            +VLNK+     SDIW+ G +M  +++G  PF+  N +  + C++
Sbjct:  247 EVLNKQGHGCESDIWALGCVMYTMLLGRPPFETTNLKETYRCIR 290          
BLAST of NUAK family kinase 1 vs. UniProt/SwissProt
Match: sp|Q02723|RKIN1_SECCE (Carbon catabolite-derepressing protein kinase OS=Secale cereale OX=4550 GN=RKIN1 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.837e-19
Identity = 49/145 (33.79%), Postives = 82/145 (56.55%), Query Frame = 2
Query:  716 STIYLCEDKILKNKSVAKVYDLINNKEISA-YLKRNAETEIGILNL--CSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIID 1141
            + + + E K  ++K   KV   +N +++ A  ++  A+ EI IL L    I P I+ + E  +    I +VMEYC NGDL  Y  E   L E + +    Q++ A+ + H+N+++H D+K EN+LLD  + +KL DF +S+ + D
Sbjct:   26 AKVIIAEHKHTRHKVAIKV---LNRRQMRAPEMEEKAKREIKILRLFIDLIHPHIIRVYEVIVTPKDIFVVMEYCQNGDLLDYILEKRRLQEDEARRTFQQIISAVEYCHRNKVVHRDLKPENLLLDSKYNVKLADFGLSNVMHD 167          

HSP 2 Score: 33.113 bits (74), Expect = 3.837e-19
Identity = 11/23 (47.83%), Postives = 18/23 (78.26%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPFDEEN 1305
            D+WS G+I+  L+ G +PFD++N
Sbjct:  197 DVWSCGVILYALLCGAVPFDDDN 219          

HSP 3 Score: 25.7942 bits (55), Expect = 3.837e-19
Identity = 11/24 (45.83%), Postives = 17/24 (70.83%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKHNFF 1468
            +S+ML  +P KRIT  +  KH++F
Sbjct:  246 ISRMLIVDPMKRITIGEIRKHSWF 269          
BLAST of NUAK family kinase 1 vs. UniProt/SwissProt
Match: sp|P00518|PHKG1_RABIT (Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Oryctolagus cuniculus OX=9986 GN=PHKG1 PE=1 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 3.612e-17
Identity = 56/177 (31.64%), Postives = 79/177 (44.63%), Query Frame = 2
Query:  668 FCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNKEISAY----LKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            F E Y   E       S +  C  K    +   K+ D+      SA     L+     E+ IL   S  P I+ + + +       +V +    G+L  Y  E   LSE + + IM  LL+ IC LHK  I+H D+K ENILLDD   +KL DF  S ++   +K   V GT  Y +
Sbjct:   16 FYENYEPKEILGRGVSSVVRRCIHKPTCKEYAVKIIDVTGGGSFSAEEVQELREATLKEVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKKGELFDYLTEKVTLSEKETRKIMRALLEVICALHKLNIVHRDLKPENILLDDDMNIKLTDFGFSCQLDPGEKLREVCGTPSYLA 192          

HSP 2 Score: 29.261 bits (64), Expect = 3.612e-17
Identity = 12/24 (50.00%), Postives = 17/24 (70.83%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKHNFF 1468
            +S+ L   P+KR TA++AL H FF
Sbjct:  265 VSRFLVVQPQKRYTAEEALAHPFF 288          

HSP 3 Score: 28.1054 bits (61), Expect = 3.612e-17
Identity = 11/22 (50.00%), Postives = 15/22 (68.18%), Query Frame = 1
Query: 1228 KPSDIWSAGIIMPILVIGNLPF 1293
            K  D+WS G+IM  L+ G+ PF
Sbjct:  209 KEVDMWSTGVIMYTLLAGSPPF 230          
BLAST of NUAK family kinase 1 vs. UniProt/SwissProt
Match: sp|Q852Q0|OSK3_ORYSJ (Serine/threonine protein kinase OSK3 OS=Oryza sativa subsp. japonica OX=39947 GN=OSK3 PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.059e-16
Identity = 46/155 (29.68%), Postives = 83/155 (53.55%), Query Frame = 2
Query:  680 YHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNKEI-SAYLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIID 1141
            Y++  +        + + E K+  ++   K+   +N +++ +  ++  A+ EI IL L  I P I+ + E       I +VMEYC  G+L  Y  E G L E + + I  Q++  + + H+N ++H D+K EN+LLD  + +KL DF +S+ + D
Sbjct:   17 YNLGRTLGIGSFGKVKIAEHKLTGHRVAIKI---LNRRQMRNMEMEEKAKREIKILRLF-IHPHIIRLYEVIYTPTDIYVVMEYCKFGELFDYIVEKGRLQEDEARRIFQQIISGVEYCHRNMVVHRDLKPENLLLDSKYNVKLADFGLSNVMHD 167          

HSP 2 Score: 36.5798 bits (83), Expect = 1.059e-16
Identity = 13/23 (56.52%), Postives = 18/23 (78.26%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPFDEEN 1305
            D+WS G+I+  L+ G LPFD+EN
Sbjct:  197 DVWSCGVILYALLCGTLPFDDEN 219          
BLAST of NUAK family kinase 1 vs. UniProt/SwissProt
Match: sp|A2XFF4|OSK3_ORYSI (Serine/threonine protein kinase OSK3 OS=Oryza sativa subsp. indica OX=39946 GN=OSK3 PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.059e-16
Identity = 46/155 (29.68%), Postives = 83/155 (53.55%), Query Frame = 2
Query:  680 YHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNKEI-SAYLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIID 1141
            Y++  +        + + E K+  ++   K+   +N +++ +  ++  A+ EI IL L  I P I+ + E       I +VMEYC  G+L  Y  E G L E + + I  Q++  + + H+N ++H D+K EN+LLD  + +KL DF +S+ + D
Sbjct:   17 YNLGRTLGIGSFGKVKIAEHKLTGHRVAIKI---LNRRQMRNMEMEEKAKREIKILRLF-IHPHIIRLYEVIYTPTDIYVVMEYCKFGELFDYIVEKGRLQEDEARRIFQQIISGVEYCHRNMVVHRDLKPENLLLDSKYNVKLADFGLSNVMHD 167          

HSP 2 Score: 36.5798 bits (83), Expect = 1.059e-16
Identity = 13/23 (56.52%), Postives = 18/23 (78.26%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPFDEEN 1305
            D+WS G+I+  L+ G LPFD+EN
Sbjct:  197 DVWSCGVILYALLCGTLPFDDEN 219          
BLAST of NUAK family kinase 1 vs. UniProt/SwissProt
Match: sp|Q852Q1|OSK4_ORYSJ (Serine/threonine protein kinase OSK4 OS=Oryza sativa subsp. japonica OX=39947 GN=OSK4 PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.077e-16
Identity = 46/155 (29.68%), Postives = 83/155 (53.55%), Query Frame = 2
Query:  680 YHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNKEI-SAYLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIID 1141
            Y++  +        + + E K+  ++   K+   +N +++ +  ++  A+ EI IL L  I P I+ + E       I +VMEYC  G+L  Y  E G L E + + I  Q++  + + H+N ++H D+K EN+LLD  + +KL DF +S+ + D
Sbjct:   17 YNLGRTLGIGSFGKVKIAEHKLTGHRVAIKI---LNRRQMRNMEMEEKAKREIKILRLF-IHPHIIRLYEVIYTPTDIYVVMEYCKFGELFDYIVEKGRLQEDEARRIFQQIISGVEYCHRNMVVHRDLKPENLLLDSKYNVKLADFGLSNVMHD 167          

HSP 2 Score: 36.5798 bits (83), Expect = 1.077e-16
Identity = 13/23 (56.52%), Postives = 18/23 (78.26%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPFDEEN 1305
            D+WS G+I+  L+ G LPFD+EN
Sbjct:  197 DVWSCGVILYALLCGTLPFDDEN 219          
BLAST of NUAK family kinase 1 vs. TrEMBL
Match: T1JRD0 (Protein kinase domain-containing protein OS=Tetranychus urticae OX=32264 GN=107369709 PE=3 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 4.450e-22
Identity = 62/175 (35.43%), Postives = 90/175 (51.43%), Query Frame = 2
Query:  668 FCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNKEISAYLKRNAET--EIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            F  KY   E       ST+  C +K    +  AK+ D+  + E    L     T  EI IL L +  P+I+++ + F +   I +V E C NG+L  Y      LSE K KTIM QLL+A+  +H   ++H D+K ENILLDD F +K+ DF  +  I   +K + + GT  Y +
Sbjct:   24 FYAKYDPKEVLGRGVSSTVRRCVEKETGREYAAKIIDVSADLEDPQGLTLRQATLREISILKLVAGHPYIIELHDVFESSTYIFLVFELCKNGELFDYLTNVVALSEKKTKTIMRQLLEAVEHIHNKNVVHRDLKPENILLDDSFNIKITDFGFAKVIAPNEKLDDLCGTPGYLA 198          

HSP 2 Score: 32.3426 bits (72), Expect = 4.450e-22
Identity = 12/21 (57.14%), Postives = 18/21 (85.71%), Query Frame = 2
Query: 1406 MLKFNPKKRITAKKALKHNFF 1468
            +L+ NP+ R+TA +ALKH+FF
Sbjct:  274 LLQINPRLRLTASQALKHDFF 294          

HSP 3 Score: 29.261 bits (64), Expect = 4.450e-22
Identity = 15/39 (38.46%), Postives = 24/39 (61.54%), Query Frame = 1
Query: 1186 PEMALKVLNKENID---KPSDIWSAGIIMPILVIGNLPF 1293
            PE+ L+    EN++   K  D+W+ G+IM  L++G  PF
Sbjct:  199 PEL-LRATMYENVEGYGKEVDLWACGVIMYTLLVGFPPF 236          
BLAST of NUAK family kinase 1 vs. TrEMBL
Match: R7TDR3 (Protein kinase domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_148295 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 3.176e-21
Identity = 64/182 (35.16%), Postives = 96/182 (52.75%), Query Frame = 2
Query:  650 IQFPLKFCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNKEISAYLK--RNA-ETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            + F  +F  KY I E       ST+  C +K  + +   K+ DL   K+    ++  R+A   E+ IL +C+  P I+++ + F +   I +V E C  G+L  Y  E   LSE + + IM QLL AI F+H  +I+H D+K ENILLDD   +KL DF  +S I   D+   + GT  Y +
Sbjct:   49 LDFAKEFYAKYEIKEVLGRGVSSTVRRCIEKDTQTEFAVKIIDLTQEKDNEFQMEEFRSATRKEMNILRMCAQHPHIIELHDTFESSTFIFLVFEICKKGELFDYLTEVVTLSEKRTRQIMRQLLDAIEFIHDKQIVHRDLKPENILLDDNLNVKLSDFGFASVINHEDELQDLCGTPGYLA 230          

HSP 2 Score: 28.1054 bits (61), Expect = 3.176e-21
Identity = 10/22 (45.45%), Postives = 16/22 (72.73%), Query Frame = 1
Query: 1228 KPSDIWSAGIIMPILVIGNLPF 1293
            +P D+W+ G+IM  L++G  PF
Sbjct:  247 RPVDMWAIGVIMYTLLVGCPPF 268          

HSP 3 Score: 28.1054 bits (61), Expect = 3.176e-21
Identity = 13/24 (54.17%), Postives = 16/24 (66.67%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKHNFF 1468
            +S +L  +P KR TAK AL H FF
Sbjct:  303 ISHLLVVDPVKRYTAKDALAHPFF 326          
BLAST of NUAK family kinase 1 vs. TrEMBL
Match: A0A131YI44 (Phosphorylase kinase gamma subunit OS=Rhipicephalus appendiculatus OX=34631 PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 4.976e-21
Identity = 55/176 (31.25%), Postives = 94/176 (53.41%), Query Frame = 2
Query:  665 KFCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNKEISA--YLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            +F  KY   E       ST+  C +K    +  AK+ D+ ++ + S    L +  + EI +L   +  P+I+++ + F +   I +V+E C +G+L  Y      LSE K K+IM QL +A+ F+H   I+H D+K ENILLDD   +K+ DF  ++++ + +    + GT  Y +
Sbjct:   22 EFYAKYEPKEILGRGISSTVRRCINKETGEEFAAKIIDISSDTDGSGPTSLYQATKREIEVLKRVAGHPYIIELHDVFESTTFIFLVLELCRHGELFDYLTSVVALSEKKTKSIMKQLFEAVEFIHSKGIVHRDLKPENILLDDDLNVKVTDFGFATQLAESETLTELCGTPGYLA 197          

HSP 2 Score: 33.113 bits (74), Expect = 4.976e-21
Identity = 14/24 (58.33%), Postives = 19/24 (79.17%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKHNFF 1468
            +SK+L  +PKKR+TA +AL H FF
Sbjct:  270 ISKLLVVDPKKRLTASQALDHCFF 293          

HSP 3 Score: 32.3426 bits (72), Expect = 4.976e-21
Identity = 13/28 (46.43%), Postives = 18/28 (64.29%), Query Frame = 1
Query: 1210 NKENIDKPSDIWSAGIIMPILVIGNLPF 1293
            + E  DK  DIW+ G+IM  L++G  PF
Sbjct:  208 SSEGYDKQVDIWACGVIMYTLLVGFPPF 235          
BLAST of NUAK family kinase 1 vs. TrEMBL
Match: A0A224YVY5 (Phosphorylase kinase gamma subunit OS=Rhipicephalus zambeziensis OX=60191 PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 5.011e-21
Identity = 55/176 (31.25%), Postives = 94/176 (53.41%), Query Frame = 2
Query:  665 KFCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNKEISA--YLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            +F  KY   E       ST+  C +K    +  AK+ D+ ++ + S    L +  + EI +L   +  P+I+++ + F +   I +V+E C +G+L  Y      LSE K K+IM QL +A+ F+H   I+H D+K ENILLDD   +K+ DF  ++++ + +    + GT  Y +
Sbjct:   22 EFYAKYEPKEILGRGISSTVRRCINKETGEEFAAKIIDISSDTDGSGPTSLYQATKREIEVLKRVAGHPYIIELHDVFESTTFIFLVLELCRHGELFDYLTSVVALSEKKTKSIMKQLFEAVEFIHSKGIVHRDLKPENILLDDDLNVKVTDFGFATQLAESETLTELCGTPGYLA 197          

HSP 2 Score: 33.113 bits (74), Expect = 5.011e-21
Identity = 14/24 (58.33%), Postives = 19/24 (79.17%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKHNFF 1468
            +SK+L  +PKKR+TA +AL H FF
Sbjct:  270 ISKLLVVDPKKRLTASQALDHCFF 293          

HSP 3 Score: 32.3426 bits (72), Expect = 5.011e-21
Identity = 13/28 (46.43%), Postives = 18/28 (64.29%), Query Frame = 1
Query: 1210 NKENIDKPSDIWSAGIIMPILVIGNLPF 1293
            + E  DK  DIW+ G+IM  L++G  PF
Sbjct:  208 SSEGYDKQVDIWACGVIMYTLLVGFPPF 235          
BLAST of NUAK family kinase 1 vs. TrEMBL
Match: A0A131YKF9 (Phosphorylase kinase gamma subunit OS=Rhipicephalus appendiculatus OX=34631 PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 5.011e-21
Identity = 55/176 (31.25%), Postives = 94/176 (53.41%), Query Frame = 2
Query:  665 KFCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNKEISA--YLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            +F  KY   E       ST+  C +K    +  AK+ D+ ++ + S    L +  + EI +L   +  P+I+++ + F +   I +V+E C +G+L  Y      LSE K K+IM QL +A+ F+H   I+H D+K ENILLDD   +K+ DF  ++++ + +    + GT  Y +
Sbjct:   22 EFYAKYEPKEILGRGISSTVRRCINKETGEEFAAKIIDISSDTDGSGPTSLYQATKREIEVLKRVAGHPYIIELHDVFESTTFIFLVLELCRHGELFDYLTSVVALSEKKTKSIMKQLFEAVEFIHSKGIVHRDLKPENILLDDDLNVKVTDFGFATQLAESETLTELCGTPGYLA 197          

HSP 2 Score: 33.113 bits (74), Expect = 5.011e-21
Identity = 14/24 (58.33%), Postives = 19/24 (79.17%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKHNFF 1468
            +SK+L  +PKKR+TA +AL H FF
Sbjct:  270 ISKLLVVDPKKRLTASQALDHCFF 293          

HSP 3 Score: 32.3426 bits (72), Expect = 5.011e-21
Identity = 13/28 (46.43%), Postives = 18/28 (64.29%), Query Frame = 1
Query: 1210 NKENIDKPSDIWSAGIIMPILVIGNLPF 1293
            + E  DK  DIW+ G+IM  L++G  PF
Sbjct:  208 SSEGYDKQVDIWACGVIMYTLLVGFPPF 235          
BLAST of NUAK family kinase 1 vs. Ensembl Cavefish
Match: phkg2 (phosphorylase kinase catalytic subunit gamma 2 [Source:NCBI gene;Acc:103041098])

HSP 1 Score: 70.4774 bits (171), Expect = 1.069e-16
Identity = 53/177 (29.94%), Postives = 85/177 (48.02%), Query Frame = 2
Query:  665 KFCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNKEISAYL---KRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            +F +KY   E       S +  C +K    +   KV ++   K     L   K +   EI +LN+    P I+ + + + +   I +V +    G+L  Y  E   LSE + + +M  LL+A+ +LH   I+H D+K ENILLDD  ++KL DF  S ++    K   + GT  Y +
Sbjct:   18 EFHQKYEPKEVIGRGVSSVVRRCVNKHTGEELAVKVIEITAEKMTVQQLEEVKSSTLKEIHVLNVLKGHPSIITLVDSYESATFIFLVFDLMRRGELFDYLTEKVTLSEKETRYMMRALLEAVQYLHSLNIVHRDLKPENILLDDQGHIKLSDFGFSVQLRPGQKLRELCGTPGYLA 194          

HSP 2 Score: 28.8758 bits (63), Expect = 1.069e-16
Identity = 11/24 (45.83%), Postives = 18/24 (75.00%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKHNFF 1468
            +S++L  +P  R+TA++AL H FF
Sbjct:  267 ISRLLVVDPPLRLTAEQALAHPFF 290          

HSP 3 Score: 26.5646 bits (57), Expect = 1.069e-16
Identity = 10/28 (35.71%), Postives = 16/28 (57.14%), Query Frame = 1
Query: 1210 NKENIDKPSDIWSAGIIMPILVIGNLPF 1293
              E   K  D+W+ G+I+  L+ G+ PF
Sbjct:  205 THEGYGKEVDLWACGVILFTLLAGSPPF 232          
BLAST of NUAK family kinase 1 vs. Ensembl Cavefish
Match: phkg2 (phosphorylase kinase catalytic subunit gamma 2 [Source:NCBI gene;Acc:103041098])

HSP 1 Score: 70.4774 bits (171), Expect = 1.069e-16
Identity = 53/177 (29.94%), Postives = 85/177 (48.02%), Query Frame = 2
Query:  665 KFCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNKEISAYL---KRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            +F +KY   E       S +  C +K    +   KV ++   K     L   K +   EI +LN+    P I+ + + + +   I +V +    G+L  Y  E   LSE + + +M  LL+A+ +LH   I+H D+K ENILLDD  ++KL DF  S ++    K   + GT  Y +
Sbjct:   18 EFHQKYEPKEVIGRGVSSVVRRCVNKHTGEELAVKVIEITAEKMTVQQLEEVKSSTLKEIHVLNVLKGHPSIITLVDSYESATFIFLVFDLMRRGELFDYLTEKVTLSEKETRYMMRALLEAVQYLHSLNIVHRDLKPENILLDDQGHIKLSDFGFSVQLRPGQKLRELCGTPGYLA 194          

HSP 2 Score: 28.8758 bits (63), Expect = 1.069e-16
Identity = 11/24 (45.83%), Postives = 18/24 (75.00%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKHNFF 1468
            +S++L  +P  R+TA++AL H FF
Sbjct:  267 ISRLLVVDPPLRLTAEQALAHPFF 290          

HSP 3 Score: 26.5646 bits (57), Expect = 1.069e-16
Identity = 10/28 (35.71%), Postives = 16/28 (57.14%), Query Frame = 1
Query: 1210 NKENIDKPSDIWSAGIIMPILVIGNLPF 1293
              E   K  D+W+ G+I+  L+ G+ PF
Sbjct:  205 THEGYGKEVDLWACGVILFTLLAGSPPF 232          
BLAST of NUAK family kinase 1 vs. Ensembl Cavefish
Match: sik1 (serine/threonine-protein kinase SIK2-like [Source:NCBI gene;Acc:103047200])

HSP 1 Score: 63.929 bits (154), Expect = 1.720e-16
Identity = 40/148 (27.03%), Postives = 74/148 (50.00%), Query Frame = 2
Query:  680 YHIIESFYFSRKSTIYLCEDKILKNKSVAKVYD--LINNKEISAYLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDF 1117
            Y I+ +      + + L   K+ K +   K+ D   +N+  +    +     E+ I+ L +  P I+ + +    +  + IV EY  NG++  +    G +SE + +   WQ+L A+ + H++ I+H D+K EN+LLD    +KL DF
Sbjct:   26 YEILRTLGKGNFAVVKLARHKVTKTQVAIKIIDKTRLNSSNLEKIYR-----EVQIMKLLN-HPHIIKLYQVMETKDMLYIVTEYAKNGEMFDFLTSNGRMSEAEARKKFWQILTAVDYCHRHHIVHRDLKTENLLLDANMNIKLADF 167          

HSP 2 Score: 36.965 bits (84), Expect = 1.720e-16
Identity = 17/41 (41.46%), Postives = 26/41 (63.41%), Query Frame = 1
Query: 1186 PEMALKVLNKENIDKPS-DIWSAGIIMPILVIGNLPFDEEN 1305
            P  A +V   +  + P  DIWS G+++ +LV G+LPFD E+
Sbjct:  187 PYAAPEVFEGKEYEGPQLDIWSLGVVLYVLVCGSLPFDGES 227          

HSP 3 Score: 24.2534 bits (51), Expect = 1.720e-16
Identity = 16/52 (30.77%), Postives = 24/52 (46.15%), Query Frame = 2
Query: 1337 DLVSFYKQLCIAFFHIIFFPMS--------KMLKFNPKKRITAKKALKHNFF 1468
             L +  +++    F I FF MS        KML  +P KRIT  +  +H + 
Sbjct:  227 SLPALRQRVTEGRFRIPFF-MSEDCENLIRKMLVVDPAKRITVAQIKQHRWM 277          
BLAST of NUAK family kinase 1 vs. Ensembl Cavefish
Match: sik1 (serine/threonine-protein kinase SIK2-like [Source:NCBI gene;Acc:103047200])

HSP 1 Score: 63.929 bits (154), Expect = 1.817e-16
Identity = 40/148 (27.03%), Postives = 74/148 (50.00%), Query Frame = 2
Query:  680 YHIIESFYFSRKSTIYLCEDKILKNKSVAKVYD--LINNKEISAYLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDF 1117
            Y I+ +      + + L   K+ K +   K+ D   +N+  +    +     E+ I+ L +  P I+ + +    +  + IV EY  NG++  +    G +SE + +   WQ+L A+ + H++ I+H D+K EN+LLD    +KL DF
Sbjct:   26 YEILRTLGKGNFAVVKLARHKVTKTQVAIKIIDKTRLNSSNLEKIYR-----EVQIMKLLN-HPHIIKLYQVMETKDMLYIVTEYAKNGEMFDFLTSNGRMSEAEARKKFWQILTAVDYCHRHHIVHRDLKTENLLLDANMNIKLADF 167          

HSP 2 Score: 36.965 bits (84), Expect = 1.817e-16
Identity = 17/41 (41.46%), Postives = 26/41 (63.41%), Query Frame = 1
Query: 1186 PEMALKVLNKENIDKPS-DIWSAGIIMPILVIGNLPFDEEN 1305
            P  A +V   +  + P  DIWS G+++ +LV G+LPFD E+
Sbjct:  187 PYAAPEVFEGKEYEGPQLDIWSLGVVLYVLVCGSLPFDGES 227          

HSP 3 Score: 24.2534 bits (51), Expect = 1.817e-16
Identity = 16/52 (30.77%), Postives = 24/52 (46.15%), Query Frame = 2
Query: 1337 DLVSFYKQLCIAFFHIIFFPMS--------KMLKFNPKKRITAKKALKHNFF 1468
             L +  +++    F I FF MS        KML  +P KRIT  +  +H + 
Sbjct:  227 SLPALRQRVTEGRFRIPFF-MSEDCENLIRKMLVVDPAKRITVAQIKQHRWM 277          
BLAST of NUAK family kinase 1 vs. Ensembl Cavefish
Match: nuak1a (NUAK family kinase 1 [Source:NCBI gene;Acc:103029612])

HSP 1 Score: 77.0258 bits (188), Expect = 3.553e-16
Identity = 39/88 (44.32%), Postives = 55/88 (62.50%), Query Frame = 2
Query:  863 PFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEIS 1126
            P I+ I E F N+  I+IVMEY S G+L  Y  E   LSE + +    Q++ A+   HKN ++H D+KLEN+LLDD   +K+ DF +S
Sbjct:  109 PHIISIYEVFENKDKIVIVMEYASKGELYDYISERRKLSERETRHFFRQIVSAVHHCHKNGVVHRDLKLENVLLDDNCNIKIADFGLS 196          

HSP 2 Score: 27.7202 bits (60), Expect = 3.553e-16
Identity = 9/20 (45.00%), Postives = 14/20 (70.00%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPFD 1296
            D W+ G+++  LV G +PFD
Sbjct:  231 DSWALGVLLYTLVYGTMPFD 250          
BLAST of NUAK family kinase 1 vs. Ensembl Sea Lamprey
Match: stk17b (serine/threonine kinase 17b (apoptosis-inducing) [Source:ZFIN;Acc:ZDB-GENE-040426-1499])

HSP 1 Score: 72.4034 bits (176), Expect = 1.295e-17
Identity = 38/124 (30.65%), Postives = 70/124 (56.45%), Query Frame = 2
Query:  830 EIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDL--SLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILL---DDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            E+ IL      P I+D+ + F     II+V+EY   G++     ++     +E+ V+ +M Q+L+ + FLH+N+++H D+K +NILL     L  +K++DF +S R+   ++   + GT  Y +
Sbjct:   42 EMAILEAARSCPHIIDLHDAFETPTEIILVLEYAVGGEIFNQCVAEGEDAFTEVDVRRLMRQILEGVAFLHRNDVVHLDLKPQNILLTSASPLGDIKIVDFGLSRRVNSAEELREIMGTPEYVA 165          

HSP 2 Score: 34.6538 bits (78), Expect = 1.295e-17
Identity = 16/42 (38.10%), Postives = 27/42 (64.29%), Query Frame = 1
Query: 1192 MALKVLNKENIDKPSDIWSAGIIMPILVIGNLPF---DEENT 1308
            +A +VLN E I K +D+WS G++  +++ G  PF   D++ T
Sbjct:  164 VAPEVLNYEPISKATDMWSVGVLAYVMLTGESPFLGEDKQET 205          
BLAST of NUAK family kinase 1 vs. Ensembl Sea Lamprey
Match: phkg1b (phosphorylase kinase, gamma 1b (muscle) [Source:ZFIN;Acc:ZDB-GENE-050522-52])

HSP 1 Score: 64.6994 bits (156), Expect = 2.104e-16
Identity = 48/176 (27.27%), Postives = 79/176 (44.89%), Query Frame = 2
Query:  668 FCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNKEISAYLK---RNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            F +KY   E       S +  C  K        K+ D+  ++     L+    +   E+ IL   S  P I+ + + + +     +V +    G+L  Y  E   LSE   ++IM  + + + FLH   I+H D+K ENILLDD   ++L DF  S ++   ++   + GT  Y S
Sbjct:   21 FNDKYEPKEVLGSGVSSVVRRCVHKRTGQDFAVKIIDITPDRLSEEELEDIYSSTVKEVDILKAVSGHPHIITLIDAYESSTFFFLVFDLMKRGELFDYLTEKVALSEKDTRSIMRSIFEVVHFLHAKNIVHRDLKPENILLDDNMNIRLSDFGFSMQLRPGERLRELCGTPGYLS 196          

HSP 2 Score: 30.8018 bits (68), Expect = 2.104e-16
Identity = 12/24 (50.00%), Postives = 18/24 (75.00%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKHNFF 1468
            +S++L   P+KR TA++AL H FF
Sbjct:  269 ISRLLVVEPEKRFTAEQALAHPFF 292          

HSP 3 Score: 26.9498 bits (58), Expect = 2.104e-16
Identity = 10/22 (45.45%), Postives = 15/22 (68.18%), Query Frame = 1
Query: 1228 KPSDIWSAGIIMPILVIGNLPF 1293
            K  D+W+ G+IM  L+ G+ PF
Sbjct:  213 KEVDLWACGVIMYTLLAGSPPF 234          
BLAST of NUAK family kinase 1 vs. Ensembl Sea Lamprey
Match: rps6ka5 (ribosomal protein S6 kinase, polypeptide 5 [Source:ZFIN;Acc:ZDB-GENE-130530-693])

HSP 1 Score: 65.0846 bits (157), Expect = 7.587e-15
Identity = 35/110 (31.82%), Postives = 58/110 (52.73%), Query Frame = 2
Query:  797 ISAYLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDD---LFYLKLIDF 1117
            +S  ++ N + EI  L LC   P I++I + + +     +VME    G+L    K+  + SE +   IM +L+ A  F+H   ++H D+K EN+L  D      +K+IDF
Sbjct:  142 VSKRMEANTQREIAALKLCHAHPNIVNIIDVYHDTLHTYLVMELLKGGELLERIKKRSHFSETEASRIMRKLVSATSFMHDTGVVHRDLKPENLLFADDTEGAAIKVIDF 251          

HSP 2 Score: 32.7278 bits (73), Expect = 7.587e-15
Identity = 14/51 (27.45%), Postives = 23/51 (45.10%), Query Frame = 1
Query: 1183 LPEMALKVLNKENIDKPSDIWSAGIIMPILVIGNLPFDEENTRF*CVKRCD 1335
            L   A ++L     D+  D+WS G+I+  ++ G +PF        C    D
Sbjct:  271 LQYAAPELLQHAGYDESCDVWSLGVILYTMLSGQVPFQSHGQPMTCSSATD 321          
BLAST of NUAK family kinase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006410.1 (pep scaffold:Pmarinus_7.0:GL476370:17405:31068:-1 gene:ENSPMAG00000005688.1 transcript:ENSPMAT00000006410.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 1.187e-14
Identity = 29/92 (31.52%), Postives = 51/92 (55.43%), Query Frame = 2
Query:  851 CSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEIS 1126
            C   P I+ + E    + ++ +VMEY S G++  Y    G + E + +    Q++ A+ + H+  I+H D+K EN+LLD   ++K+ DF  S
Sbjct:   92 CLNHPNIVKLYEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKNIVHRDLKAENLLLDVDMHIKIADFGFS 183          

HSP 2 Score: 36.965 bits (84), Expect = 1.187e-14
Identity = 19/49 (38.78%), Postives = 27/49 (55.10%), Query Frame = 1
Query: 1171 FDIFL---PEMALKVLNKENIDKPS-DIWSAGIIMPILVIGNLPFDEEN 1305
             D F    P  A ++   +  D P  D+WS G+I+  LV G+LPFD +N
Sbjct:  192 LDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQN 240          
BLAST of NUAK family kinase 1 vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 58.9214 bits (141), Expect = 2.042e-14
Identity = 28/88 (31.82%), Postives = 49/88 (55.68%), Query Frame = 2
Query:  863 PFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEIS 1126
            P I+ + E    + ++ +VMEY S G++  Y    G + E + +    Q++ A+ + H+  I+H D+K EN+LLD    +K+ DF  S
Sbjct:  111 PNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLKAENLLLDADMNIKIADFGFS 198          

HSP 2 Score: 37.3502 bits (85), Expect = 2.042e-14
Identity = 19/49 (38.78%), Postives = 27/49 (55.10%), Query Frame = 1
Query: 1171 FDIFL---PEMALKVLNKENIDKPS-DIWSAGIIMPILVIGNLPFDEEN 1305
             D F    P  A ++   +  D P  D+WS G+I+  LV G+LPFD +N
Sbjct:  207 LDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQN 255          
BLAST of NUAK family kinase 1 vs. Ensembl Yeast
Match: KIN1 (Serine/threonine protein kinase involved in regulation of exocytosis; localizes to the cytoplasmic face of the plasma membrane; KIN1 has a paralog, KIN2, that arose from the whole genome duplication [Source:SGD;Acc:S000002529])

HSP 1 Score: 55.0694 bits (131), Expect = 2.838e-15
Identity = 25/71 (35.21%), Postives = 43/71 (60.56%), Query Frame = 2
Query:  914 IVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEIS 1126
            ++ EY S G L  Y  + G++ E + +     +  A+ +LH N I+H D+K+ENI++ D   +K+IDF +S
Sbjct:  221 MLFEYVSGGQLLDYIIQHGSIREHQARKFARGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFGLS 291          

HSP 2 Score: 35.4242 bits (80), Expect = 2.838e-15
Identity = 12/24 (50.00%), Postives = 20/24 (83.33%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPFDEENT 1308
            D+WS G+++ +LV G +PFD+EN+
Sbjct:  326 DVWSFGVVLFVLVCGKVPFDDENS 349          

HSP 3 Score: 27.335 bits (59), Expect = 2.838e-15
Identity = 12/28 (42.86%), Postives = 19/28 (67.86%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKHNFFWCFR 1480
            +SKML  +PK+R T K+ ++H+  W  R
Sbjct:  375 LSKMLVVDPKRRATLKQVVEHH--WMVR 400          
BLAST of NUAK family kinase 1 vs. Ensembl Yeast
Match: PKH2 (Serine/threonine protein kinase; involved in sphingolipid-mediated signaling pathway that controls endocytosis; activates Ypk1p and Ykr2p, components of signaling cascade required for maintenance of cell wall integrity; contains a PH-like domain; redundant with Pkh1p; PKH2 has a paralog, PKH1, that arose from the whole genome duplication [Source:SGD;Acc:S000005460])

HSP 1 Score: 68.1662 bits (165), Expect = 5.623e-14
Identity = 34/85 (40.00%), Postives = 50/85 (58.82%), Query Frame = 2
Query:  863 PFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDF 1117
            P ++ +   F ++ S+  ++EY  NGD     K++G+L E   +    Q++ AI +LH N IIH DIK ENILLD    +KL DF
Sbjct:  238 PSVVRLFSTFQDESSLYFLLEYAPNGDFLSLMKKYGSLDETCARYYAAQIIDAIDYLHSNGIIHRDIKPENILLDGEMKIKLTDF 322          

HSP 2 Score: 25.7942 bits (55), Expect = 5.623e-14
Identity = 12/35 (34.29%), Postives = 18/35 (51.43%), Query Frame = 1
Query: 1201 KVLNKENIDKPSDIWSAGIIMPILVIGNLPFDEEN 1305
            ++LN    D   DIW+ G I+  ++ G  PF   N
Sbjct:  359 ELLNDSFTDYRCDIWAFGCILFQMIAGKPPFKATN 393          
BLAST of NUAK family kinase 1 vs. Ensembl Yeast
Match: HSL1 (Nim1p-related protein kinase; septin-binding kinase that localizes to the bud neck septin ring and regulates the morphogenesis checkpoint; phosphorylates Hsl7p and cooperates with Elm1p to recruit Hsl7p to the mother-bud neck, as a prerequisite for the subsequent recruitment, phosphorylation, and degradation of Swe1p; autophosphorylation enhances interactions with Hsl7p [Source:SGD;Acc:S000001584])

HSP 1 Score: 46.595 bits (109), Expect = 1.193e-13
Identity = 36/120 (30.00%), Postives = 62/120 (51.67%), Query Frame = 2
Query:  782 INNKEISAYLKRNA---ETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDL-FYLKLIDFEISS 1129
            I ++E S + + N    E EI I+ L S    +M + E + N+  + +V+EY   G+L  Y    G L E +      Q+++ + + H   I H D+K EN+LLD     +K+ DF +++
Sbjct:  145 IASREHSNHSQTNPYGIEREIVIMKLIS-HTNVMALFEVWENKSELYLVLEYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIKIADFGMAA 263          

HSP 2 Score: 37.7354 bits (86), Expect = 1.193e-13
Identity = 13/27 (48.15%), Postives = 22/27 (81.48%), Query Frame = 1
Query: 1231 PSDIWSAGIIMPILVIGNLPFDEENTR 1311
            PSD+WS GI++  L+ G+LPF+++N +
Sbjct:  295 PSDVWSCGIVLFALLTGHLPFNDDNIK 321          

HSP 3 Score: 28.1054 bits (61), Expect = 1.193e-13
Identity = 11/21 (52.38%), Postives = 17/21 (80.95%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKH 1459
            +SK+L  +P+KRIT ++ LKH
Sbjct:  346 ISKILVIDPEKRITTQEILKH 366          
BLAST of NUAK family kinase 1 vs. Ensembl Yeast
Match: RIM15 (Protein kinase involved in cell proliferation in response to nutrients; glucose-repressible; involved in signal transduction during cell proliferation in response to nutrients, specifically the establishment of stationary phase; identified as a regulator of IME2; phosphorylates Igo1p and Igo2p; substrate of Pho80p-Pho85p kinase [Source:SGD;Acc:S000001861])

HSP 1 Score: 71.633 bits (174), Expect = 1.386e-13
Identity = 46/170 (27.06%), Postives = 88/170 (51.76%), Query Frame = 2
Query:  626 FSSNQVKFIQFPLKFCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVY---DLINNKEISAYLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEIS 1126
             ++NQ   ++ P    + Y I++        ++YL   K+  +    KV    D+I   +++     N ++E  I+ + S  P++  +   F N+ ++ +VMEY   GDL+   K  G L +   K  + +++  +  +H+N IIH D+K EN+L+D+  ++KL DF +S
Sbjct:  778 LATNQT--VKSPTPSIKDYDILKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVT-----NVKSERAIMMVQSDKPYVARLFASFQNKDNLFLVMEYLPGGDLATLIKMMGYLPDQWAKQYLTEIVVGVNDMHQNGIIHHDLKPENLLIDNAGHVKLTDFGLS 940          
BLAST of NUAK family kinase 1 vs. Ensembl Yeast
Match: KCC4 (Protein kinase of the bud neck involved in the septin checkpoint; associates with septin proteins, negatively regulates Swe1p by phosphorylation, shows structural homology to bud neck kinases Gin4p and Hsl1p; KCC4 has a paralog, GIN4, that arose from the whole genome duplication [Source:SGD;Acc:S000000529])

HSP 1 Score: 53.9138 bits (128), Expect = 1.426e-13
Identity = 40/169 (23.67%), Postives = 78/169 (46.15%), Query Frame = 2
Query:  659 PLKFCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKV------YDLINNKEISAYLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFD 1147
            P      + + E+  F     + L + +   +++  KV       +  N+    + L  N E EI I+ L S  P ++ + + +    ++ +++EY   G+L     + G L E +      Q++  I + H   I+H D+K EN+LLD  + +K+ DF +++   D D
Sbjct:   14 PSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLLS-HPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDAD 181          

HSP 2 Score: 38.891 bits (89), Expect = 1.426e-13
Identity = 15/24 (62.50%), Postives = 19/24 (79.17%), Query Frame = 1
Query: 1234 SDIWSAGIIMPILVIGNLPFDEEN 1305
            SD+WS G+I+  L+ G LPFDEEN
Sbjct:  208 SDVWSCGVILFALLTGRLPFDEEN 231          
BLAST of NUAK family kinase 1 vs. Ensembl Nematostella
Match: EDO34707 (Serine/threonine-protein kinase PLK4 [Source:UniProtKB/Swiss-Prot;Acc:A7SNN5])

HSP 1 Score: 63.929 bits (154), Expect = 1.072e-15
Identity = 36/110 (32.73%), Postives = 65/110 (59.09%), Query Frame = 2
Query:  863 PFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGN-LSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVR-GTLIYFS 1186
            P I+++  YF +   + +V+E   NG+ + Y ++ G+ L E +V+ IM Q+++ + +LH + IIH D+ L NILL      K+ DF +++R+   D+++    GT  Y S
Sbjct:   71 PSILELYTYFEDDNYVYLVLELAENGEANRYLRKQGHTLKESEVRRIMLQVVKGVLYLHSHGIIHRDLSLGNILLSSDMDAKIADFGLATRLSLPDEKHYTMCGTPNYIS 180          

HSP 2 Score: 31.5722 bits (70), Expect = 1.072e-15
Identity = 12/26 (46.15%), Postives = 17/26 (65.38%), Query Frame = 1
Query: 1234 SDIWSAGIIMPILVIGNLPFDEENTR 1311
            SD+WS G ++  L++G  PFD E  R
Sbjct:  193 SDVWSIGCMLFTLLVGKPPFDTEAVR 218          

HSP 3 Score: 25.0238 bits (53), Expect = 1.072e-15
Identity = 11/23 (47.83%), Postives = 15/23 (65.22%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKHNF 1465
            +SK+LK NP+ R+T    L H F
Sbjct:  243 ISKLLKKNPQDRLTLSGILDHPF 265          
BLAST of NUAK family kinase 1 vs. Ensembl Nematostella
Match: EDO37143 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGS0])

HSP 1 Score: 62.003 bits (149), Expect = 5.559e-15
Identity = 32/86 (37.21%), Postives = 50/86 (58.14%), Query Frame = 2
Query:  869 IMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEIS 1126
            I+ + + F  +  + ++ME  + GDL  Y +  G + E K K +  QLLQA+ + H+  +IH D+K EN+LLD    +KL DF  S
Sbjct:   78 IIQVLDLFEVREKVYVIMELATRGDLLEYIRYRGCVRERKAKKVFSQLLQAVKYCHQQGVIHRDLKCENVLLDIGDNVKLTDFGFS 163          

HSP 2 Score: 36.965 bits (84), Expect = 5.559e-15
Identity = 16/38 (42.11%), Postives = 25/38 (65.79%), Query Frame = 1
Query: 1195 ALKVLNKENID-KPSDIWSAGIIMPILVIGNLPFDEEN 1305
            A+++L     D + +DIWS GII+  +V G +PFD+ N
Sbjct:  183 AIEILQGTEYDGEKADIWSLGIILYTMVTGRMPFDDAN 220          
BLAST of NUAK family kinase 1 vs. Ensembl Nematostella
Match: EDO36169 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJE6])

HSP 1 Score: 59.6918 bits (143), Expect = 2.174e-14
Identity = 29/95 (30.53%), Postives = 52/95 (54.74%), Query Frame = 2
Query:  863 PFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFD 1147
            P I+ + +       I +VMEY S G+L  Y  + G L E   +    Q++  + + H++ ++H D+K EN+LLD    +K+ DF +S+ + D +
Sbjct:   78 PHIIKLYQVISTPTDIFMVMEYVSGGELFEYILKHGKLEEKDARRFFQQIISGVDYCHRHMVVHRDLKPENLLLDSQLNIKIADFGLSNIMTDGE 172          

HSP 2 Score: 36.965 bits (84), Expect = 2.174e-14
Identity = 14/23 (60.87%), Postives = 19/23 (82.61%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPFDEEN 1305
            DIWSAG+I+  L+ G LPFD+E+
Sbjct:  200 DIWSAGVILYALLCGTLPFDDEH 222          
BLAST of NUAK family kinase 1 vs. Ensembl Nematostella
Match: EDO30768 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZV3])

HSP 1 Score: 58.9214 bits (141), Expect = 4.697e-14
Identity = 31/108 (28.70%), Postives = 56/108 (51.85%), Query Frame = 2
Query:  863 PFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            P I+ + E      ++ +VMEY S G++  Y    G + E + +    Q++ A+ + H+  +IH D+K EN+LLD    +K+ DF  S+     +K +   G+  Y +
Sbjct:   95 PNIVKLYEVIETDKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHVIHRDLKAENLLLDADMNIKIADFGFSNEFTPGNKLDTFCGSPPYAA 202          

HSP 2 Score: 36.5798 bits (83), Expect = 4.697e-14
Identity = 17/41 (41.46%), Postives = 25/41 (60.98%), Query Frame = 1
Query: 1186 PEMALKVLNKENIDKPS-DIWSAGIIMPILVIGNLPFDEEN 1305
            P  A ++   +  D P  D+WS G+I+  LV G+LPFD +N
Sbjct:  199 PYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQN 239          
BLAST of NUAK family kinase 1 vs. Ensembl Nematostella
Match: EDO37827 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEP8])

HSP 1 Score: 61.2326 bits (147), Expect = 5.343e-13
Identity = 33/100 (33.00%), Postives = 58/100 (58.00%), Query Frame = 2
Query:  887 YFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            YF ++  I I++E C    L    K    L+E +V+  M Q++ A  +LHK+ IIH D+KL N+ L+D   +K+ DF +++R  + +++  + GT  Y +
Sbjct:   89 YFEDRDYIYILLELCPRRSLMELHKRRRALTEPEVRYFMKQIIDACIYLHKSRIIHRDLKLGNLFLNDDMEVKVGDFGLATRAEEGERKKTLCGTPNYIA 188          

HSP 2 Score: 31.187 bits (69), Expect = 5.343e-13
Identity = 13/38 (34.21%), Postives = 23/38 (60.53%), Query Frame = 1
Query: 1192 MALKVLNKENIDKPSDIWSAGIIMPILVIGNLPFDEEN 1305
            +A +VL+K       D+WS G I+  L++G  PF+ ++
Sbjct:  187 IAPEVLSKRGHSFEVDVWSVGCILYTLLVGKPPFETQS 224          
BLAST of NUAK family kinase 1 vs. Ensembl Medaka
Match: nuak2 (NUAK family kinase 2 [Source:NCBI gene;Acc:101165471])

HSP 1 Score: 79.337 bits (194), Expect = 2.782e-18
Identity = 41/88 (46.59%), Postives = 56/88 (63.64%), Query Frame = 2
Query:  863 PFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEIS 1126
            P I+ I E F N+  I+IVMEY S GDL  Y  E   LSE + +    Q++ A+ + H+N I+H D+KLENILLDD   +K+ DF +S
Sbjct:  100 PHIISIYEVFENKDKIVIVMEYASRGDLYDYICEKRRLSEREARHFFRQIVSAVHYCHQNGIVHRDLKLENILLDDRGNVKIADFGLS 187          

HSP 2 Score: 32.3426 bits (72), Expect = 2.782e-18
Identity = 12/25 (48.00%), Postives = 17/25 (68.00%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPFDEENTR 1311
            D WS G+++  LV GN+PFD  N +
Sbjct:  222 DTWSLGVLLYTLVHGNMPFDGNNHK 246          
BLAST of NUAK family kinase 1 vs. Ensembl Medaka
Match: nuak2 (NUAK family kinase 2 [Source:NCBI gene;Acc:101165471])

HSP 1 Score: 79.337 bits (194), Expect = 2.805e-18
Identity = 41/88 (46.59%), Postives = 56/88 (63.64%), Query Frame = 2
Query:  863 PFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEIS 1126
            P I+ I E F N+  I+IVMEY S GDL  Y  E   LSE + +    Q++ A+ + H+N I+H D+KLENILLDD   +K+ DF +S
Sbjct:  103 PHIISIYEVFENKDKIVIVMEYASRGDLYDYICEKRRLSEREARHFFRQIVSAVHYCHQNGIVHRDLKLENILLDDRGNVKIADFGLS 190          

HSP 2 Score: 32.3426 bits (72), Expect = 2.805e-18
Identity = 12/25 (48.00%), Postives = 17/25 (68.00%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPFDEENTR 1311
            D WS G+++  LV GN+PFD  N +
Sbjct:  225 DTWSLGVLLYTLVHGNMPFDGNNHK 249          
BLAST of NUAK family kinase 1 vs. Ensembl Medaka
Match: nuak2 (NUAK family kinase 2 [Source:NCBI gene;Acc:101165471])

HSP 1 Score: 79.337 bits (194), Expect = 2.875e-18
Identity = 41/88 (46.59%), Postives = 56/88 (63.64%), Query Frame = 2
Query:  863 PFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEIS 1126
            P I+ I E F N+  I+IVMEY S GDL  Y  E   LSE + +    Q++ A+ + H+N I+H D+KLENILLDD   +K+ DF +S
Sbjct:   98 PHIISIYEVFENKDKIVIVMEYASRGDLYDYICEKRRLSEREARHFFRQIVSAVHYCHQNGIVHRDLKLENILLDDRGNVKIADFGLS 185          

HSP 2 Score: 32.3426 bits (72), Expect = 2.875e-18
Identity = 12/25 (48.00%), Postives = 17/25 (68.00%), Query Frame = 1
Query: 1237 DIWSAGIIMPILVIGNLPFDEENTR 1311
            D WS G+++  LV GN+PFD  N +
Sbjct:  220 DTWSLGVLLYTLVHGNMPFDGNNHK 244          
BLAST of NUAK family kinase 1 vs. Ensembl Medaka
Match: sik1 (serine/threonine-protein kinase SIK2-like [Source:NCBI gene;Acc:101175275])

HSP 1 Score: 68.5514 bits (166), Expect = 4.853e-16
Identity = 43/146 (29.45%), Postives = 74/146 (50.68%), Query Frame = 2
Query:  680 YHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNKEISAYLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDF 1117
            Y II +      + + L + K+ K +   K+   I+   +S         E+ I+ L +  P I+ + +    +  + IV EY  NG++  Y    G +SE + +T  WQ+L A+ + H++ I+H D+K EN+LLD    +KL DF
Sbjct:   26 YEIIRTLGKGNFAVVKLAKHKVTKTQVAIKI---IDKTRLSPSNLEKIYREVQIMKLLN-HPHIIKLYQVMETKDMLYIVTEYAKNGEMFDYLTSNGRMSEDEARTKFWQILTAVDYCHRHHIVHRDLKTENLLLDGNMNIKLADF 167          

HSP 2 Score: 35.4242 bits (80), Expect = 4.853e-16
Identity = 16/38 (42.11%), Postives = 24/38 (63.16%), Query Frame = 1
Query: 1186 PEMALKVLNKENIDKPS-DIWSAGIIMPILVIGNLPFD 1296
            P  A +V   +  + P  DIWS G+++ +LV G+LPFD
Sbjct:  187 PYAAPEVFEGKEYEGPQLDIWSLGVVLYVLVCGSLPFD 224          
BLAST of NUAK family kinase 1 vs. Ensembl Medaka
Match: sik1 (serine/threonine-protein kinase SIK2-like [Source:NCBI gene;Acc:101175275])

HSP 1 Score: 68.5514 bits (166), Expect = 4.853e-16
Identity = 43/146 (29.45%), Postives = 74/146 (50.68%), Query Frame = 2
Query:  680 YHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNKEISAYLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDF 1117
            Y II +      + + L + K+ K +   K+   I+   +S         E+ I+ L +  P I+ + +    +  + IV EY  NG++  Y    G +SE + +T  WQ+L A+ + H++ I+H D+K EN+LLD    +KL DF
Sbjct:   26 YEIIRTLGKGNFAVVKLAKHKVTKTQVAIKI---IDKTRLSPSNLEKIYREVQIMKLLN-HPHIIKLYQVMETKDMLYIVTEYAKNGEMFDYLTSNGRMSEDEARTKFWQILTAVDYCHRHHIVHRDLKTENLLLDGNMNIKLADF 167          

HSP 2 Score: 35.4242 bits (80), Expect = 4.853e-16
Identity = 16/38 (42.11%), Postives = 24/38 (63.16%), Query Frame = 1
Query: 1186 PEMALKVLNKENIDKPS-DIWSAGIIMPILVIGNLPFD 1296
            P  A +V   +  + P  DIWS G+++ +LV G+LPFD
Sbjct:  187 PYAAPEVFEGKEYEGPQLDIWSLGVVLYVLVCGSLPFD 224          
BLAST of NUAK family kinase 1 vs. Planmine SMEST
Match: SMESG000054249.1 (SMESG000054249.1)

HSP 1 Score: 395.586 bits (1015), Expect = 1.633e-137
Identity = 196/196 (100.00%), Postives = 196/196 (100.00%), Query Frame = 2
Query:  611 MKNINFSSNQVKFIQFPLKFCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNKEISAYLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFSRKWH 1198
            MKNINFSSNQVKFIQFPLKFCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNKEISAYLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFSRKWH
Sbjct:    1 MKNINFSSNQVKFIQFPLKFCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNKEISAYLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFSRKWH 196          
BLAST of NUAK family kinase 1 vs. Planmine SMEST
Match: SMESG000038340.1 (SMESG000038340.1)

HSP 1 Score: 92.0485 bits (227), Expect = 3.243e-23
Identity = 51/178 (28.65%), Postives = 94/178 (52.81%), Query Frame = 2
Query:  665 KFCE----KYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNKEISAYLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            K+CE    KY   E       ST+  C D+  K +   K+ D+ +  +    L+     E+ IL L +  P+I+++ +++ ++  + ++ E C  G+L  +      LSE + + IM Q+ +A+ F+H   I+H D+K ENILLDD   +K+ DF ++ +  + ++   +RGT  Y +
Sbjct:   12 KYCEHFYSKYEPKEIIGTGASSTVRRCMDRKTKIEYAVKIIDVNSGVDSPNILRAECHREVEILRLVAGQPYIIELHDFYESEVYMFLIFELCPKGELFDHLNARVTLSEKRTRLIMSQIFEAVTFIHSKNIVHRDLKPENILLDDNLNIKITDFGLAVKTDNLEELKEIRGTPGYLA 189          

HSP 2 Score: 30.4166 bits (67), Expect = 3.243e-23
Identity = 15/53 (28.30%), Postives = 25/53 (47.17%), Query Frame = 1
Query: 1228 KPSDIWSAGIIMPILVIGNLPFDEENTRF*CVKRCD*FGKFLQTIMYCFFSYN 1386
            +P D+W+ G+IM  L++G  PF                   L+ IM C +S++
Sbjct:  206 QPVDVWACGVIMYTLLVGCPPFWHRKQHL-----------MLRQIMECKYSFH 247          

HSP 3 Score: 25.409 bits (54), Expect = 3.243e-23
Identity = 11/24 (45.83%), Postives = 16/24 (66.67%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKHNFF 1468
            + K+L  NP +RI + +AL H FF
Sbjct:  262 IKKILIVNPNQRIKSSEALFHEFF 285          
BLAST of NUAK family kinase 1 vs. Planmine SMEST
Match: SMESG000038340.1 (SMESG000038340.1)

HSP 1 Score: 91.6633 bits (226), Expect = 3.638e-23
Identity = 51/178 (28.65%), Postives = 94/178 (52.81%), Query Frame = 2
Query:  665 KFCE----KYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNKEISAYLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            K+CE    KY   E       ST+  C D+  K +   K+ D+ +  +    L+     E+ IL L +  P+I+++ +++ ++  + ++ E C  G+L  +      LSE + + IM Q+ +A+ F+H   I+H D+K ENILLDD   +K+ DF ++ +  + ++   +RGT  Y +
Sbjct:   12 KYCEHFYSKYEPKEIIGTGASSTVRRCMDRKTKIEYAVKIIDVNSGVDSPNILRAECHREVEILRLVAGQPYIIELHDFYESEVYMFLIFELCPKGELFDHLNARVTLSEKRTRLIMSQIFEAVTFIHSKNIVHRDLKPENILLDDNLNIKITDFGLAVKTDNLEELKEIRGTPGYLA 189          

HSP 2 Score: 30.4166 bits (67), Expect = 3.638e-23
Identity = 15/53 (28.30%), Postives = 25/53 (47.17%), Query Frame = 1
Query: 1228 KPSDIWSAGIIMPILVIGNLPFDEENTRF*CVKRCD*FGKFLQTIMYCFFSYN 1386
            +P D+W+ G+IM  L++G  PF                   L+ IM C +S++
Sbjct:  206 QPVDVWACGVIMYTLLVGCPPFWHRKQHL-----------MLRQIMECKYSFH 247          

HSP 3 Score: 25.409 bits (54), Expect = 3.638e-23
Identity = 11/24 (45.83%), Postives = 16/24 (66.67%), Query Frame = 2
Query: 1397 MSKMLKFNPKKRITAKKALKHNFF 1468
            + K+L  NP +RI + +AL H FF
Sbjct:  262 IKKILIVNPNQRIKSSEALFHEFF 285          
BLAST of NUAK family kinase 1 vs. Planmine SMEST
Match: SMESG000038340.1 (SMESG000038340.1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.826e-21
Identity = 51/178 (28.65%), Postives = 94/178 (52.81%), Query Frame = 2
Query:  665 KFCE----KYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNKEISAYLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRNLVRGTLIYFS 1186
            K+CE    KY   E       ST+  C D+  K +   K+ D+ +  +    L+     E+ IL L +  P+I+++ +++ ++  + ++ E C  G+L  +      LSE + + IM Q+ +A+ F+H   I+H D+K ENILLDD   +K+ DF ++ +  + ++   +RGT  Y +
Sbjct:   12 KYCEHFYSKYEPKEIIGTGASSTVRRCMDRKTKIEYAVKIIDVNSGVDSPNILRAECHREVEILRLVAGQPYIIELHDFYESEVYMFLIFELCPKGELFDHLNARVTLSEKRTRLIMSQIFEAVTFIHSKNIVHRDLKPENILLDDNLNIKITDFGLAVKTDNLEELKEIRGTPGYLA 189          

HSP 2 Score: 30.4166 bits (67), Expect = 1.826e-21
Identity = 15/53 (28.30%), Postives = 25/53 (47.17%), Query Frame = 1
Query: 1228 KPSDIWSAGIIMPILVIGNLPFDEENTRF*CVKRCD*FGKFLQTIMYCFFSYN 1386
            +P D+W+ G+IM  L++G  PF                   L+ IM C +S++
Sbjct:  206 QPVDVWACGVIMYTLLVGCPPFWHRKQHL-----------MLRQIMECKYSFH 247          
BLAST of NUAK family kinase 1 vs. Planmine SMEST
Match: SMESG000031831.1 (SMESG000031831.1)

HSP 1 Score: 80.8777 bits (198), Expect = 3.537e-20
Identity = 69/205 (33.66%), Postives = 107/205 (52.20%), Query Frame = 2
Query:  578 SPQYSWNIYRKMKNI-NFSSNQVKFIQFPLKFCEKYHIIESFYFSRKSTIYLCEDKILKNKSVAKVYDLINNKEISAYLKRNAETEIGILNLCSIWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMWQLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEIS-SRIIDFDKRNLVRGTLIYFS 1186
            +P  S+ +   + NI N  S Q++ I  P  F E Y + +  +    + IY C     +   VAK+Y   + + IS  LK + + E  I+      P I+   +YF N+  I I+ E C +GDL  + ++  N  E  +K IM+Q+L+ + FLH   + H DIKLENI +     ++LIDFE   +   D  K+N V+GT +YFS
Sbjct:  245 APSTSFKLPSYILNIRNRKSCQIE-INLPKAFYESYQLGKIVFTGLHANIYHCTHTNSQTLFVAKIYSQNSPQLIS--LKVSPKNEYEIIKSFD-HPHIIKAYDYFENEEFICILFENCQHGDLIDFMEK--NFIEKDIKGIMFQILETLSFLHGKNMAHRDIKLENICVSSDLKIRLIDFECCINDSDDLGKKN-VKGTALYFS 442          

HSP 2 Score: 36.5798 bits (83), Expect = 3.537e-20
Identity = 19/56 (33.93%), Postives = 33/56 (58.93%), Query Frame = 1
Query: 1180 FLPEMALKV--LNKENIDKPSDIWSAGIIMPILVIGNLPFDEENTRF*CVKRCD*F 1341
            F PE   K+  +  ++ +KPSDIW+AGI+M  L++G  P +     +  +K+ + F
Sbjct:  441 FSPEKVNKMFYIRMQSSEKPSDIWAAGIVMFYLLVGYFPIEYNGNLYKNIKQGNIF 496          
The following BLAST results are available for this feature:
BLAST of NUAK family kinase 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PHKG25.498e-1727.12phosphorylase kinase catalytic subunit gamma 2 [So... [more]
PHKG26.917e-1727.12phosphorylase kinase catalytic subunit gamma 2 [So... [more]
NUAK21.065e-1644.32NUAK family kinase 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
NUAK21.126e-1644.32NUAK family kinase 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
NUAK11.263e-1637.21NUAK family kinase 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of NUAK family kinase 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-822.017e-1638.89pep chromosome:WBcel235:IV:7431348:7444648:1 gene:... [more]
unc-822.192e-1638.89pep chromosome:WBcel235:IV:7425729:7444660:1 gene:... [more]
unc-822.208e-1638.89pep chromosome:WBcel235:IV:7428926:7444648:1 gene:... [more]
unc-822.209e-1638.89pep chromosome:WBcel235:IV:7428926:7444648:1 gene:... [more]
unc-822.247e-1638.89pep chromosome:WBcel235:IV:7425729:7444660:1 gene:... [more]
back to top
BLAST of NUAK family kinase 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PhKgamma8.297e-2029.94gene:FBgn0011754 transcript:FBtr0301501[more]
PhKgamma8.297e-2029.94gene:FBgn0011754 transcript:FBtr0301500[more]
PhKgamma1.342e-1929.94gene:FBgn0011754 transcript:FBtr0090002[more]
PhKgamma1.342e-1929.94gene:FBgn0011754 transcript:FBtr0343648[more]
PhKgamma1.378e-1929.94gene:FBgn0011754 transcript:FBtr0343587[more]
back to top
BLAST of NUAK family kinase 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phkg1a3.505e-1832.96phosphorylase kinase, gamma 1a (muscle) [Source:ZF... [more]
phkg1a3.505e-1832.96phosphorylase kinase, gamma 1a (muscle) [Source:ZF... [more]
phkg1a3.505e-1832.96phosphorylase kinase, gamma 1a (muscle) [Source:ZF... [more]
phkg24.562e-1730.51phosphorylase kinase, gamma 2 (testis) [Source:ZFI... [more]
sik11.886e-1630.14salt-inducible kinase 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of NUAK family kinase 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itga111.142e-1741.13integrin subunit alpha 11 [Source:Xenbase;Acc:XB-G... [more]
phkg11.392e-1730.39phosphorylase kinase, gamma 1 (muscle) [Source:NCB... [more]
phkg11.554e-1730.39phosphorylase kinase, gamma 1 (muscle) [Source:NCB... [more]
phkg12.945e-1731.55phosphorylase kinase, gamma 1 (muscle) [Source:NCB... [more]
phkg13.095e-1730.64phosphorylase kinase, gamma 1 (muscle) [Source:NCB... [more]
back to top
BLAST of NUAK family kinase 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Phkg26.355e-1727.12phosphorylase kinase, gamma 2 (testis) [Source:MGI... [more]
Phkg26.355e-1727.12phosphorylase kinase, gamma 2 (testis) [Source:MGI... [more]
Nuak29.158e-1745.45NUAK family, SNF1-like kinase, 2 [Source:MGI Symbo... [more]
Nuak12.949e-1644.32NUAK family, SNF1-like kinase, 1 [Source:MGI Symbo... [more]
Plk22.432e-1528.14polo like kinase 2 [Source:MGI Symbol;Acc:MGI:1099... [more]
back to top
BLAST of NUAK family kinase 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q02723|RKIN1_SECCE3.837e-1933.79Carbon catabolite-derepressing protein kinase OS=S... [more]
sp|P00518|PHKG1_RABIT3.612e-1731.64Phosphorylase b kinase gamma catalytic chain, skel... [more]
sp|Q852Q0|OSK3_ORYSJ1.059e-1629.68Serine/threonine protein kinase OSK3 OS=Oryza sati... [more]
sp|A2XFF4|OSK3_ORYSI1.059e-1629.68Serine/threonine protein kinase OSK3 OS=Oryza sati... [more]
sp|Q852Q1|OSK4_ORYSJ1.077e-1629.68Serine/threonine protein kinase OSK4 OS=Oryza sati... [more]
back to top
BLAST of NUAK family kinase 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1JRD04.450e-2235.43Protein kinase domain-containing protein OS=Tetran... [more]
R7TDR33.176e-2135.16Protein kinase domain-containing protein OS=Capite... [more]
A0A131YI444.976e-2131.25Phosphorylase kinase gamma subunit OS=Rhipicephalu... [more]
A0A224YVY55.011e-2131.25Phosphorylase kinase gamma subunit OS=Rhipicephalu... [more]
A0A131YKF95.011e-2131.25Phosphorylase kinase gamma subunit OS=Rhipicephalu... [more]
back to top
BLAST of NUAK family kinase 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phkg21.069e-1629.94phosphorylase kinase catalytic subunit gamma 2 [So... [more]
phkg21.069e-1629.94phosphorylase kinase catalytic subunit gamma 2 [So... [more]
sik11.720e-1627.03serine/threonine-protein kinase SIK2-like [Source:... [more]
sik11.817e-1627.03serine/threonine-protein kinase SIK2-like [Source:... [more]
nuak1a3.553e-1644.32NUAK family kinase 1 [Source:NCBI gene;Acc:1030296... [more]
back to top
BLAST of NUAK family kinase 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk17b1.295e-1730.65serine/threonine kinase 17b (apoptosis-inducing) [... [more]
phkg1b2.104e-1627.27phosphorylase kinase, gamma 1b (muscle) [Source:ZF... [more]
rps6ka57.587e-1531.82ribosomal protein S6 kinase, polypeptide 5 [Source... [more]
ENSPMAT00000006410.11.187e-1431.52pep scaffold:Pmarinus_7.0:GL476370:17405:31068:-1 ... [more]
MARK32.042e-1431.82microtubule affinity regulating kinase 3 [Source:H... [more]
back to top
BLAST of NUAK family kinase 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KIN12.838e-1535.21Serine/threonine protein kinase involved in regula... [more]
PKH25.623e-1440.00Serine/threonine protein kinase; involved in sphin... [more]
HSL11.193e-1330.00Nim1p-related protein kinase; septin-binding kinas... [more]
RIM151.386e-1327.06Protein kinase involved in cell proliferation in r... [more]
KCC41.426e-1323.67Protein kinase of the bud neck involved in the sep... [more]
back to top
BLAST of NUAK family kinase 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO347071.072e-1532.73Serine/threonine-protein kinase PLK4 [Source:UniP... [more]
EDO371435.559e-1537.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361692.174e-1430.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO307684.697e-1428.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378275.343e-1333.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NUAK family kinase 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nuak22.782e-1846.59NUAK family kinase 2 [Source:NCBI gene;Acc:1011654... [more]
nuak22.805e-1846.59NUAK family kinase 2 [Source:NCBI gene;Acc:1011654... [more]
nuak22.875e-1846.59NUAK family kinase 2 [Source:NCBI gene;Acc:1011654... [more]
sik14.853e-1629.45serine/threonine-protein kinase SIK2-like [Source:... [more]
sik14.853e-1629.45serine/threonine-protein kinase SIK2-like [Source:... [more]
back to top
BLAST of NUAK family kinase 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000054249.11.633e-137100.00SMESG000054249.1[more]
SMESG000038340.13.243e-2328.65SMESG000038340.1[more]
SMESG000038340.13.638e-2328.65SMESG000038340.1[more]
SMESG000038340.11.826e-2128.65SMESG000038340.1[more]
SMESG000031831.13.537e-2033.66SMESG000031831.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032412 ID=SMED30032412|Name=NUAK family kinase 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1540bp
TGTCACATGAACTAAAGACACGTTGTAAATGCAAATTTTCATGGATACTT
GTTTTAATCACTATCAAGATATAATAAAAATTTAAACCTTAATAATGAAC
TCAATTTTCATTTCTGGTCGAAAAGTAAAGCAAAAGCGAATTTCAAGCTA
TTTATACCACTACATTGATGCATGATAGATATCGAATATAGTCGGCCGGT
TTTAGCAATTGCAAGCGTGTATGCGTATCCATTTTCTTGCTGACAATTAT
CCATGTTGATAGTGTGTAGTCTTCAGCTTGTATTCTTCTCAATCGACAAG
TTTGTAGACATGCAAGTCGTCTTCAGGAGAAATATGAGTCAATTACTTGA
GTACTGTTTTGGTAGCTCAGTATTATCATTCTGCATTTGCCCAACTGCAA
TGCAAGCGATGGAGAATTTATCGATCCACACCATTTGACGAAAACACAAA
TGCGGTATTTGTATGGTGAAAGCATATATCAAATCAAGCCTTTCCTCAAC
CGTTAATTCGTATTTCAACGACAGCATGTGTGTTATATGCTCATCAACCA
TTCGAAATGAATTTACCATACGCATTGAGCCCTCAGTACAGTTGGAATAT
ATACAGAAAAATGAAAAATATTAATTTTTCAAGTAACCAAGTAAAATTCA
TTCAGTTTCCACTAAAATTTTGTGAAAAATATCATATAATTGAAAGCTTT
TACTTCTCTCGAAAATCTACAATATATCTCTGCGAAGACAAAATACTTAA
AAATAAATCTGTTGCTAAAGTCTACGATCTGATTAACAATAAGGAAATAT
CGGCCTATCTAAAAAGGAATGCCGAAACTGAAATAGGCATTTTGAACCTG
TGTTCTATTTGGCCTTTCATAATGGACATTTGTGAATATTTCCTGAACCA
ATACTCCATAATCATCGTCATGGAATACTGCTCAAATGGGGACTTGTCAT
TGTATTCAAAAGAGTTTGGCAATTTGTCCGAGATGAAAGTCAAAACGATA
ATGTGGCAATTGCTTCAAGCGATTTGTTTTCTTCATAAGAACGAAATCAT
CCACGGTGACATCAAGTTGGAAAACATTCTACTGGATGATCTGTTCTATC
TGAAATTGATAGATTTCGAAATTTCGTCACGCATCATTGACTTTGATAAA
AGAAATTTAGTCCGAGGCACTTTGATATATTTCTCCCGGAAATGGCACTG
AAAGTTTTAAATAAAGAAAACATAGATAAACCATCAGATATTTGGTCGGC
TGGAATTATTATGCCTATTTTAGTGATTGGAAATCTTCCTTTCGATGAGG
AGAATACCAGATTTTGATGTGTCAAAAGGTGCGATTGATTTGGTAAGTTT
TTACAAACAATTATGTATTGCTTTTTTTCATATAATCTTTTTCCCGATGT
CGAAAATGTTGAAATTTAATCCCAAGAAAAGAATTACGGCCAAAAAAGCT
TTAAAACATAATTTCTTTTGGTGTTTCAGATGAAAGTGAGGCAAAATATT
AACAAAATATAATAATTAATCCTTCATCATAACCTTTGGA
back to top

protein sequence of SMED30032412-orf-1

>SMED30032412-orf-1 ID=SMED30032412-orf-1|Name=SMED30032412-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=215bp
MNLPYALSPQYSWNIYRKMKNINFSSNQVKFIQFPLKFCEKYHIIESFYF
SRKSTIYLCEDKILKNKSVAKVYDLINNKEISAYLKRNAETEIGILNLCS
IWPFIMDICEYFLNQYSIIIVMEYCSNGDLSLYSKEFGNLSEMKVKTIMW
QLLQAICFLHKNEIIHGDIKLENILLDDLFYLKLIDFEISSRIIDFDKRN
LVRGTLIYFSRKWH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0001650fibrillar center
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0015630microtubule cytoskeleton
Vocabulary: molecular function
TermDefinition
GO:0002039p53 binding
GO:0004674protein serine/threonine kinase activity
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0030155regulation of cell adhesion
GO:0035507regulation of myosin-light-chain-phosphatase activity
GO:2000772regulation of cellular senescence
GO:0006468protein phosphorylation
GO:0016310phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 48..214
e-value: 7.2E-8
score: -22.8
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 54..210
e-value: 1.8E-27
score: 96.4
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 42..214
score: 20.542
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 37..212
e-value: 4.9E-32
score: 113.3
NoneNo IPR availablePANTHERPTHR24347SERINE/THREONINE-PROTEIN KINASEcoord: 25..208
NoneNo IPR availablePANTHERPTHR24347:SF412CALCIUM/CALMODULIN DEPENDENT PROTEIN KINASE Icoord: 25..208
NoneNo IPR availableCDDcd00180PKccoord: 54..205
e-value: 9.15175E-31
score: 110.438
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 164..176
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 37..210