Mitogen-activated protein kinase kinase kinase 3

Overview
NameMitogen-activated protein kinase kinase kinase 3
Smed IDSMED30032406
Length (bp)6484
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mitogen-activated protein kinase kinase kinase 3 (SMED30032406) t-SNE clustered cells

Violin plots show distribution of expression levels for Mitogen-activated protein kinase kinase kinase 3 (SMED30032406) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mitogen-activated protein kinase kinase kinase 3 (SMED30032406) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mitogen-activated protein kinase kinase kinase 3 (SMED30032406) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 290.812 bits (743), Expect = 1.093e-83
Identity = 220/616 (35.71%), Postives = 323/616 (52.44%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILV-------TSNIPH-------RV-ASSSVSD----------YSIHKSYHTR-PG--SPPPGYLHPNDVHVERSTSFPISHVDGEFIPEDDA---IXXXXXXXXXXXXXXXXLIDTNWGGSGRRQKLSNLKSHSELPDEPGIHQQKI-------GTFPLRVHPSTYTK--PEGRQTLPHIRNSE--MFQQIIXXXXXXXXXXXXXF---YLP------------SLMLDKTMTKSKAPSL-VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNF--AMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEP-----ISREMEAFIDQMFISIPQERATAESLLSCAF 1784
            +R+KFE + + R ++  RPVK+E++  K+++         LHY+N    I   + NQ +L++ +  +D ++  +SLRIL+        S+ PH       R+ AS S  D           S H S  ++ PG  SPPPGY+     H+ R  S+   + +GEFIPE      +    S ++S S S QSL  +    S R+ ++S  +S  +   E    + ++       GT+P R H S + K   +GR+T P IR  +  +F  + SS   +++  +      YL             +L + +    +K+PS  +++++G LLG+G FG+VY C D ++GRE A K+V     +   S    K+   LE EI + K L  H+RIVQYYG  RD     + IFMEYM GGSVKDQL+ YG L   V  KYT+QIL+G+++LH  +I+HRDIK ANILRD  GNVKL DFGAS+ L++I +              S  G         + S  GT Y+M+PEVI GE Y   AD+WSLG TVVEMLT  PP+ + E  AA+++IA       +P  P     IS     F+ ++F+   Q R +AE LL+  F
Sbjct:   45 VRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLD--LHYMNNELSIL--LKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNHNSSSPHSGVSRQVRIKASQSAGDINTIYQPPEPRSRHLSVSSQNPGRSSPPPGYVPERQQHIARQGSYTSINSEGEFIPETSEQCMLDPLSSAENSLSGSCQSLDRSADSPSFRKSRMSRAQSFPDNRQEYSDRETQLYDKGVKGGTYPRRYHVSVHHKDYSDGRRTFPRIRRHQGNLFTLVPSSRSLSTNGENMGLAVQYLDPRGRLRSADSENALSVQERNVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELASKQV----QFDPDSPETSKEVSALECEIQLLKNLQ-HERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICM--------------SGTG---------MRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIAT------QPTNPQLPSHISEHGRDFLRRIFVEARQ-RPSAEELLTHHF 621          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 290.426 bits (742), Expect = 1.219e-83
Identity = 216/615 (35.12%), Postives = 320/615 (52.03%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILV-------TSNIPH-------RV-ASSSVSD----------YSIHKSYHTR-PG--SPPPGYLHPNDVHVERSTSFPISHVDGEFIPE--DDAIXXXXXXXXXXXXXXXXLIDTNWGGSGRRQKLSNLKSHSELPDEPGIHQQKI-------GTFPLRVHPSTYTK--PEGRQTLPHIRNSE--MFQQIIXXXXXXXXXXXXXF---YLP------------SLMLDKTMTKSKAPSL-VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNF--AMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEP-----ISREMEAFIDQMFISIPQERATAESLLSCAF 1784
            +R+KFE + + R ++  RPVK+E++  K+++         LHY+N    I   + NQ +L++ +  +D ++  +SLRIL+        S+ PH       R+ AS S  D           S H S  ++ PG  SPPPGY+     H+ R  S+   + +GEFIPE  +  +    S   +  S     +D+    S R+ ++S  +S  +   E    + ++       GT+P R H S + K   +GR+T P IR  +  +F  + SS   +++  +      YL             +L + +    +K+PS  +++++G LLG+G FG+VY C D ++GRE A K+V     +   S    K+   LE EI + K L  H+RIVQYYG  RD     + IFMEYM GGSVKDQL+ YG L   V  KYT+QIL+G+++LH  +I+HRDIK ANILRD  GNVKL DFGAS+ L++I +              S  G         + S  GT Y+M+PEVI GE Y   AD+WSLG TVVEMLT  PP+ + E  AA+++IA       +P  P     IS     F+ ++F+   Q R +AE LL+  F
Sbjct:   45 VRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLD--LHYMNNELSIL--LKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNHNSSSPHSGVSRQVRIKASQSAGDINTIYQPPEPRSRHLSVSSQNPGRSSPPPGYVPERQQHIARQGSYTSINSEGEFIPETSEQCMLDPLSSAENSLSGSCQSLDSP---SFRKSRMSRAQSFPDNRQEYSDRETQLYDKGVKGGTYPRRYHVSVHHKDYSDGRRTFPRIRRHQGNLFTLVPSSRSLSTNGENMGLAVQYLDPRGRLRSADSENALSVQERNVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELASKQV----QFDPDSPETSKEVSALECEIQLLKNLQ-HERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICM--------------SGTG---------MRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIAT------QPTNPQLPSHISEHGRDFLRRIFVEARQ-RPSAEELLTHHF 617          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 290.812 bits (743), Expect = 1.717e-83
Identity = 216/615 (35.12%), Postives = 320/615 (52.03%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILV-------TSNIPH-------RV-ASSSVSD----------YSIHKSYHTR-PG--SPPPGYLHPNDVHVERSTSFPISHVDGEFIPE--DDAIXXXXXXXXXXXXXXXXLIDTNWGGSGRRQKLSNLKSHSELPDEPGIHQQKI-------GTFPLRVHPSTYTK--PEGRQTLPHIRNSE--MFQQIIXXXXXXXXXXXXXF---YLP------------SLMLDKTMTKSKAPSL-VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNF--AMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEP-----ISREMEAFIDQMFISIPQERATAESLLSCAF 1784
            +R+KFE + + R ++  RPVK+E++  K+++         LHY+N    I   + NQ +L++ +  +D ++  +SLRIL+        S+ PH       R+ AS S  D           S H S  ++ PG  SPPPGY+     H+ R  S+   + +GEFIPE  +  +    S   +  S     +D+    S R+ ++S  +S  +   E    + ++       GT+P R H S + K   +GR+T P IR  +  +F  + SS   +++  +      YL             +L + +    +K+PS  +++++G LLG+G FG+VY C D ++GRE A K+V     +   S    K+   LE EI + K L  H+RIVQYYG  RD     + IFMEYM GGSVKDQL+ YG L   V  KYT+QIL+G+++LH  +I+HRDIK ANILRD  GNVKL DFGAS+ L++I +              S  G         + S  GT Y+M+PEVI GE Y   AD+WSLG TVVEMLT  PP+ + E  AA+++IA       +P  P     IS     F+ ++F+   Q R +AE LL+  F
Sbjct:   76 VRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLD--LHYMNNELSIL--LKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNHNSSSPHSGVSRQVRIKASQSAGDINTIYQPPEPRSRHLSVSSQNPGRSSPPPGYVPERQQHIARQGSYTSINSEGEFIPETSEQCMLDPLSSAENSLSGSCQSLDSP---SFRKSRMSRAQSFPDNRQEYSDRETQLYDKGVKGGTYPRRYHVSVHHKDYSDGRRTFPRIRRHQGNLFTLVPSSRSLSTNGENMGLAVQYLDPRGRLRSADSENALSVQERNVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELASKQV----QFDPDSPETSKEVSALECEIQLLKNLQ-HERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICM--------------SGTG---------MRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIAT------QPTNPQLPSHISEHGRDFLRRIFVEARQ-RPSAEELLTHHF 648          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 290.812 bits (743), Expect = 1.786e-83
Identity = 220/616 (35.71%), Postives = 323/616 (52.44%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILV-------TSNIPH-------RV-ASSSVSD----------YSIHKSYHTR-PG--SPPPGYLHPNDVHVERSTSFPISHVDGEFIPEDDA---IXXXXXXXXXXXXXXXXLIDTNWGGSGRRQKLSNLKSHSELPDEPGIHQQKI-------GTFPLRVHPSTYTK--PEGRQTLPHIRNSE--MFQQIIXXXXXXXXXXXXXF---YLP------------SLMLDKTMTKSKAPSL-VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNF--AMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEP-----ISREMEAFIDQMFISIPQERATAESLLSCAF 1784
            +R+KFE + + R ++  RPVK+E++  K+++         LHY+N    I   + NQ +L++ +  +D ++  +SLRIL+        S+ PH       R+ AS S  D           S H S  ++ PG  SPPPGY+     H+ R  S+   + +GEFIPE      +    S ++S S S QSL  +    S R+ ++S  +S  +   E    + ++       GT+P R H S + K   +GR+T P IR  +  +F  + SS   +++  +      YL             +L + +    +K+PS  +++++G LLG+G FG+VY C D ++GRE A K+V     +   S    K+   LE EI + K L  H+RIVQYYG  RD     + IFMEYM GGSVKDQL+ YG L   V  KYT+QIL+G+++LH  +I+HRDIK ANILRD  GNVKL DFGAS+ L++I +              S  G         + S  GT Y+M+PEVI GE Y   AD+WSLG TVVEMLT  PP+ + E  AA+++IA       +P  P     IS     F+ ++F+   Q R +AE LL+  F
Sbjct:   76 VRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLD--LHYMNNELSIL--LKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNHNSSSPHSGVSRQVRIKASQSAGDINTIYQPPEPRSRHLSVSSQNPGRSSPPPGYVPERQQHIARQGSYTSINSEGEFIPETSEQCMLDPLSSAENSLSGSCQSLDRSADSPSFRKSRMSRAQSFPDNRQEYSDRETQLYDKGVKGGTYPRRYHVSVHHKDYSDGRRTFPRIRRHQGNLFTLVPSSRSLSTNGENMGLAVQYLDPRGRLRSADSENALSVQERNVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELASKQV----QFDPDSPETSKEVSALECEIQLLKNLQ-HERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICM--------------SGTG---------MRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIAT------QPTNPQLPSHISEHGRDFLRRIFVEARQ-RPSAEELLTHHF 652          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 290.812 bits (743), Expect = 1.786e-83
Identity = 220/616 (35.71%), Postives = 323/616 (52.44%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILV-------TSNIPH-------RV-ASSSVSD----------YSIHKSYHTR-PG--SPPPGYLHPNDVHVERSTSFPISHVDGEFIPEDDA---IXXXXXXXXXXXXXXXXLIDTNWGGSGRRQKLSNLKSHSELPDEPGIHQQKI-------GTFPLRVHPSTYTK--PEGRQTLPHIRNSE--MFQQIIXXXXXXXXXXXXXF---YLP------------SLMLDKTMTKSKAPSL-VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNF--AMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEP-----ISREMEAFIDQMFISIPQERATAESLLSCAF 1784
            +R+KFE + + R ++  RPVK+E++  K+++         LHY+N    I   + NQ +L++ +  +D ++  +SLRIL+        S+ PH       R+ AS S  D           S H S  ++ PG  SPPPGY+     H+ R  S+   + +GEFIPE      +    S ++S S S QSL  +    S R+ ++S  +S  +   E    + ++       GT+P R H S + K   +GR+T P IR  +  +F  + SS   +++  +      YL             +L + +    +K+PS  +++++G LLG+G FG+VY C D ++GRE A K+V     +   S    K+   LE EI + K L  H+RIVQYYG  RD     + IFMEYM GGSVKDQL+ YG L   V  KYT+QIL+G+++LH  +I+HRDIK ANILRD  GNVKL DFGAS+ L++I +              S  G         + S  GT Y+M+PEVI GE Y   AD+WSLG TVVEMLT  PP+ + E  AA+++IA       +P  P     IS     F+ ++F+   Q R +AE LL+  F
Sbjct:   76 VRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLD--LHYMNNELSIL--LKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNHNSSSPHSGVSRQVRIKASQSAGDINTIYQPPEPRSRHLSVSSQNPGRSSPPPGYVPERQQHIARQGSYTSINSEGEFIPETSEQCMLDPLSSAENSLSGSCQSLDRSADSPSFRKSRMSRAQSFPDNRQEYSDRETQLYDKGVKGGTYPRRYHVSVHHKDYSDGRRTFPRIRRHQGNLFTLVPSSRSLSTNGENMGLAVQYLDPRGRLRSADSENALSVQERNVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELASKQV----QFDPDSPETSKEVSALECEIQLLKNLQ-HERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICM--------------SGTG---------MRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIAT------QPTNPQLPSHISEHGRDFLRRIFVEARQ-RPSAEELLTHHF 652          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Celegans
Match: cst-2 (Caenorhabditis STE20-like kinase [Source:UniProtKB/TrEMBL;Acc:Q304D8])

HSP 1 Score: 149.828 bits (377), Expect = 3.864e-38
Identity = 96/285 (33.68%), Postives = 133/285 (46.67%), Query Frame = 3
Query:  939 LGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQR-IVQYYGAKRDNFAMYIFMEYMSGGSVKDQLR-QYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            LG G +G V+K +  ESG   A+K+V            +  D + +  EI I ++  C  + +V+YYG+   +  ++I MEY   GS+ D +R +   L  + +    +  L+GL +LH    IHRDIKA NIL + DG  KL+DFG +  L                                 N+  GT ++MAPEVI    Y   ADIWSLG T +EM  G PPY D+ P  A++ I       +K  E  S E   FI    I  P+ER TA  L    FI
Sbjct:   41 LGEGSYGSVHKAIHRESGHVLAIKKV-----------PVDTDLQEIIKEISIMQQ--CKSKYVVKYYGSYFKHSDLWIVMEYCGAGSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHRDIKAGNILLNTDGIAKLADFGVAGQLTDTMAKR--------------------------NTVIGTPFWMAPEVIEEIGYDTKADIWSLGITAIEMAEGRPPYSDIHPMRAIFMIPTKPPPTFKKPEEWSSEFNDFIRSCLIKKPEERKTALRLCEHTFI 286          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 151.369 bits (381), Expect = 2.854e-37
Identity = 97/302 (32.12%), Postives = 150/302 (49.67%), Query Frame = 3
Query:  885 TMTKSKAPSLVDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVD-GNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            T   SK    V + K   +GRG FG+VYK +D+ +GR  A+K + L        +  + + E ++ EI +  +    Q + +Y+G+      ++I MEY+ GGS  D L + G L    +    ++IL+GL +LH +  IHRDIK AN+L D     VK+ D+G ++ L ++                              N+F GT +FMAPEV++GE YS  ADIWSLG T +E+  G PP+ DL P   L+ I        +  +  S+  + F++      P+ R +A +LL   FI
Sbjct:    2 TFANSKLDPEVIFTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDL--------EQAEDEIEDIQQEIQVLSQCDS-QYVTKYFGSFLKGSKLWIIMEYLGGGSALD-LTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIKGANVLLDRQTAAVKICDYGVAKPLDTVL---------------------------KANTFVGTPFFMAPEVVKGE-YSIEADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKNPPPVLQGSQ-WSKPFKEFVEMCLNKDPENRPSASTLLKHQFI 264          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 150.984 bits (380), Expect = 3.680e-37
Identity = 94/301 (31.23%), Postives = 148/301 (49.17%), Query Frame = 3
Query:  885 TMTKSKAPSLVDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            T   SK    V + K   +GRG FG+VYK +D+ +GR  A+K + L        +  + + E ++ EI +  +    Q + +Y+G+      ++I MEY+ GGS  D L + G L    +    ++IL+GL +LH +  IHRDIKAAN+L    G+VK++DFG +  L       +                          +F G+ ++MAPE+I+  SY   ADIWSLG T +E+  G PP+ DL P   L+ I        +  +  S+  + F++      P+ R +A +LL   FI
Sbjct:    2 TFANSKLDPEVIFTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDL--------EQAEDEIEDIQQEIQVLSQCDS-QYVTKYFGSFLKGSKLWIIMEYLGGGSALD-LTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKKRI--------------------------TFVGSPFWMAPELIKQSSYDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKNPPPVLQGSQ-WSKPFKEFVEMCLNKDPENRPSASTLLKHQFI 265          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Celegans
Match: cst-1 (Serine/threonine-protein kinase cst-1 Serine/threonine-protein kinase cst-1 37kDa subunit Serine/threonine-protein kinase cst-1 18kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:Q9NB31])

HSP 1 Score: 148.673 bits (374), Expect = 3.863e-37
Identity = 96/285 (33.68%), Postives = 133/285 (46.67%), Query Frame = 3
Query:  939 LGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQR-IVQYYGAKRDNFAMYIFMEYMSGGSVKDQLR-QYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            LG G +G V+K +  ESG   A+K+V            +  D + +  EI I ++  C  + +V+YYG+   +  ++I MEY   GS+ D +R +   L  + +    +  L+GL +LH    IHRDIKA NIL + DG  KL+DFG +  L                                 N+  GT ++MAPEVI    Y   ADIWSLG T +EM  G PPY D+ P  A++ I       +K  E  S E   FI    I  P+ER TA  L    FI
Sbjct:   41 LGEGSYGSVHKAIHRESGHVLAIKKV-----------PVDTDLQEIIKEISIMQQ--CKSKYVVKYYGSYFKHSDLWIVMEYCGAGSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHRDIKAGNILLNTDGIAKLADFGVAGQLTDTMAKR--------------------------NTVIGTPFWMAPEVIEEIGYDTKADIWSLGITAIEMAEGRPPYSDIHPMRAIFMIPTKPPPTFKKPEEWSSEFNDFIRSCLIKKPEERKTALRLCEHTFI 286          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Celegans
Match: cst-1 (Serine/threonine-protein kinase cst-1 Serine/threonine-protein kinase cst-1 37kDa subunit Serine/threonine-protein kinase cst-1 18kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:Q9NB31])

HSP 1 Score: 148.673 bits (374), Expect = 3.955e-37
Identity = 96/285 (33.68%), Postives = 133/285 (46.67%), Query Frame = 3
Query:  939 LGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQR-IVQYYGAKRDNFAMYIFMEYMSGGSVKDQLR-QYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            LG G +G V+K +  ESG   A+K+V            +  D + +  EI I ++  C  + +V+YYG+   +  ++I MEY   GS+ D +R +   L  + +    +  L+GL +LH    IHRDIKA NIL + DG  KL+DFG +  L                                 N+  GT ++MAPEVI    Y   ADIWSLG T +EM  G PPY D+ P  A++ I       +K  E  S E   FI    I  P+ER TA  L    FI
Sbjct:   41 LGEGSYGSVHKAIHRESGHVLAIKKV-----------PVDTDLQEIIKEISIMQQ--CKSKYVVKYYGSYFKHSDLWIVMEYCGAGSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHRDIKAGNILLNTDGIAKLADFGVAGQLTDTMAKR--------------------------NTVIGTPFWMAPEVIEEIGYDTKADIWSLGITAIEMAEGRPPYSDIHPMRAIFMIPTKPPPTFKKPEEWSSEFNDFIRSCLIKKPEERKTALRLCEHTFI 286          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334539)

HSP 1 Score: 153.68 bits (387), Expect = 1.210e-37
Identity = 94/289 (32.53%), Postives = 143/289 (49.48%), Query Frame = 3
Query:  921 YKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            Y K   +G+G  G VY  ++S +G E A+K++ L+          +   E + NEIL+ +E   H  +V Y  +   +  +++ MEY+ GGS+ D + +   +    +    +++LQ L FLH   +IHRDIK+ NIL  +DG+VKL+DFG                C+ +S   S              +  GT Y+MAPEV+  + Y    D+WSLG   +EM+ G PPY +  P  ALY IA   K E K  + +S   + F+DQ        RA+A  LL   F+
Sbjct:  430 YTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQ---------QPKKELIINEILVMRE-NKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTET-CMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGF---------------CAQISPEQSKR-----------TTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFL 681          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0081714)

HSP 1 Score: 153.68 bits (387), Expect = 1.210e-37
Identity = 94/289 (32.53%), Postives = 143/289 (49.48%), Query Frame = 3
Query:  921 YKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            Y K   +G+G  G VY  ++S +G E A+K++ L+          +   E + NEIL+ +E   H  +V Y  +   +  +++ MEY+ GGS+ D + +   +    +    +++LQ L FLH   +IHRDIK+ NIL  +DG+VKL+DFG                C+ +S   S              +  GT Y+MAPEV+  + Y    D+WSLG   +EM+ G PPY +  P  ALY IA   K E K  + +S   + F+DQ        RA+A  LL   F+
Sbjct:  430 YTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQ---------QPKKELIINEILVMRE-NKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTET-CMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGF---------------CAQISPEQSKR-----------TTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFL 681          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0081716)

HSP 1 Score: 153.68 bits (387), Expect = 1.210e-37
Identity = 94/289 (32.53%), Postives = 143/289 (49.48%), Query Frame = 3
Query:  921 YKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            Y K   +G+G  G VY  ++S +G E A+K++ L+          +   E + NEIL+ +E   H  +V Y  +   +  +++ MEY+ GGS+ D + +   +    +    +++LQ L FLH   +IHRDIK+ NIL  +DG+VKL+DFG                C+ +S   S              +  GT Y+MAPEV+  + Y    D+WSLG   +EM+ G PPY +  P  ALY IA   K E K  + +S   + F+DQ        RA+A  LL   F+
Sbjct:  430 YTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQ---------QPKKELIINEILVMRE-NKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTET-CMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGF---------------CAQISPEQSKR-----------TTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFL 681          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0081715)

HSP 1 Score: 153.68 bits (387), Expect = 1.210e-37
Identity = 94/289 (32.53%), Postives = 143/289 (49.48%), Query Frame = 3
Query:  921 YKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            Y K   +G+G  G VY  ++S +G E A+K++ L+          +   E + NEIL+ +E   H  +V Y  +   +  +++ MEY+ GGS+ D + +   +    +    +++LQ L FLH   +IHRDIK+ NIL  +DG+VKL+DFG                C+ +S   S              +  GT Y+MAPEV+  + Y    D+WSLG   +EM+ G PPY +  P  ALY IA   K E K  + +S   + F+DQ        RA+A  LL   F+
Sbjct:  430 YTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQ---------QPKKELIINEILVMRE-NKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTET-CMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGF---------------CAQISPEQSKR-----------TTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFL 681          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334544)

HSP 1 Score: 153.68 bits (387), Expect = 1.210e-37
Identity = 94/289 (32.53%), Postives = 143/289 (49.48%), Query Frame = 3
Query:  921 YKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            Y K   +G+G  G VY  ++S +G E A+K++ L+          +   E + NEIL+ +E   H  +V Y  +   +  +++ MEY+ GGS+ D + +   +    +    +++LQ L FLH   +IHRDIK+ NIL  +DG+VKL+DFG                C+ +S   S              +  GT Y+MAPEV+  + Y    D+WSLG   +EM+ G PPY +  P  ALY IA   K E K  + +S   + F+DQ        RA+A  LL   F+
Sbjct:  430 YTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQ---------QPKKELIINEILVMRE-NKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTET-CMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGF---------------CAQISPEQSKR-----------TTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFL 681          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 291.582 bits (745), Expect = 3.294e-84
Identity = 213/609 (34.98%), Postives = 308/609 (50.57%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILV--------TSNIPHRV-------ASSSVSDYSIH-------------KSYHTRPGSPPPGYLHPNDVHVERSTSFPISHVDGEFIPE--DDAIXXXXXXXXXXXXXXXXLIDTNWGG-SGRRQKLSNLKSHSELPDEPGIHQQKI--------GTFPLRVHPSTYTK--PEGRQTLPHIRNSEMFQQIIXXXXXXXXXXXXXFYLPSLMLDKTMTK---------SKAPSL-VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDN--FAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEP-----ISREMEAFIDQMFISIPQERATAESLLSCAF 1784
            +R+KFEF  + R L   RPV+FEE+ QK+ +         LHY+N   E+   + +Q +L++ +  +D ++  +S++I++        +S+  H V        S S  D S                S +T   SPPPGY+      + R  S+   + +GEFIPE  D  +    S   +  S     +D+N    S R+ +   +KS+ +   +    +  +        GT+P R H S + K   EGR+T P IR  +    + +      S   +   L S  L+ T ++          K+P+  V +++G LLG+G FG+VY C D ++GRE A K+V     +  +S    K+   LE EI + K L  H+RIVQYYG  RD+    + IFMEYM GGSVKDQL+ YG L   V  KYT+QIL+G+++LH  +I+HRDIK ANILRD  GNVKL DFGAS+ L++I           MSS               V S  GT Y+M+PEVI GE Y   AD+WSLG TVVEMLT  PP+ + E  AA+++IA       +P  P     IS     F+  +F+   + R +AE LL   F
Sbjct:   48 VRIKFEFCGERRILMFGRPVQFEEVQQKVKTFFGQQLD--LHYMN--NELSIPLRDQDDLDKAIDLLDRSSNMKSIKIMLLTQEQSNASSSSHHTVCKQVRIKTSQSTGDVSTAYQSSEPRGRHHSTSSQNTGRSSPPPGYVPERQQRIARQGSYTSINSEGEFIPETSDQCVLDPWSSAENSVSGSCQSLDSNSDSPSLRKSRTHRIKSYPDNRQDCSDRENHVYDKIVGKGGTYPRRYHVSMHHKDHSEGRRTFPRIRRPQ--GNLFTLVPSRRSLNGSEESLGSWQLENTQSRLRPQDRAVPHKSPTAPVTWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQV----HFDPASPETSKEVSALECEIQLLKNLH-HERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTI----------CMSSTG-------------VRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIAT------QPTNPQLPSHISEHTRDFLRCIFVEA-KYRPSAEELLRHPF 615          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 290.812 bits (743), Expect = 6.265e-84
Identity = 216/612 (35.29%), Postives = 312/612 (50.98%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILV--------TSNIPHRV-------ASSSVSDYSIH-------------KSYHTRPGSPPPGYLHPNDVHVERSTSFPISHVDGEFIPE--DDAIXXXXXXXXXXXXXXXXLIDTNWGG-SGRRQKLSNLKSHSELPD--------EPGIHQQ---KIGTFPLRVHPSTYTK--PEGRQTLPHIRNSEMFQQIIXXXXXXXXXXXXXFYLPSLMLDKTMTK---------SKAPSL-VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDN--FAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEP-----ISREMEAFIDQMFISIPQERATAESLLSCAF 1784
            +R+KFEF  + R L   RPV+FEE+ QK+ +         LHY+N   E+   + +Q +L++ +  +D ++  +S++I++        +S+  H V        S S  D S                S +T   SPPPGY+      + R  S+   + +GEFIPE  D  +    S   +  S     +D+N    S R+ +   +KS+   PD        E  ++ +   K GT+P R H S + K   EGR+T P IR  +    + +      S   +   L S  L+ T ++          K+P+  V +++G LLG+G FG+VY C D ++GRE A K+V     +  +S    K+   LE EI + K L  H+RIVQYYG  RD+    + IFMEYM GGSVKDQL+ YG L   V  KYT+QIL+G+++LH  +I+HRDIK ANILRD  GNVKL DFGAS+ L++I +              S+ G         V S  GT Y+M+PEVI GE Y   AD+WSLG TVVEMLT  PP+ + E  AA+++IA       +P  P     IS     F+  +F+   + R +AE LL   F
Sbjct:   54 VRIKFEFCGERRILMFGRPVQFEEVQQKVKTFFGQQLD--LHYMN--NELSIPLRDQDDLDKAIDLLDRSSNMKSIKIMLLTQEQSNASSSSHHTVCKQVRIKTSQSTGDVSTAYQSSEPRGRHHSTSSQNTGRSSPPPGYVPERQQRIARQGSYTSINSEGEFIPETSDQCVLDPWSSAENSVSGSCQSLDSNSDSPSLRKSRTHRIKSY---PDNRQDCSDRENHVYDKIVGKGGTYPRRYHVSMHHKDHSEGRRTFPRIRRPQ--GNLFTLVPSRRSLNGSEESLGSWQLENTQSRLRPQDRAVPHKSPTAPVTWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQV----HFDPASPETSKEVSALECEIQLLKNLH-HERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICM--------------SSTG---------VRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIAT------QPTNPQLPSHISEHTRDFLRCIFVEA-KYRPSAEELLRHPF 621          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 278.87 bits (712), Expect = 4.229e-80
Identity = 207/598 (34.62%), Postives = 301/598 (50.33%), Query Frame = 3
Query:  165 RALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILV--------TSNIPHRV-------ASSSVSDYSIH-------------KSYHTRPGSPPPGYLHPNDVHVERSTSFPISHVDGEFIPE--DDAIXXXXXXXXXXXXXXXXLIDTNWGG-SGRRQKLSNLKSHSELPDEPGIHQQKI--------GTFPLRVHPSTYTK--PEGRQTLPHIRNSEMFQQIIXXXXXXXXXXXXXFYLPSLMLDKTMTK---------SKAPSL-VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDN--FAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEP-----ISREMEAFIDQMFISIPQERATAESLLSCAF 1784
            R L   RPV+FEE+ QK+ +         LHY+N   E+   + +Q +L++ +  +D ++  +S++I++        +S+  H V        S S  D S                S +T   SPPPGY+      + R  S+   + +GEFIPE  D  +    S   +  S     +D+N    S R+ +   +KS+ +   +    +  +        GT+P R H S + K   EGR+T P IR  +    + +      S   +   L S  L+ T ++          K+P+  V +++G LLG+G FG+VY C D ++GRE A K+V     +  +S    K+   LE EI + K L  H+RIVQYYG  RD+    + IFMEYM GGSVKDQL+ YG L   V  KYT+QIL+G+++LH  +I+HRDIK ANILRD  GNVKL DFGAS+ L++I +              S+ G         V S  GT Y+M+PEVI GE Y   AD+WSLG TVVEMLT  PP+ + E  AA+++IA       +P  P     IS     F+  +F+   + R +AE LL   F
Sbjct:   47 RILMFGRPVQFEEVQQKVKTFFGQQLD--LHYMN--NELSIPLRDQDDLDKAIDLLDRSSNMKSIKIMLLTQEQSNASSSSHHTVCKQVRIKTSQSTGDVSTAYQSSEPRGRHHSTSSQNTGRSSPPPGYVPERQQRIARQGSYTSINSEGEFIPETSDQCVLDPWSSAENSVSGSCQSLDSNSDSPSLRKSRTHRIKSYPDNRQDCSDRENHVYDKIVGKGGTYPRRYHVSMHHKDHSEGRRTFPRIRRPQ--GNLFTLVPSRRSLNGSEESLGSWQLENTQSRLRPQDRAVPHKSPTAPVTWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQV----HFDPASPETSKEVSALECEIQLLKNLH-HERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICM--------------SSTG---------VRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIAT------QPTNPQLPSHISEHTRDFLRCIFVEA-KYRPSAEELLRHPF 603          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 272.322 bits (695), Expect = 1.154e-77
Identity = 216/621 (34.78%), Postives = 306/621 (49.28%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILVT--SNIPHRVASSSV---------SDYSIHK---------SYHTRPGSPPPGYLHPNDVHVERSTSFPISHVDGEFIPED-----DAIXXXXXXXXXX---XXXXXXLIDTNWGGSGRRQKLSNLKSHSELP--DEPGIHQQ-KIGTFPLRVH-P---STYTKPEGRQTLPHIRNSEM--FQQIIXXXXXXXXXXXXXFYL------------------------PSLMLDKTMTKSKAP-SLVDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNF--AMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEP-----ISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            +RVKFE+  + R L  PRPV  E+L  K   +        LHY N   E+   ++ Q +L++ V  +D +   +SL+IL+   S   + V+S  +         +D+S            S  T   SPPPGY+      V R+ SF   + +GEFIPE      D +S S   +S+     S    L    +  S   + LS   +H E P  D P   +  K GT+P R H P     Y+  +GR+T P  R ++   F+  +S S     + S +                           P+L +      S++P +  +++ G LLG+G FG+V+ C D+++GRE A+K+V     +   S    K+   LE EI + K L  H+RIVQYYG  RD     + IFMEYM GGS+KDQL+ YG L   V  KYT+QIL+G+ +LH  +I+HRDIK ANILRD  GNVKL DFGASR L++I +              S  G         + S  GT Y+M+PEVI GE Y   ADIWS+G TVVEMLT  PP+ + E  AA+++IA       +P  P     +S     F+ ++F+   Q R  AE LL   F+
Sbjct:   43 VRVKFEYRGEKRILQFPRPVSLEDLSAKAKVAFGQSMD--LHYTN--NELVIPLSTQDDLDKAVELLDRSVHMKSLKILLVLPSWSQNCVSSKDLLPTHDILDNTDFSAPDKKSMLAHIGSQSTDRSSPPPGYIPDALQQVARNGSFTSINSEGEFIPESMDQMLDPLSMSSPENSASGSCPSLDSPLDSDTYPKSRMPRALSYPDNHQEFPEYDIPVFEKTGKGGTYPRRYHIPFGLQDYS--DGRKTFPRARRTQAHGFRSPVSFSPTEQQSPSTSSGSSIFTPELEEPGRRRRGSDIEPSSNPTLSVMDISPPSRSPRAPTNWRLGKLLGQGAFGRVFLCYDADTGRELAVKQVQ----FDPDSPETSKEVSALECEIQLLKNL-FHERIVQYYGCLRDTHEKTLSIFMEYMPGGSIKDQLKSYGALTENVTRKYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTICL--------------SGTG---------IKSVTGTPYWMSPEVISGEGYGRKADIWSIGCTVVEMLTQRPPWAEFEAMAAIFKIAT------QPTNPTLPPHVSDHCRDFLKRIFVETKQ-RPAAEDLLRHTFV 622          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 271.552 bits (693), Expect = 1.730e-77
Identity = 213/612 (34.80%), Postives = 300/612 (49.02%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRIL-VTSNIPHRVASS-------SVSDYSIHKSYHTRPG-----SPPPGYLHPNDVHVERSTSFPISHVDGEFIPED-----DAIXXXXXXXXXX---XXXXXXLIDTNWGGSGRRQKLSNLKSHSELP--DEPGIHQQ-KIGTFPLRVHPSTYTK--PEGRQTLPHIRNSEM--FQQIIXXXXXXXXXXXXXFYL------------------------PSLMLDKTMTKSKAP-SLVDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNF--AMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEP-----ISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            +RVKFE+  + R L  PRPV  E+L  K   +        LHY N   E+   ++ Q +L++ V  +D +   +SL+IL V  +      SS        + D +   S     G     SPPPGY+      V R+ SF   + +GEFIPE      D +S S   +S+     S    L    +  S   + LS   +H E P  D P   +  K GT+P R H     +   +GR+T P  R ++   F+  +S S     + S +                           P+L +      S++P +  +++ G LLG+G FG+V+ C D+++GRE A+K+V     +   S    K+   LE EI + K L  H+RIVQYYG  RD     + IFMEYM GGS+KDQL+ YG L   V  KYT+QIL+G+ +LH  +I+HRDIK ANILRD  GNVKL DFGASR L++I +              S  G         + S  GT Y+M+PEVI GE Y   ADIWS+G TVVEMLT  PP+ + E  AA+++IA       +P  P     +S     F+ ++F+   Q R  AE LL   F+
Sbjct:   42 VRVKFEYRGEKRILQFPRPVSLEDLSAKAKVAFGQSMD--LHYTN--NELVIPLSTQDDLDKAVELLDRSVHMKSLKILLVLPSWSQNCVSSKDLLPTHDILDNTDFSSMLAHIGGLHLDSPPPGYIPDALQQVARNGSFTSINSEGEFIPESMDQMLDPLSMSSPENSASGSCPSLDSPLDSDTYPKSRMPRALSYPDNHQEFPEYDIPVFEKTGKGGTYPRRYHIPFGLQDYSDGRKTFPRARRTQAHGFRSPVSFSPTEQQSPSTSSGSSIFTPELEEPGRRRRGSDIEPSSNPTLSVMDISPPSRSPRAPTNWRLGKLLGQGAFGRVFLCYDADTGRELAVKQVQ----FDPDSPETSKEVSALECEIQLLKNL-FHERIVQYYGCLRDTHEKTLSIFMEYMPGGSIKDQLKSYGALTENVTRKYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTICL--------------SGTG---------IKSVTGTPYWMSPEVISGEGYGRKADIWSIGCTVVEMLTQRPPWAEFEAMAAIFKIAT------QPTNPTLPPHVSDHCRDFLKRIFVETKQ-RPAAEDLLRHTFV 614          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Xenopus
Match: samd8 (sterile alpha motif domain containing 8 [Source:Xenbase;Acc:XB-GENE-1012742])

HSP 1 Score: 286.96 bits (733), Expect = 2.194e-82
Identity = 213/623 (34.19%), Postives = 311/623 (49.92%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILVTSNIPHRVASS--------------SVSDYSIH-------------KSYHTRPGSPPPGYLHPNDVHVERSTSFPISHVDGEFIPEDDAIXXXXXXXXXXXXXXXXLIDT------------NWGGSGRRQKLSNL------KSHSELPDEPGIHQQKIGTFPLRVHPSTYTKP--EGRQTLPHIRNSE--MFQQIIXXXXXXXXXXXXXFYLP---------------SLMLDKTMTKSKAPSL-VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNF--AMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEP-----ISREMEAFIDQMFISIPQERATAESLLSCAF 1784
            +R+KFE   + R L   RPVKFEE+ QK+ +         L+Y+N   E+   + +Q +L++ V  +D ++  +SLRIL+ S+  + ++SS              SV D S                S +T   SPPPGY+      + R  S+   + +GEFIPE +    S +   + ++S     D+              G +G R   +NL         ++  D  G    K GT+P R H S   K   +GR+T P IR  +  +F  + SS   +++  +    +                +L + +    SK+PS  +++++G LLG+G FG+VY C D ++GRE A K+V     +   S    K+   LE EI + K L  H RIVQYYG+ RD     + IFMEYM GGSVKDQL+ YG L   V  +YT+QIL+G+++LH  +I+HRDIK ANILRD  GNVKL DFGAS+ L++I +              S  G         + S  GT Y+M+PEVI GE Y   AD+WSLG TVVEMLT  PP+ + E  AA+++IA       +P  P      S +   F+ ++ +   Q R TAE L+   F
Sbjct:   45 VRIKFEHSGERRILQFSRPVKFEEVEQKVKNVFGQQLD--LYYMN--NELSIPLRSQDDLDKAVDLLDRSSSMKSLRILLLSHDKNHISSSHSGIQKQVRIKASQSVGDISTVYHPAEPRSRHLSVTSQNTGRSSPPPGYVPERQQRIARQGSYTSINSEGEFIPETNEQCVSCATMLTKTTSLDQSEDSPSFRKSRIHIILKCGWTGYRTYRNNLLCLFFSDRENQFSDRAG----KGGTYPRRYHVSIQHKEYNDGRRTFPRIRRPQGNLFTLVPSSRSLSTNGENLGLTVQYMENRGRLRNADSENTLTVQERNISSKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQV----QFDPDSPETSKEVSALECEIQLLKNLH-HDRIVQYYGSLRDKGEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICM--------------SGTG---------IRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIAT------QPTNPQLPPNTSEQCRDFVKRILVEARQ-RPTAEELIRHPF 624          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Xenopus
Match: samd8 (sterile alpha motif domain containing 8 [Source:Xenbase;Acc:XB-GENE-1012742])

HSP 1 Score: 282.722 bits (722), Expect = 3.670e-81
Identity = 207/605 (34.21%), Postives = 302/605 (49.92%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILVTSNIPHRVASS--------------SVSDYSIH-------------KSYHTRPGSPPPGYLHPNDVHVERSTSFPISHVDGEFIPEDDAIXXXXXXXXXXXXXXXXLIDTNWGGSGRRQKLSNLKSHSELPDEPGIHQQKIGTFPLRVHPSTYTKP--EGRQTLPHIRNSE--MFQQIIXXXXXXXXXXXXXFYLP---------------SLMLDKTMTKSKAPSL-VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNF--AMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEP-----ISREMEAFIDQMFISIPQERATAESLLSCAF 1784
            +R+KFE   + R L   RPVKFEE+ QK+ +         L+Y+N   E+   + +Q +L++ V  +D ++  +SLRIL+ S+  + ++SS              SV D S                S +T   SPPPGY+      + R  S+   + +GEFIPE +      + + +       L  +          L      ++  D  G    K GT+P R H S   K   +GR+T P IR  +  +F  + SS   +++  +    +                +L + +    SK+PS  +++++G LLG+G FG+VY C D ++GRE A K+V     +   S    K+   LE EI + K L  H RIVQYYG+ RD     + IFMEYM GGSVKDQL+ YG L   V  +YT+QIL+G+++LH  +I+HRDIK ANILRD  GNVKL DFGAS+ L++I +              S  G         + S  GT Y+M+PEVI GE Y   AD+WSLG TVVEMLT  PP+ + E  AA+++IA       +P  P      S +   F+ ++ +   Q R TAE L+   F
Sbjct:   45 VRIKFEHSGERRILQFSRPVKFEEVEQKVKNVFGQQLD--LYYMN--NELSIPLRSQDDLDKAVDLLDRSSSMKSLRILLLSHDKNHISSSHSGIQKQVRIKASQSVGDISTVYHPAEPRSRHLSVTSQNTGRSSPPPGYVPERQQRIARQGSYTSINSEGEFIPETNEQCHPCNRNENLFFRICILTPSYRTYRNNLLCLFFSDRENQFSDRAG----KGGTYPRRYHVSIQHKEYNDGRRTFPRIRRPQGNLFTLVPSSRSLSTNGENLGLTVQYMENRGRLRNADSENTLTVQERNISSKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQV----QFDPDSPETSKEVSALECEIQLLKNLH-HDRIVQYYGSLRDKGEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICM--------------SGTG---------IRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIAT------QPTNPQLPPNTSEQCRDFVKRILVEARQ-RPTAEELIRHPF 606          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Xenopus
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:100493570])

HSP 1 Score: 259.996 bits (663), Expect = 3.067e-73
Identity = 207/615 (33.66%), Postives = 305/615 (49.59%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILVTSNIPHRVASSSVSDY---------------SIHKSYHTRP--------GSPPPGYLHPNDVH-VERSTSFPISHVDGEFIPED-DAIXXXXXXXXXXXXXXXXLIDTNWGGSGRRQKLSNLKSHSELPDE---------PGIHQ-QKIGTFPLRVHPSTYTKP--EGRQTLPHIRNSE--MFQQIIXXXXXXXXXXXXXFYL--------------------PSLMLDKTMTKSKAP-SLVDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIK--KDAECLENEILIYKELTCHQRIVQYYGAKRDN--FAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAF 1784
            +RVKFE   + R L   RPV  E+LY K   +        LHY   N E+   +  Q +L++ V  +D +   +SL+IL+   +P    + ++ D                ++ K   T           SPPPGY+ P D+H V R+ SF   + +GEFIPE  D +    S  S  +S   S    +    G     S +      PD          P   +  K GT+P R H S + +   +GR+T P  R ++   F+  ++ S  + S ++++                       P+L +      S++P +  +++ G LLG+G FG+VY C D+++GRE A+K+V       +  D+++  K+   LE EI + K L  H+RIVQYYG  RD+    + IFMEYM GGS+KDQL+ YG L   V  KYT+QIL+G+ +LH  +I+HRDIK ANILRD  GNVKL DFGAS+ L++I +              S  G         + S  GT Y+M+PEVI GE Y   ADIWS+G TVVEMLT  PP+ + E  AA+++IA        P   +S     F+ ++F+   + R ++E LL   F
Sbjct:   51 VRVKFEHRGEKRILQFSRPVLLEDLYAKAKVAFGQCMD--LHY--SNNELVIPLKTQDDLDKAVELLDRSVHMKSLKILLV--LPGHTETDTLCDMEHMPSLEDLDNSVFATLDKKTKTSGIGAQTRDRSSPPPGYI-PEDLHQVVRNGSFTSINSEGEFIPESMDQMLDPLSLSSPENSGSGSCPSLDSPLDGDSYSKSRMPRAQSYPDNYQEFLEYDIPVFEKFGKGGTYPRRYHVSYHHQDYNDGRKTFPRARRTQGNSFRSPVNFSPTDHSLSTSSGSSVFTPEYEDGRLRRRGSDIDNPTLSVMDISPPSRSPRAPSNWRLGKLLGQGAFGRVYLCYDADTGRELAVKQV------QFDPDSLETSKEVNALECEIQLLKNL-LHERIVQYYGCLRDSQEKTLSIFMEYMPGGSIKDQLKAYGALTEFVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRLQTICL--------------SGTG---------MKSVTGTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPQLPAH-VSEHCRDFLKRIFVEA-KVRPSSEELLRHTF 626          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Xenopus
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:100493570])

HSP 1 Score: 254.603 bits (649), Expect = 1.007e-71
Identity = 202/590 (34.24%), Postives = 297/590 (50.34%), Query Frame = 3
Query:  171 LSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILVTSNIPHR--------VASSSVSDYSI--HKSYHTRP-GSPPPGYLHPNDVH-VERSTSFPISHVDGEFIPED-DAIXXXXXXXXXXXXXXXXLIDTNWGGSGRRQKLSNLKSHSELPDE---------PGIHQ-QKIGTFPLRVHPSTYTKP--EGRQTLPHIRNSE--MFQQIIXXXXXXXXXXXXXFYL--------------------PSLMLDKTMTKSKAP-SLVDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIK--KDAECLENEILIYKELTCHQRIVQYYGAKRDN--FAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAF 1784
            L   RPV  E+LY K   +        LHY   N E+   +  Q +L++ V  +D +   +SL+IL+   +P          ++   + +Y I       TR   SPPPGY+ P D+H V R+ SF   + +GEFIPE  D +    S  S  +S   S    +    G     S +      PD          P   +  K GT+P R H S + +   +GR+T P  R ++   F+  ++ S  + S ++++                       P+L +      S++P +  +++ G LLG+G FG+VY C D+++GRE A+K+V       +  D+++  K+   LE EI + K L  H+RIVQYYG  RD+    + IFMEYM GGS+KDQL+ YG L   V  KYT+QIL+G+ +LH  +I+HRDIK ANILRD  GNVKL DFGAS+ L++I +              S  G         + S  GT Y+M+PEVI GE Y   ADIWS+G TVVEMLT  PP+ + E  AA+++IA        P   +S     F+ ++F+   + R ++E LL   F
Sbjct:   46 LQFSRPVLLEDLYAKAKVAFGQCMD--LHY--SNNELVIPLKTQDDLDKAVELLDRSVHMKSLKILLVLPVPEHNNCPGLDCISHKHLDNYDIIAPACAQTRDRSSPPPGYI-PEDLHQVVRNGSFTSINSEGEFIPESMDQMLDPLSLSSPENSGSGSCPSLDSPLDGDSYSKSRMPRAQSYPDNYQEFLEYDIPVFEKFGKGGTYPRRYHVSYHHQDYNDGRKTFPRARRTQGNSFRSPVNFSPTDHSLSTSSGSSVFTPEYEDGRLRRRGSDIDNPTLSVMDISPPSRSPRAPSNWRLGKLLGQGAFGRVYLCYDADTGRELAVKQV------QFDPDSLETSKEVNALECEIQLLKNL-LHERIVQYYGCLRDSQEKTLSIFMEYMPGGSIKDQLKAYGALTEFVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRLQTICL--------------SGTG---------MKSVTGTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPQLPAH-VSEHCRDFLKRIFVEA-KVRPSSEELLRHTF 598          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Xenopus
Match: dennd1a (DENN domain containing 1A [Source:Xenbase;Acc:XB-GENE-5729862])

HSP 1 Score: 241.121 bits (614), Expect = 6.386e-67
Identity = 178/480 (37.08%), Postives = 249/480 (51.88%), Query Frame = 3
Query:  432 SYHTRPGSPPPGYLHPNDVHVERSTSFPISHVDGEFIPE--DDAIXXXXXXXXXXXXXXXXLIDTNWGGSGRRQKLSNLKSHSELPDEPGIHQQ--KIGTFPLRVHPSTYTKPEGRQTLPHIRNSEMFQQIIXXXXXXXXXXXXXFYLPSLMLDKTMTK--------------------SKAPSLVD-YKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRD--NFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFIT 1790
            S HT   SPPPG +      + R  S+   + +GEFIPE  D  IS ++S  SS  S  +SL    +     R K     S   L  E   +++  K GTFP + H S     +GR+T P  R+    + I   S   + + +    L  +  D+   K                    +K+P   + ++ G LLGRG FG+VY C D + GRE A+K+V    P+   S    K+   LE EI + K L  H+RIVQYYG  RD     + IF+EYM GGS+KDQL+ YG L   V  +YT+QILQG+++LH  +I+HRDIK ANILRD  GNVKL DFGAS+ +++I +              S  G         + S  GT Y+M+PEVI GE Y   AD+WS+  TVVEMLT  PP+ + E  AA+++IA T   + +  + +S     F+ Q+F+   + R TAE LL   F++
Sbjct:  168 SLHTGRSSPPPGSVPDEQQQIARQGSYTSINSEGEFIPEVIDPFISPNESLSSSCQSLDRSLDSPAFSTPVPRGKGQLNDSLDCLDFEIPFYERFGKGGTFPRQYHFSRKDYNDGRRTFP--RSYIPPENIFPLSSSRTRSVNGESGLVPMSCDEQRKKRWNSSEQGFPFFCSTSQEQNNKSPQAPENWRLGKLLGRGAFGEVYLCYDVDKGRELAVKQV----PFDPDSQETSKEVNALECEIQLLK-LHRHERIVQYYGCLRDPTERKLSIFVEYMPGGSIKDQLKAYGALTENVTRRYTRQILQGVSYLHGNMIVHRDIKGANILRDSAGNVKLGDFGASKRIQTICM--------------SGTG---------IKSVTGTPYWMSPEVISGEGYGRKADVWSVACTVVEMLTEKPPWSEYEAMAAIFKIA-TQPTKPRLPDTVSDACRDFMKQIFVE-EKRRPTAEELLRHLFVS 615          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Mouse
Match: Map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:MGI Symbol;Acc:MGI:1346874])

HSP 1 Score: 290.426 bits (742), Expect = 9.422e-84
Identity = 217/616 (35.23%), Postives = 319/616 (51.79%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILV-------TSNIPHRVASSSV------SDYSIHKSYHT-------------RPG--SPPPGYLHPNDVHVERSTSFPISHVDGEFIPEDDA---IXXXXXXXXXXXXXXXXLIDTNWGGSGRRQKLSNLKSHSELPDEPGIHQQKI-------GTFPLRVHPSTYTKP--EGRQTLPHIRNSE--MFQQIIXXXXXXXXXXXXXF---YLP------------SLMLDKTMTKSKAPSL-VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFA--MYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEP-----ISREMEAFIDQMFISIPQERATAESLLSCAF 1784
            +R+KFE + + R ++  RPV++E++  K+++         LHY+N    I   + NQ +L++ +  +D ++  +SLRIL+       TS+ PH   S  V      S   I+  Y                PG  SPPPGY+     H+ R  S+   + +GEFIPE      +    S ++S S S QSL  +    S R+ ++S  +S  +   E    + ++       GT+P R H S + K   +GR+T P IR  +  +F  + SS   +++  +      YL             +L + +    +K+PS  +++++G LLG+G FG+VY C D ++GRE A K+V     +   S    K+   LE EI + K L  H+RIVQYYG  RD     + IFMEYM GGSVKDQL+ YG L   V  KYT+QIL+G+++LH  +I+HRDIK ANILRD  GNVKL DFGAS+ L++I +              S  G         + S  GT Y+M+PEVI GE Y   AD+WSLG TVVEMLT  PP+ + E  AA+++IA       +P  P     IS     F+ ++F+   Q R +AE LL+  F
Sbjct:   45 VRIKFEHNGERRIIAFSRPVRYEDVEHKVTTVFGQPLD--LHYMNNELSIL--LKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNHTSSSPHSGVSRQVRIKPSQSAGDINTIYQAPEPRSRHLSVSSQNPGRSSPPPGYVPERQQHIARQGSYTSINSEGEFIPETSEQCMLDPLSSAENSLSGSCQSLDRSADSPSFRKSQMSRARSFPDNRKECSDRETQLYDKGVKGGTYPRRYHVSVHHKDYNDGRRTFPRIRRHQGNLFTLVPSSRSLSTNGENMGVAVQYLDPRGRLRSADSENALTVQERNVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELASKQV----QFDPDSPETSKEVSALECEIQLLKNLQ-HERIVQYYGCLRDRAEKILTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICM--------------SGTG---------IRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIAT------QPTNPQLPSHISEHGRDFLRRIFVEARQ-RPSAEELLTHHF 621          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Mouse
Match: Map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:MGI Symbol;Acc:MGI:1346873])

HSP 1 Score: 264.618 bits (675), Expect = 5.085e-75
Identity = 207/611 (33.88%), Postives = 306/611 (50.08%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILV-------TSNIPHRVASSSVSDYSIHKSYHTR----------PGSPPPGYLHPNDVH-VERSTSFPISHVDGEFIPED-DAIXXXXXXXXXXXXXXXXLIDTNWGGSGRRQKLSNLKSHSELPDEPGIHQQ-------------KIGTFPLRVHPSTYTKP--EGRQTLPHIRNSE--MFQQIIXXXXXXXXXXXXXFYL--------------------PSLMLDKTMTKSKAP-SLVDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRD--NFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            +RVKFE   + R L + RPVK E+L  K  S +     + LHY N   E+   +T Q +L++ V  +D +   +SL+IL+        +N+    +   +++  +      R            SPPPGY+ P+++H + R+ SF   + +GEFIPE  D +    S  S  +S   S    +    G     S +      PD    HQ+             K GT+P R H S + +   +GR+T P  R ++   F+  +S S  + S ++++                       P+L +      S++P +  +++ G LLG+G FG+VY C D ++GRE A+K+V     +   S    K+   LE EI + K L  H+RIVQYYG  RD     + IFMEYM GGS+KDQL+ YG L   V  KYT+QIL+G+ +LH  +I+HRDIK ANILRD  GN+KL DFGAS+ L++I +              S  G         + S  GT Y+M+PEVI GE Y   ADIWS+  TVVEMLT  PP+ + E  AA+++IA T     K    +S     F+ ++F+   + R +AE LL   F+
Sbjct:   44 VRVKFEHRGEKRILQVTRPVKLEDLRSK--SKIAFGQSMDLHYTN--NELVIPLTTQDDLDKAVELLDRSIHMKSLKILLVVNGSTQATNLEPSPSPEDLNNTPLGAERKKRLSVVGPPNRDRSSPPPGYI-PDELHQIARNGSFTSINSEGEFIPESMDQMLDPLSLSSPENSGSGSCPSLDSPLDGESYPKSRMPRAQSYPDN---HQEFTDYDNPIFEKFGKGGTYPRRYHVSYHHQEYNDGRKTFPRARRTQGTSFRSPVSFSPTDHSLSTSSGSSVFTPEYDDSRIRRRGSDIDNPTLTVTDISPPSRSPRAPTNWRLGKLLGQGAFGRVYLCYDVDTGRELAVKQVQ----FNPESPETSKEVNALECEIQLLKNL-LHERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNIKLGDFGASKRLQTICL--------------SGTG---------MKSVTGTPYWMSPEVISGEGYGRKADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIA-TQPTNPKLPPHVSDYTRDFLKRIFVEA-KLRPSAEELLRHMFV 616          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Mouse
Match: Map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:MGI Symbol;Acc:MGI:1203481])

HSP 1 Score: 159.458 bits (402), Expect = 2.486e-40
Identity = 102/305 (33.44%), Postives = 153/305 (50.16%), Query Frame = 3
Query:  879 DKTMTKSKAPSLVDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSD--AIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            DK++   +A   + + KG +LGRG +G VY C  +  G+  A+K+V L +     SD  A +K+   L+ E+ + K L  H  IV Y G   +   + IFME++ GGS+   + ++G LP  V  KYT+QILQG+A+LH   ++HRDIK  N++    G +KL DFG ++ L    ++                       S ++ S  GT Y+MAPEVI    Y   +DIWS+G TV EM TG PP   ++  AA++ I     +        S     F+         ER +A  LL  +F+
Sbjct:  237 DKSLNHEEA---IFWTKGEILGRGAYGTVY-CGLTSLGQLIAVKQVALDT-----SDKLATEKEYRKLQEEVDLLKALK-HVNIVAYLGTCLEENTLSIFMEFVPGGSISSIINRFGPLPEMVFCKYTRQILQGVAYLHDNCVVHRDIKGNNVMLMPTGIIKLIDFGCAKRLAWAGLNGT--------------------HSDMLKSMRGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPARFSEPAADFVRLCLTRDQHERPSALQLLKHSFL 511          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Mouse
Match: Map3k15 (mitogen-activated protein kinase kinase kinase 15 [Source:MGI Symbol;Acc:MGI:2448588])

HSP 1 Score: 159.073 bits (401), Expect = 2.958e-38
Identity = 108/295 (36.61%), Postives = 157/295 (53.22%), Query Frame = 3
Query:  936 LLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLR-QYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDV-DGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVI----RGESYSNSADIWSLGATVVEMLTGNPPYHDL-EPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFITSVS 1799
            +LG+G +G VY   D  +    A+KE+          +   + ++ L  EI ++K L  H+ IVQY G+  +N  + IFME + GGS+   LR ++G +    +  YTKQIL+GL +LH+  I+HRDIK  N+L +   G VK+SDFG S+ L  I+       C+                     +F GT  +MAPE+I    RG  Y   ADIWSLG T++EM T  PP+H+L EP AA++++    K+  +  E +S E  AFI   F   PQ+R TA  LL   F+  V+
Sbjct:  661 VLGKGSYGIVYAGRDLSNQVRIAIKEI---------PERDIRYSQPLHEEIALHKYLK-HRNIVQYLGSVSENGYIKIFMEQVPGGSLSALLRSKWGPMKEPTIKFYTKQILEGLKYLHENQIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLAGIN------PCT--------------------ETFTGTLQYMAPEIIDQGPRG--YGAPADIWSLGCTIIEMATSRPPFHELGEPQAAMFKVG-MFKIHPEIPEALSAEARAFILSCFEPDPQKRVTAADLLQEGFLRQVN 916          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Mouse
Match: Map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:MGI Symbol;Acc:MGI:1203481])

HSP 1 Score: 158.688 bits (400), Expect = 3.162e-38
Identity = 102/305 (33.44%), Postives = 153/305 (50.16%), Query Frame = 3
Query:  879 DKTMTKSKAPSLVDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSD--AIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            DK++   +A   + + KG +LGRG +G VY C  +  G+  A+K+V L +     SD  A +K+   L+ E+ + K L  H  IV Y G   +   + IFME++ GGS+   + ++G LP  V  KYT+QILQG+A+LH   ++HRDIK  N++    G +KL DFG ++ L    ++                       S ++ S  GT Y+MAPEVI    Y   +DIWS+G TV EM TG PP   ++  AA++ I     +        S     F+         ER +A  LL  +F+
Sbjct: 1033 DKSLNHEEA---IFWTKGEILGRGAYGTVY-CGLTSLGQLIAVKQVALDT-----SDKLATEKEYRKLQEEVDLLKALK-HVNIVAYLGTCLEENTLSIFMEFVPGGSISSIINRFGPLPEMVFCKYTRQILQGVAYLHDNCVVHRDIKGNNVMLMPTGIIKLIDFGCAKRLAWAGLNGT--------------------HSDMLKSMRGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPARFSEPAADFVRLCLTRDQHERPSALQLLKHSFL 1307          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. UniProt/SwissProt
Match: sp|Q99759|M3K3_HUMAN (Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP3K3 PE=1 SV=2)

HSP 1 Score: 290.812 bits (743), Expect = 5.249e-83
Identity = 220/616 (35.71%), Postives = 323/616 (52.44%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILV-------TSNIPH-------RV-ASSSVSD----------YSIHKSYHTR-PG--SPPPGYLHPNDVHVERSTSFPISHVDGEFIPEDDA---IXXXXXXXXXXXXXXXXLIDTNWGGSGRRQKLSNLKSHSELPDEPGIHQQKI-------GTFPLRVHPSTYTK--PEGRQTLPHIRNSE--MFQQIIXXXXXXXXXXXXXF---YLP------------SLMLDKTMTKSKAPSL-VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNF--AMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEP-----ISREMEAFIDQMFISIPQERATAESLLSCAF 1784
            +R+KFE + + R ++  RPVK+E++  K+++         LHY+N    I   + NQ +L++ +  +D ++  +SLRIL+        S+ PH       R+ AS S  D           S H S  ++ PG  SPPPGY+     H+ R  S+   + +GEFIPE      +    S ++S S S QSL  +    S R+ ++S  +S  +   E    + ++       GT+P R H S + K   +GR+T P IR  +  +F  + SS   +++  +      YL             +L + +    +K+PS  +++++G LLG+G FG+VY C D ++GRE A K+V     +   S    K+   LE EI + K L  H+RIVQYYG  RD     + IFMEYM GGSVKDQL+ YG L   V  KYT+QIL+G+++LH  +I+HRDIK ANILRD  GNVKL DFGAS+ L++I +              S  G         + S  GT Y+M+PEVI GE Y   AD+WSLG TVVEMLT  PP+ + E  AA+++IA       +P  P     IS     F+ ++F+   Q R +AE LL+  F
Sbjct:   45 VRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLD--LHYMNNELSIL--LKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNHNSSSPHSGVSRQVRIKASQSAGDINTIYQPPEPRSRHLSVSSQNPGRSSPPPGYVPERQQHIARQGSYTSINSEGEFIPETSEQCMLDPLSSAENSLSGSCQSLDRSADSPSFRKSRMSRAQSFPDNRQEYSDRETQLYDKGVKGGTYPRRYHVSVHHKDYSDGRRTFPRIRRHQGNLFTLVPSSRSLSTNGENMGLAVQYLDPRGRLRSADSENALSVQERNVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELASKQV----QFDPDSPETSKEVSALECEIQLLKNLQ-HERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICM--------------SGTG---------MRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIAT------QPTNPQLPSHISEHGRDFLRRIFVEARQ-RPSAEELLTHHF 621          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. UniProt/SwissProt
Match: sp|Q61084|M3K3_MOUSE (Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus OX=10090 GN=Map3k3 PE=1 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 6.591e-83
Identity = 217/616 (35.23%), Postives = 319/616 (51.79%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILV-------TSNIPHRVASSSV------SDYSIHKSYHT-------------RPG--SPPPGYLHPNDVHVERSTSFPISHVDGEFIPEDDA---IXXXXXXXXXXXXXXXXLIDTNWGGSGRRQKLSNLKSHSELPDEPGIHQQKI-------GTFPLRVHPSTYTKP--EGRQTLPHIRNSE--MFQQIIXXXXXXXXXXXXXF---YLP------------SLMLDKTMTKSKAPSL-VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFA--MYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEP-----ISREMEAFIDQMFISIPQERATAESLLSCAF 1784
            +R+KFE + + R ++  RPV++E++  K+++         LHY+N    I   + NQ +L++ +  +D ++  +SLRIL+       TS+ PH   S  V      S   I+  Y                PG  SPPPGY+     H+ R  S+   + +GEFIPE      +    S ++S S S QSL  +    S R+ ++S  +S  +   E    + ++       GT+P R H S + K   +GR+T P IR  +  +F  + SS   +++  +      YL             +L + +    +K+PS  +++++G LLG+G FG+VY C D ++GRE A K+V     +   S    K+   LE EI + K L  H+RIVQYYG  RD     + IFMEYM GGSVKDQL+ YG L   V  KYT+QIL+G+++LH  +I+HRDIK ANILRD  GNVKL DFGAS+ L++I +              S  G         + S  GT Y+M+PEVI GE Y   AD+WSLG TVVEMLT  PP+ + E  AA+++IA       +P  P     IS     F+ ++F+   Q R +AE LL+  F
Sbjct:   45 VRIKFEHNGERRIIAFSRPVRYEDVEHKVTTVFGQPLD--LHYMNNELSIL--LKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNHTSSSPHSGVSRQVRIKPSQSAGDINTIYQAPEPRSRHLSVSSQNPGRSSPPPGYVPERQQHIARQGSYTSINSEGEFIPETSEQCMLDPLSSAENSLSGSCQSLDRSADSPSFRKSQMSRARSFPDNRKECSDRETQLYDKGVKGGTYPRRYHVSVHHKDYNDGRRTFPRIRRHQGNLFTLVPSSRSLSTNGENMGVAVQYLDPRGRLRSADSENALTVQERNVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELASKQV----QFDPDSPETSKEVSALECEIQLLKNLQ-HERIVQYYGCLRDRAEKILTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICM--------------SGTG---------IRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIAT------QPTNPQLPSHISEHGRDFLRRIFVEARQ-RPSAEELLTHHF 621          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. UniProt/SwissProt
Match: sp|Q9Y2U5|M3K2_HUMAN (Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2)

HSP 1 Score: 265.003 bits (676), Expect = 2.580e-74
Identity = 209/616 (33.93%), Postives = 298/616 (48.38%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILVTSNIPHRVAS----SSVSDY-------------SIHKSYHTRPGSPPPGYLHPNDVH-VERSTSFPISHVDGEFIPED-DAIXXXXXXXXXXXXXXXXLIDTNWGGSGRRQKLSNLKSHSELPDEPGIHQQ-------------KIGTFPLRVHPSTYTKP--EGRQTLPHIRNSE--------------------MFQQIIXXXXXXXXXXXXXFYL--PSLMLDKTMTKSKAP-SLVDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRD--NFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEP-----ISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            +RVKFE   + R L  PRPVK E+L  K   +        LHY N   E+   +T Q +L++ V  +D +   +SL+IL+  N   +  +     S+ D              SI         SPPPGY+ P+++H V R+ SF   + +GEFIPE  D +    S  S  +S   S    +    G     S +      PD    HQ+             K GT+P R H S + +   +GR+T P  R ++                        I +    +S        +  P+L +      S++P +  +++ G LLG+G FG+VY C D ++GRE A+K+V     +   S    K+   LE EI + K L  H+RIVQYYG  RD     + IFMEYM GGS+KDQL+ YG L   V  KYT+QIL+G+ +LH  +I+HRDIK ANILRD  GNVKL DFGAS+ L++I +              S  G         + S  GT Y+M+PEVI GE Y   ADIWS+  TVVEMLT  PP+ + E  AA+++IA       +P  P     +S     F+ ++F+   + R +A+ LL   F+
Sbjct:   44 VRVKFEHRGEKRILQFPRPVKLEDLRSKAKIAFGQSMD--LHYTN--NELVIPLTTQDDLDKAVELLDRSIHMKSLKILLVINGSTQATNLEPLPSLEDLDNTVFGAERKKRLSIIGPTSRDRSSPPPGYI-PDELHQVARNGSFTSINSEGEFIPESMDQMLDPLSLSSPENSGSGSCPSLDSPLDGESYPKSRMPRAQSYPDN---HQEFSDYDNPIFEKFGKGGTYPRRYHVSYHHQEYNDGRKTFPRARRTQGTSLRSPVSFSPTDHSLSTSSGSSIFTPEYDDSRIRRRGSDIDNPTLTVMDISPPSRSPRAPTNWRLGKLLGQGAFGRVYLCYDVDTGRELAVKQV----QFDPDSPETSKEVNALECEIQLLKNL-LHERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICL--------------SGTG---------MKSVTGTPYWMSPEVISGEGYGRKADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIAT------QPTNPKLPPHVSDYTRDFLKRIFVEA-KLRPSADELLRHMFV 616          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. UniProt/SwissProt
Match: sp|Q61083|M3K2_MOUSE (Mitogen-activated protein kinase kinase kinase 2 OS=Mus musculus OX=10090 GN=Map3k2 PE=1 SV=2)

HSP 1 Score: 256.914 bits (655), Expect = 1.312e-71
Identity = 205/611 (33.55%), Postives = 303/611 (49.59%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILV-------TSNIPHRVASSSVSDYSIHKSYHTR----------PGSPPPGYLHPNDVH-VERSTSFPISHVDGEFIPED-DAIXXXXXXXXXXXXXXXXLIDTNWGGSGRRQKLSNLKSHSELPDEPGIHQQ-------------KIGTFPLRVHPSTYTKP--EGRQTLPHIRNSE--MFQQIIXXXXXXXXXXXXXFYL--------------------PSLMLDKTMTKSKAP-SLVDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRD--NFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            +RVKFE   + R L + RPVK E+L  K  S +     + LHY N   E+   +T Q +L++ V  +D +   +SL+IL+        +N+    +   +++  +      R            SPPPGY+ P+ +H + R+ SF   + +GEFIPE  D +    S  S  +S   S    +    G     S +      PD    HQ+             K GT+P R H S + +   +GR+T P  R ++   F+  +S S  + S ++++                       P+L +      S++P +  +++ G LLG+G FG+VY C D ++GRE A+K+V     +   S    K+   LE EI + K L  H+RIVQYYG  RD     + IFME   GGS+KDQL+ YG L   V  KYT+QIL+G+ +LH  +I+HRDIK ANILRD  GN+KL DFGAS+ L++I +              S  G         + S  GT Y+M+PEVI GE Y   ADIWS+  TVVEMLT  PP+ + E  AA+++IA T     K    +S     F+ ++F+   + R +AE LL   F+
Sbjct:   44 VRVKFEHRGEKRILQVTRPVKLEDLRSK--SKIAFGQSMDLHYTN--NELVIPLTTQDDLDKAVELLDRSIHMKSLKILLVVNGSTQATNLEPSPSPEDLNNTPLGAERKKRLSVVGPPNRDRSSPPPGYI-PDILHQIARNGSFTSINSEGEFIPESMDQMLDPLSLSSPENSGSGSCPSLDSPLDGESYPKSRMPRAQSYPDN---HQEFTDYDNPIFEKFGKGGTYPRRYHVSYHHQEYNDGRKTFPRARRTQGTSFRSPVSFSPTDHSLSTSSGSSVFTPEYDDSRIRRRGSDIDNPTLTVTDISPPSRSPRAPTNWRLGKLLGQGAFGRVYLCYDVDTGRELAVKQVQ----FNPESPETSKEVNALECEIQLLKNL-LHERIVQYYGCLRDPQEKTLSIFMELSPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNIKLGDFGASKRLQTICL--------------SGTG---------MKSVTGTPYWMSPEVISGEGYGRKADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIA-TQPTNPKLPPHVSDYTRDFLKRIFVEA-KLRPSAEELLRHMFV 616          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. UniProt/SwissProt
Match: sp|Q9CAD5|YODA_ARATH (Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana OX=3702 GN=YDA PE=1 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 1.980e-50
Identity = 118/293 (40.27%), Postives = 166/293 (56.66%), Query Frame = 3
Query:  921 YKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSA-DIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFITSV 1796
            +KKG LLG G FG VY   +SESG   AMKEV L S         ++ A+ L  EI +   L  HQ IVQYYG++  +  +YI++EY+SGGS+   L++YG      +  YT+QIL GLA+LH K  +HRDIK ANIL D  G VK++DFG ++++ +                          +SG + SF G+ Y+MAPEVI+  + SN A DIWSLG TV+EM T  PP+   E   A+++I N+ ++   P + +S E + F+ +     P  R TA  LL  AF+ +V
Sbjct:  400 WKKGRLLGMGSFGHVYLGFNSESGEMCAMKEVTLCS----DDPKSRESAQQLGQEISVLSRLR-HQNIVQYYGSETVDDKLYIYLEYVSGGSIYKLLQEYGQFGENAIRNYTQQILSGLAYLHAKNTVHRDIKGANILVDPHGRVKVADFGMAKHITA--------------------------QSGPL-SFKGSPYWMAPEVIKNSNGSNLAVDIWSLGCTVLEMATTKPPWSQYEGVPAMFKIGNSKELPDIP-DHLSEEGKDFVRKCLQRNPANRPTAAQLLDHAFVRNV 659          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. TrEMBL
Match: A0A2I3TPU4 (Mitogen-activated protein kinase kinase kinase 3 OS=Pan troglodytes OX=9598 GN=MAP3K3 PE=4 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 5.221e-83
Identity = 217/604 (35.93%), Postives = 320/604 (52.98%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILVTSNIPHRVAS--------------SSVSDYSIHKSYHTRPG--SPPPGYLHPNDVHVERSTSFPISHVDGEFIPEDDA---IXXXXXXXXXXXXXXXXLIDTNWGGSGRRQKLSNLKSHSELPDEPGIHQQKI-------GTFPLRVHPSTYTK--PEGRQTLPHIRNSE--MFQQIIXXXXXXXXXXXXXF---YLP------------SLMLDKTMTKSKAPSL-VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNF--AMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEP-----ISREMEAFIDQMFISIPQERATAESLLSCAF 1784
            +R+KFE + + R ++  RPVK+E++  K+++         LHY+N    I   + NQ +L++ +  +D ++  +SLRIL+ S   + V+S              S  S  S+  S H+ PG  SPPPGY+     H+ R  S+   + +GEFIPE      +    S ++S S S QSL  +    S R+ ++S  +S  +   E    + ++       GT+P R H S + K   +GR+T P IR  +  +F  + SS   +++  +      YL             +L + +    +K+PS  +++++G LLG+G FG+VY C D ++GRE A K+V     +   S    K+   LE EI + K L  H+RIVQYYG  RD     + IFMEYM GGSVKDQL+ YG L   V  KYT+QIL+G+++LH  +I+HRDIK ANILRD  GNVKL DFGAS+ L++I +              S  G         + S  GT Y+M+PEVI GE Y   AD+WSLG TVVEMLT  PP+ + E  AA+++IA       +P  P     IS     F+ ++F+   Q R +AE LL+  F
Sbjct:   76 VRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLD--LHYMNNELSIL--LKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNHVSSPCHGLAAEDKACFPSGTSHLSV-ASEHSNPGRSSPPPGYVPERQQHIARQGSYTSINSEGEFIPETSEQCMLDPLSSAENSLSGSCQSLDRSADSPSFRKSRMSRAQSFPDNRQEYSDRETQLYDKGVKGGTYPRRYHVSVHHKDYSDGRRTFPRIRRHQGNLFTLVPSSRSLSTNGENMGLAVQYLDPRGRLRSADSENALSVQERNVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELASKQV----QFDPDSPETSKEVSALECEIQLLKNLQ-HERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICM--------------SGTG---------MRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIAT------QPTNPQLPSHISEHGRDFLRRIFVEARQ-RPSAEELLTHHF 639          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. TrEMBL
Match: A0A2R9B6G6 (Mitogen-activated protein kinase kinase kinase 3 OS=Pan paniscus OX=9597 GN=MAP3K3 PE=4 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 6.311e-83
Identity = 217/604 (35.93%), Postives = 320/604 (52.98%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILVTSNIPHRVAS--------------SSVSDYSIHKSYHTRPG--SPPPGYLHPNDVHVERSTSFPISHVDGEFIPEDDA---IXXXXXXXXXXXXXXXXLIDTNWGGSGRRQKLSNLKSHSELPDEPGIHQQKI-------GTFPLRVHPSTYTK--PEGRQTLPHIRNSE--MFQQIIXXXXXXXXXXXXXF---YLP------------SLMLDKTMTKSKAPSL-VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNF--AMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEP-----ISREMEAFIDQMFISIPQERATAESLLSCAF 1784
            +R+KFE + + R ++  RPVK+E++  K+++         LHY+N    I   + NQ +L++ +  +D ++  +SLRIL+ S   + V+S              S  S  S+  S H+ PG  SPPPGY+     H+ R  S+   + +GEFIPE      +    S ++S S S QSL  +    S R+ ++S  +S  +   E    + ++       GT+P R H S + K   +GR+T P IR  +  +F  + SS   +++  +      YL             +L + +    +K+PS  +++++G LLG+G FG+VY C D ++GRE A K+V     +   S    K+   LE EI + K L  H+RIVQYYG  RD     + IFMEYM GGSVKDQL+ YG L   V  KYT+QIL+G+++LH  +I+HRDIK ANILRD  GNVKL DFGAS+ L++I +              S  G         + S  GT Y+M+PEVI GE Y   AD+WSLG TVVEMLT  PP+ + E  AA+++IA       +P  P     IS     F+ ++F+   Q R +AE LL+  F
Sbjct:   76 VRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLD--LHYMNNELSIL--LKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNHVSSPCHGLAAEDKACFPSGTSHLSV-ASEHSNPGRSSPPPGYVPERQQHIARQGSYTSINSEGEFIPETSEQCMLDPLNSAENSLSGSCQSLDRSADSPSFRKSRMSRAQSFPDNRQEYSDRETQLYDKGVKGGTYPRRYHVSVHHKDYSDGRRTFPRIRRHQGNLFTLVPSSRSLSTNGENMGLAVQYLDPRGRLRSADSENALSVQERNVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELASKQV----QFDPDSPETSKEVSALECEIQLLKNLQ-HERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICM--------------SGTG---------MRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIAT------QPTNPQLPSHISEHGRDFLRRIFVEARQ-RPSAEELLTHHF 639          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. TrEMBL
Match: A0A452HBA1 (Mitogen-activated protein kinase kinase kinase 3 OS=Gopherus agassizii OX=38772 GN=MAP3K3 PE=4 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 1.156e-82
Identity = 215/608 (35.36%), Postives = 316/608 (51.97%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILV-------TSNIPH-------RVASS-SVSDYSIH-------------KSYHTRPGSPPPGYLHPNDVHVERSTSFPISHVDGEFIPE--DDAIXXXXXXXXXXXXXXXXLIDTNWGGSGRRQKLSNLKSHSELPDEPGIHQQKIGTFPLRVHPSTYTK--PEGRQTLPHIRNSE--MFQQIIXXXXXXXXXXXXXFYLP---------------SLMLDKTMTKSKAPSL-VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNF--AMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEP-----ISREMEAFIDQMFISIPQERATAESLLSCAF 1784
            +R+KFE + + R +   RPV++E++ QK+ ++        LHY+N   E+   + NQ +L++ V  +D ++  +SLRIL+       TS+ PH       R+ +S SV D +                S +T   SPPPGY+      + R  S+   + +GEFIPE  +  +    S   +  S     +D     S  R + ++ +S++++ D+ G    K GT+P R H S   K   +GR+T P IR  +  +F  + SS   +++  +    L                SL + +    +K+PS  +++++G LLG+G FG+VY C D ++GRE A K+V     +   S    K+   LE EI + K L  H RIVQYYG  RD     + IFMEYM GGSVKDQL+ YG L   V  KYT+QIL+G+++LH  +I+HRDIK ANILRD  GNVKL DFGAS+ L++I +              S  G         + S  GT Y+M+PEVI GE Y   AD+WSLG TVVEMLT  PP+ + E  AA+++IA       +P  P     IS     F+ ++F+   Q R +AE LL   F
Sbjct:   35 VRIKFEHNGERRIIPFVRPVRYEDVQQKVKTAFGQPLD--LHYMN--NELSIPLKNQDDLDKAVDILDRSSNVKSLRILLLSQDRNHTSSSPHSGLPKQVRIKTSQSVGDVNTAYQPPEPRSRLLSVSSQNTGRSSPPPGYVPERQQRIARQGSYTSINSEGEFIPETNEQCMLDPLSSAENSISGSCQSLDR----SADRYRPTDKRSYNQIYDKAG----KGGTYPRRYHVSMQHKDYSDGRRTFPRIRRHQGNLFTLVPSSRSLSTNGENLGLALQYLDPRGRLRSADSENSLTVQERNIPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQV----QFDPDSPETSKEVSALECEIQLLKNLQ-HDRIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGVSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICM--------------SGTG---------IRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIAT------QPTNPQLPSHISEHCRDFLKRIFVEARQ-RPSAEELLRHHF 595          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. TrEMBL
Match: G3P5R1 (Mitogen-activated protein kinase kinase kinase 3 OS=Gasterosteus aculeatus OX=69293 PE=4 SV=1)

HSP 1 Score: 297.745 bits (761), Expect = 1.286e-82
Identity = 222/641 (34.63%), Postives = 318/641 (49.61%), Query Frame = 3
Query:   60 LKKQTHSIINNNNTDDNEKVVGKMLRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILV-------TSNIPHRV--------ASSSVSDYSIH-------------KSYHTRPGSPPPGYLHPNDVHVERSTSFPISHVDGEFIPE--DDAIXXXXXXXXXXXXXXXXLIDTNWGG-SGRRQKLSNLKSHSELPDEPGIHQQKI--------GTFPLRVHPSTYTK--PEGRQTLPHIRNSEMFQQIIXXXXXXXXXXXXXFYLPSLML----------DKTMT-------KSKAPSL-VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDN--FAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEP-----ISREMEAFIDQMFISIPQERATAESLLSCAF 1784
            L+ + HS     N  +  K     +R+KFEF  + R L   RPV+FEE+ QK+++         LHY+N   E+   + +Q +L++ +  +D ++  +S+RIL+        S+  H V        +S S  D S                S +T   SPPPGY+      + R  S+   + +GEFIPE  D  +    S   +  S     +D+N    S RR ++   KS+ +  +E    +  +        GTFP R H S + K   EGR+T P IR  +    + +      S   +   L S  L          D+++         SK PS  + +++G LLG+G FG+VY C D ++GRE A K+V     +   S    K+   LE EI + K L  H+RIVQYYG  RD+    + IFMEYM GGSVKDQL+ YG L   V  KYT+QIL+G+++LH  +I+HRDIK ANILRD +GNVKL DFGAS+ L++I +              S  G         + S  GT Y+M+PEVI GE Y   AD+WSLG TVVEMLT  PP+ + E  AA+++IA       +P  P      S +   FI  +F+   + R +AE LL   F
Sbjct:   52 LQNEMHSKCFQLNRSEEIKNSQDDVRIKFEFSGERRILVFGRPVQFEEVQQKVTTVFGQQLD--LHYMN--NELSIPLRDQDDLDKAIDLLDRSSNMKSIRILLLTPEHSNASSPSHHVPCKQVRIKSSQSTGDVSTAYQSSEPRGRHLSTGSQNTGRSSPPPGYVPERQQRIARQGSYTSINSEGEFIPETSDQCVLDPWSSAENSVSGSCQSLDSNSDSPSLRRSRMHRAKSYPDNREEGSDRENHVYDRVAGKGGTFPRRYHVSLHHKDHSEGRRTFPRIRRPQ--GNLFTLVPSRRSLNGSEESLGSWQLVDAHGRLRPQDRSVAHKCECSNNSKPPSAPMTWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVH----FDPESPETSKEVSALECEIQLLKNLH-HERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSEGNVKLGDFGASKRLQTICM--------------SGTG---------IRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIAT------QPTNPALPSHTSEQARDFISCIFVEA-KHRPSAEELLRRPF 651          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. TrEMBL
Match: A0A3B4A3L4 (Mitogen-activated protein kinase kinase kinase 3 OS=Periophthalmus magnuspinnatus OX=409849 PE=4 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 2.119e-82
Identity = 220/607 (36.24%), Postives = 309/607 (50.91%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILVT----SNIPHRV---------------ASSSVSDYSIHK------------SYHTRPGSPPPGYLHPNDVHVERSTSFPISHVDGEFIPE--DDAIXXXXXXXXXXXXXXXXLIDTNWGG-SGRRQKLSNLKSHS----ELPDEPGIHQQKI----GTFPLRVHPSTYTK--PEGRQTLPHIRNSE--MFQQIIXXXXXXXXXXXXXFYL-----PSLMLDKTMTKSKAPSL-VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNF--AMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPI--SREMEAFIDQMFISIPQERATAESLLSCAF 1784
            +R+KFEF  + R L   RPV+FEE+ QK+ S         LHY+N   E+   + +Q +L++ +  +D ++  +S+RIL+     SN+ ++                 S S  D + ++            S +T   SPPPGY+      + R  S+   + +GEFIPE  D  +    S   +  S     +D+N    S R+ ++   KS+     E  D       +I    GT+P R H S + K   EGR+T P IR  +  +F  + S    N S  S   +        L   +     K+PS  V +++G LLG+G FGQVY C D ++GRE A K+V     +   S    K+   LE EI + K L  H RIVQYYG  RD+    + IFMEYM GGSVKDQL+ YG L   V  KYT+QIL+G+++LH  +I+HRDIK ANILRD  GNVKL DFGAS+ L++I +              S  G         + S  GT Y+M+PEVI GE Y   AD+WSLG TVVEMLT  PP+ + E  AA+++IA       KP+ P+  S +   FI  +F+   Q R +AE LL   F
Sbjct:   42 VRIKFEFSGERRILMFGRPVQFEEVLQKVKSVFGQQLD--LHYMN--NELSIPLKSQDDLDKAIDLLDRSSNMKSIRILLLTPEHSNVRNKSLATENSLPCKQVRISTSQSTGDSTAYQPPESRGRQHSTGSQNTGRSSPPPGYVPERQQRIARQGSYTSINSEGEFIPETSDQCVMDPWSSAENSVSGSCQSLDSNSDSPSLRKSRMHRAKSYPDNRLECSDRENHMYDRIVGKGGTYPRRYHVSVHHKDHSEGRRTFPRIRRPQGNLFTLVPSRRSLNGSEESLGSWQLVDAQGRLRPQERTVNHKSPSAPVTWRRGKLLGQGAFGQVYLCYDVDTGRELAAKQV----QFDPDSPETSKEVSALECEIQLLKNLH-HDRIVQYYGCLRDHCEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSVGNVKLGDFGASKRLQTICM--------------SGTG---------IRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPT---KPLLPLHCSEQARDFIHYIFVEAKQ-RPSAEELLRHPF 612          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 286.96 bits (733), Expect = 8.649e-83
Identity = 213/607 (35.09%), Postives = 306/607 (50.41%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILVTSNIPHRV---------------ASSSVSD-------------YSIHKSYHTRPGSPPPGYLHPNDVHVERSTSFPISHVDGEFIPE--DDAIXXXXXXXXXXXXXXXXLIDTNWGG-SGRRQKLSNLKSHSELPDEPGIHQQKI--------GTFPLRVHPSTYTK--PEGRQTLPHIRNSE--MFQQIIXXXXXXXXXXXXXFYL-----PSLMLDKTMTKSKAPSL-VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDN--FAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPI-----SREMEAFIDQMFISIPQERATAESLLSCAF 1784
            +R+KFEF  + R L   RPV+F+E+ QK+ +         LHYIN   E+   +  Q +L++ +  +D ++  +S++IL+ +     V               AS S  D             +S   S +T   SPPPGY+      + R  S+   + +GEFIPE  D  +    S   +  S     +D+N    S R+ ++   +S+ +   +    +  +        GT+P R H S + K   EGR+T P IR  +  +F  + S    N S  S   +        L         K+P+  V +++G LLG+G FG+VY C D ++GRE A K+V     +  +S    K+   LE EI + K L  H+RIVQYYG  RD+    + IFMEYM GGSVKDQL+ YG L   V  KYT+QIL+G+++LH  +I+HRDIK ANILRD  GNVKL DFGAS+ L++I           MSS               V S  GT Y+M+PEVI G+ Y   AD+WSLG TVVEMLT  PP+ + E  AA+++IA       +P  PI     S +   FI ++F+   + R +AE LL   F
Sbjct:   48 VRIKFEFGGERRILMFCRPVQFDEVQQKVKTVFGQQLD--LHYIN--NEMSIPLHGQDDLDKAIDLLDRSSNMKSIKILLLTQEHSNVSSSSHHSGCKQVRIKASQSTGDVNTAYQSTEPRGRHSSTSSQNTGRSSPPPGYVPERQQRIARQGSYTSINSEGEFIPETSDQLVLDPWSSAENSVSGSCQSLDSNSDSPSLRKSRMHRARSYPDNRQDCADRENHVYDKIVGKGGTYPRRYHVSLHHKDHSEGRRTFPRIRRPQGNLFTLVPSRRSLNGSEESLGTWQLVDAQSRLRPQDRPVPHKSPTAPVTWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQV----QFDPASPETSKEVSTLECEIQLLKNLH-HERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTI----------CMSSTG-------------VRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIAT------QPTNPILPSHTSEQTRDFIRRIFVEA-KHRPSAEELLRHPF 615          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 286.96 bits (733), Expect = 8.649e-83
Identity = 213/607 (35.09%), Postives = 306/607 (50.41%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILVTSNIPHRV---------------ASSSVSD-------------YSIHKSYHTRPGSPPPGYLHPNDVHVERSTSFPISHVDGEFIPE--DDAIXXXXXXXXXXXXXXXXLIDTNWGG-SGRRQKLSNLKSHSELPDEPGIHQQKI--------GTFPLRVHPSTYTK--PEGRQTLPHIRNSE--MFQQIIXXXXXXXXXXXXXFYL-----PSLMLDKTMTKSKAPSL-VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDN--FAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPI-----SREMEAFIDQMFISIPQERATAESLLSCAF 1784
            +R+KFEF  + R L   RPV+F+E+ QK+ +         LHYIN   E+   +  Q +L++ +  +D ++  +S++IL+ +     V               AS S  D             +S   S +T   SPPPGY+      + R  S+   + +GEFIPE  D  +    S   +  S     +D+N    S R+ ++   +S+ +   +    +  +        GT+P R H S + K   EGR+T P IR  +  +F  + S    N S  S   +        L         K+P+  V +++G LLG+G FG+VY C D ++GRE A K+V     +  +S    K+   LE EI + K L  H+RIVQYYG  RD+    + IFMEYM GGSVKDQL+ YG L   V  KYT+QIL+G+++LH  +I+HRDIK ANILRD  GNVKL DFGAS+ L++I           MSS               V S  GT Y+M+PEVI G+ Y   AD+WSLG TVVEMLT  PP+ + E  AA+++IA       +P  PI     S +   FI ++F+   + R +AE LL   F
Sbjct:   48 VRIKFEFGGERRILMFCRPVQFDEVQQKVKTVFGQQLD--LHYIN--NEMSIPLHGQDDLDKAIDLLDRSSNMKSIKILLLTQEHSNVSSSSHHSGCKQVRIKASQSTGDVNTAYQSTEPRGRHSSTSSQNTGRSSPPPGYVPERQQRIARQGSYTSINSEGEFIPETSDQLVLDPWSSAENSVSGSCQSLDSNSDSPSLRKSRMHRARSYPDNRQDCADRENHVYDKIVGKGGTYPRRYHVSLHHKDHSEGRRTFPRIRRPQGNLFTLVPSRRSLNGSEESLGTWQLVDAQSRLRPQDRPVPHKSPTAPVTWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQV----QFDPASPETSKEVSTLECEIQLLKNLH-HERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTI----------CMSSTG-------------VRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIAT------QPTNPILPSHTSEQTRDFIRRIFVEA-KHRPSAEELLRHPF 615          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 286.96 bits (733), Expect = 8.649e-83
Identity = 213/607 (35.09%), Postives = 306/607 (50.41%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILVTSNIPHRV---------------ASSSVSD-------------YSIHKSYHTRPGSPPPGYLHPNDVHVERSTSFPISHVDGEFIPE--DDAIXXXXXXXXXXXXXXXXLIDTNWGG-SGRRQKLSNLKSHSELPDEPGIHQQKI--------GTFPLRVHPSTYTK--PEGRQTLPHIRNSE--MFQQIIXXXXXXXXXXXXXFYL-----PSLMLDKTMTKSKAPSL-VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDN--FAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPI-----SREMEAFIDQMFISIPQERATAESLLSCAF 1784
            +R+KFEF  + R L   RPV+F+E+ QK+ +         LHYIN   E+   +  Q +L++ +  +D ++  +S++IL+ +     V               AS S  D             +S   S +T   SPPPGY+      + R  S+   + +GEFIPE  D  +    S   +  S     +D+N    S R+ ++   +S+ +   +    +  +        GT+P R H S + K   EGR+T P IR  +  +F  + S    N S  S   +        L         K+P+  V +++G LLG+G FG+VY C D ++GRE A K+V     +  +S    K+   LE EI + K L  H+RIVQYYG  RD+    + IFMEYM GGSVKDQL+ YG L   V  KYT+QIL+G+++LH  +I+HRDIK ANILRD  GNVKL DFGAS+ L++I           MSS               V S  GT Y+M+PEVI G+ Y   AD+WSLG TVVEMLT  PP+ + E  AA+++IA       +P  PI     S +   FI ++F+   + R +AE LL   F
Sbjct:   48 VRIKFEFGGERRILMFCRPVQFDEVQQKVKTVFGQQLD--LHYIN--NEMSIPLHGQDDLDKAIDLLDRSSNMKSIKILLLTQEHSNVSSSSHHSGCKQVRIKASQSTGDVNTAYQSTEPRGRHSSTSSQNTGRSSPPPGYVPERQQRIARQGSYTSINSEGEFIPETSDQLVLDPWSSAENSVSGSCQSLDSNSDSPSLRKSRMHRARSYPDNRQDCADRENHVYDKIVGKGGTYPRRYHVSLHHKDHSEGRRTFPRIRRPQGNLFTLVPSRRSLNGSEESLGTWQLVDAQSRLRPQDRPVPHKSPTAPVTWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQV----QFDPASPETSKEVSTLECEIQLLKNLH-HERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTI----------CMSSTG-------------VRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIAT------QPTNPILPSHTSEQTRDFIRRIFVEA-KHRPSAEELLRHPF 615          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Cavefish
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3-like [Source:NCBI gene;Acc:103044968])

HSP 1 Score: 268.855 bits (686), Expect = 1.262e-76
Identity = 210/597 (35.18%), Postives = 296/597 (49.58%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDH--NNKYRSLRILVTSNIPHRV----------ASSSVSDYS---------IHK----SYHTRPGSPPPGYLHPNDVHVERSTSFPISHVDGEFIPE--DDAIXXXXXXXXXXXXXXXXLIDTN-----WGGSGRRQKLSNLKSHSELPDEPGIHQQKIGTFPLRVHPSTYTKP--EGRQTLPH--IRNSEMFQQIIXXXXXXXXXXXXXFYLPSL----MLDKTMTKSKAPSL---VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRD--NFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            LRVK E + + R +   +P+KF EL QK+  +        L+Y +  KE    +  Q +L++ V  V    N   R L    T+N   +V          +S S+ D           + K    S HT   SPPPG +      + R  S+   + +GEFIPE  D  I           SS    +D       +  + R     NL       D  G H  K GTFP + H S  +K   +GR+T P   +    +FQ + SS   + +  S   Y   +      DK+  +S A S    V++++G LLGRG FG+VY C D+++GRE A+K+V    P+        K+   LE EI + K L  H+RIVQYYG  RD     + IF+E+M GGS+KDQL+ YG L  +V  +YT+QILQG+ +LH  +I+HRDIK ANILRD  GNVKL DFGAS+ +++I +              S  G         + +  GT Y+M+PEVI GE Y   AD+WS+  TVVEMLT  PP+ + E  AA+++IA        P E +S     F+ Q+F+   + R TAE LLS  F+
Sbjct:   58 LRVKLEHEREKRIIPFQKPLKFRELLQKVIEAFGQHMD--LYYTD--KEALVALKCQEDLDRAVQNVSSGTNGLLRVLLKTPTNNHFLQVNSRDKQSEMKSSRSLGDLKGSLIKGSERVRKHSTGSLHTGRSSPPPGSVPEEQQQIARQGSYTSINSEGEFIPETLDPNIMEPFGSADGSLSSSCQSLDKALDSPPFSQNNRDNNYLNLNF-----DYKGRHG-KHGTFPRQFHISNRSKDYGDGRRTFPRSFMPQENLFQLVPSSRTRSYNGDSMLQYSGDMHSITWTDKSSQRSAAKSPQAPVNWRQGKLLGRGAFGEVYLCYDADTGRELAVKQV----PFDPECHETSKEVNALECEIQLLKNLR-HERIVQYYGCLRDPEQRKLSIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVFYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTICM--------------SGTG---------IKTVTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIATQPTKPNLP-EGVSDACRDFLRQVFVE-EKWRPTAEGLLSHPFV 614          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Cavefish
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3-like [Source:NCBI gene;Acc:103044968])

HSP 1 Score: 268.855 bits (686), Expect = 1.280e-76
Identity = 210/597 (35.18%), Postives = 296/597 (49.58%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDH--NNKYRSLRILVTSNIPHRV----------ASSSVSDYS---------IHK----SYHTRPGSPPPGYLHPNDVHVERSTSFPISHVDGEFIPE--DDAIXXXXXXXXXXXXXXXXLIDTN-----WGGSGRRQKLSNLKSHSELPDEPGIHQQKIGTFPLRVHPSTYTKP--EGRQTLPH--IRNSEMFQQIIXXXXXXXXXXXXXFYLPSL----MLDKTMTKSKAPSL---VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRD--NFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            LRVK E + + R +   +P+KF EL QK+  +        L+Y +  KE    +  Q +L++ V  V    N   R L    T+N   +V          +S S+ D           + K    S HT   SPPPG +      + R  S+   + +GEFIPE  D  I           SS    +D       +  + R     NL       D  G H  K GTFP + H S  +K   +GR+T P   +    +FQ + SS   + +  S   Y   +      DK+  +S A S    V++++G LLGRG FG+VY C D+++GRE A+K+V    P+        K+   LE EI + K L  H+RIVQYYG  RD     + IF+E+M GGS+KDQL+ YG L  +V  +YT+QILQG+ +LH  +I+HRDIK ANILRD  GNVKL DFGAS+ +++I +              S  G         + +  GT Y+M+PEVI GE Y   AD+WS+  TVVEMLT  PP+ + E  AA+++IA        P E +S     F+ Q+F+   + R TAE LLS  F+
Sbjct:   61 LRVKLEHEREKRIIPFQKPLKFRELLQKVIEAFGQHMD--LYYTD--KEALVALKCQEDLDRAVQNVSSGTNGLLRVLLKTPTNNHFLQVNSRDKQSEMKSSRSLGDLKGSLIKGSERVRKHSTGSLHTGRSSPPPGSVPEEQQQIARQGSYTSINSEGEFIPETLDPNIMEPFGSADGSLSSSCQSLDKALDSPPFSQNNRDNNYLNLNF-----DYKGRHG-KHGTFPRQFHISNRSKDYGDGRRTFPRSFMPQENLFQLVPSSRTRSYNGDSMLQYSGDMHSITWTDKSSQRSAAKSPQAPVNWRQGKLLGRGAFGEVYLCYDADTGRELAVKQV----PFDPECHETSKEVNALECEIQLLKNLR-HERIVQYYGCLRDPEQRKLSIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVFYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTICM--------------SGTG---------IKTVTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIATQPTKPNLP-EGVSDACRDFLRQVFVE-EKWRPTAEGLLSHPFV 617          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 266.929 bits (681), Expect = 1.403e-76
Identity = 212/644 (32.92%), Postives = 319/644 (49.53%), Query Frame = 3
Query:   48 LKVSLKKQTHSIINNNNTDDNEKVVGKMLRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILVTSNIPHRVAS-----SSVSDYSIHKS-------------YHTRPGSPPPGYLHPNDVHVERSTSFPISHVDGEFIPEDDAIX----XXXXXXXXXXXXXXXLIDTNWGGSGRRQKLSNLKSHSELPDEPGIHQQ-------------KIGTFPLRVHPSTYTK---PEGRQTLPHIR---NSEM---FQQIIXXXXXXXXXXXXXFYLPS----------------LMLDKTMTK-SKAP-SLVDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRD--NFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            L++S + ++ ++  ++       V    +RVKFE++ + R L   RP+  E++  K   +        L+Y     E+   + +Q EL+Q V  +D N   + LRI +   +  +++S      S  D +  K+             Y     SPPPGY+        R  S+   H +GEFIP+D  +     +  S ++S   S  SL     G S  +  +   KS+      P  HQ+             K GT+P RV+ ST+ +    EGR+T P +R   NS +   F    +    ++S+ S+  + P                 L  +  ++  S++P +  ++++G LLG+G FG+VY C D+++GRE A+K+V     +   S    K+   LE EI + K L  H+RIVQY+G  RD     + IFMEYM GGS+KDQLR YG L   V  KYT+QIL+G++FLH  +I+HRDIK ANILRD  GNVKL DFGAS+ L++I        CS  ++M S                 GT Y+M+PEVI GE Y   ADIWS+G TVVEMLT  PP+ + E  AA+++IA        P+   S      + ++F+   + R +AE LL   F+
Sbjct:   17 LQLSNRVRSSTLPEDDRAKAAADVAFSDIRVKFEYNGEKRILQFLRPLSLEDVLHKAKVAFGQPMD--LYY--SGNELMIPLRSQEELDQAVELMDRNPHMKCLRIALHLQVRMQLSSHVAPLQSSQDLNSLKATAGADVKALLAGVYPPERSSPPPGYIPAGQRQAARHGSYTSIHSEGEFIPDDTCVEIDPLSPSSPENSTFGSCHSLDSPLAGDSHHKGWIPRTKSY------PDNHQEFSEYELPYFERVGKGGTYPRRVN-STFQRHDCNEGRKTFPRVRCPQNSWLLSPFGCSPTDVSLSTSSGSSGIFTPEPDEGRARRLAGGVGGELAENADVSPPSRSPRAPTNWQRGKLLGQGAFGRVYLCYDADTGRELAVKQV----QFDPGSVETSKEVNALECEIQLLKNLQ-HERIVQYFGCLRDPQQKTLSIFMEYMPGGSIKDQLRAYGALTENVTRKYTRQILEGVSFLHGNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTI--------CSQGTAMRSVT---------------GTPYWMSPEVINGEGYGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTDPRLPLH-ASEHARDLLRRIFVEA-KLRPSAEDLLRHPFV 619          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Sea Lamprey
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:ZFIN;Acc:ZDB-GENE-081104-140])

HSP 1 Score: 160.999 bits (406), Expect = 7.381e-44
Identity = 99/295 (33.56%), Postives = 156/295 (52.88%), Query Frame = 3
Query:  915 VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVIL---ASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFG-ASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            + + KG  LG+G FG V+  L ++ G+  A+KE+ L    S  G      + + + L++E+ +   L  H  +V+Y G + +     IFME++ GG+V + +R +G L   V   Y  Q+ +GLA+LH   ++H D+K +N +    G VKL DFG A R   ++S H                      ++G ++S  GT Y+MAPEVI G  Y+  AD+WSLG T+ EM  G PP+ D+ P AAL  I   + +     +  S+E + F++Q FI    +R +++ LLS  FI
Sbjct:   13 ITWIKGNRLGKGAFGTVFLGLTNQ-GKLIAVKELELRDAQSANGNQGGQKQSELQKLQDEVELLTTLH-HPNVVEYLGTEMEGNRFSIFMEFVPGGTVAETVRGFGPLGESVCRSYIAQMTRGLAYLHGHGVMHGDVKGSNAVITPAGVVKLIDFGCAQRVALALSCH----------------------ENGGLHSVHGTAYWMAPEVINGTGYARRADVWSLGCTLHEMAVGRPPFADMAPMAALLHIGIRNGIMPGLPQAFSKEAQEFVEQCFIRDKLKRPSSQELLSHPFI 283          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Sea Lamprey
Match: pak4 (p21 protein (Cdc42/Rac)-activated kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040704-69])

HSP 1 Score: 141.739 bits (356), Expect = 1.852e-34
Identity = 89/283 (31.45%), Postives = 139/283 (49.12%), Query Frame = 3
Query:  939 LGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            +G G  G V   +D  SGR+ A+K++ L           ++  E L NE++I +E   H+ +V  Y +      +++ ME++ GG++ D +  +  +    +      +L+ LA+LH + +IHRDIK+ +IL   DG +KLSDFG                C+ +S   +              S  GT Y+MAPEVI    Y    D+WSLG  V+EM+ G PPY +  P  A+ RI +    + K ++  S  +  F+DQM +  P  RATA  LL   F+
Sbjct:  425 IGEGSTGVVCLAVDRRSGRQVAVKKMHLRK---------QQRRELLFNEVVIMREYH-HENVVDMYNSYLVADELWVVMEFLEGGALTD-IVTHTRMNEEQIATVCVSVLRALAYLHGQGVIHRDIKSDSILLTADGRIKLSDFGF---------------CAQVSKEVTRR-----------KSLVGTPYWMAPEVISRLPYGPEVDVWSLGIMVIEMVDGEPPYFNEPPLQAMRRIRDNVPPKMKNIQKASPLLRGFLDQMLVRDPALRATALELLQHPFL 670          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Sea Lamprey
Match: MAP4K3 (mitogen-activated protein kinase kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6865])

HSP 1 Score: 141.739 bits (356), Expect = 4.692e-34
Identity = 96/301 (31.89%), Postives = 148/301 (49.17%), Query Frame = 3
Query:  918 DYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVI---RGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTS--------KVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            D++    LG G +G V+K  + ++G   A+K +I   P          D   ++ EI++ KE   H  IV YYG+   +  ++I ME+  GGS++D     G L  R +   T++ LQGLA+LH +  +HRDIK ANIL   DG+VKL+DFG S  +                   +A  A +        SF GT Y+MAPEV    R   Y++  D+W++G T +E+    PP  DL P  AL+ ++ +         K ++ PV         FI       P++R TAE +L+ +++
Sbjct:   13 DFELAERLGSGTYGDVHKARNVQTGELVAIK-IIKLEP--------GDDFSVIQQEIVMMKECK-HTNIVAYYGSYLRHDKLWICMEHCGGGSLQDIYHVTGPLTERQIAYVTRETLQGLAYLHSEGKMHRDIKGANILLTDDGDVKLADFGVSAQI-------------------TATIAKR-------KSFIGTPYWMAPEVAAVERKGGYNHQCDVWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFQPPKLRDKQKWSPV------FHNFIKMALTKNPKKRPTAEKMLTHSYV 271          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006402.1 (pep scaffold:Pmarinus_7.0:GL481397:10373:21355:-1 gene:ENSPMAG00000005783.1 transcript:ENSPMAT00000006402.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.109 bits (331), Expect = 6.722e-34
Identity = 82/254 (32.28%), Postives = 124/254 (48.82%), Query Frame = 3
Query:  876 LDKTMTKSKAPSLVDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFL----HQKLIIHRDIKAANILRDVDGN-VKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSG-LVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYH 1619
            L+ T  +       ++ +G  +G G F   ++  D  +G   A+K+V          D +    + L  EI +   L  H  I++  GA  +     +F+E+M+GGSV + L +YG    RVV+ Y +Q+L+GLA+L    H   +IHRDIK AN+L D  G  ++++DFGA+  L                       ASK   +G       GT  FMAPEV+RG  Y  S DIWS+G  ++EM    PP++
Sbjct:    9 LEHTRARQPYQEGAEWLRGQQIGLGAFSSCFQAQDIGTGTLMAVKQVTYVRNTASEQDEV---VQTLREEIRMMSRLD-HPNIIRMLGATCEKSNYNLFIEWMAGGSVANLLNKYGPFHERVVISYVEQLLRGLAYLHSNQHSNQLIHRDIKGANLLVDSMGQRLRIADFGAAARL-----------------------ASKGTGAGEFQGQLLGTIAFMAPEVLRGLQYGRSCDIWSVGCVIIEMSCAKPPWN 235          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 178.333 bits (451), Expect = 4.497e-45
Identity = 107/292 (36.64%), Postives = 157/292 (53.77%), Query Frame = 3
Query:  921 YKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVI-RGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEP---ISREMEAFIDQMFISIPQERATAESLLSCAF 1784
            + KG ++G+G FG VY CL+  +G   A+K+V +   Y   ++AI    E L +E+   K+L  H  IVQY G +  N    +F+EY++GGSV   +R YG     ++   T Q+L+GLA+LH K I+HRD+KA N+L D DG  K+SDFG SR  K I                       ++ S +  +  GT ++MAPE++   + YS   DIWSLG  V+EM  G  P+ +LE  AA+++I  +      P +    IS+    F+D  F   P++R TA  LLS  F
Sbjct: 1175 WMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPK-YSSQNEAILSTVEALRSEVSTLKDLD-HLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISRKSKDI-----------------------YSNSDM--TMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELLSHPF 1439          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 160.614 bits (405), Expect = 5.189e-40
Identity = 104/294 (35.37%), Postives = 148/294 (50.34%), Query Frame = 3
Query:  915 VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLRQYGT-LPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFITS 1793
            V Y    ++GRG +G VYK ++  + +  A+KEV+      Y +D    D   +  EI + K L  H  IV+Y+G  R ++ +YI +EY + GS++  + +  T L       Y  Q L GL +LH + +IHRDIKAANIL   D  VKL+DFG S  +                           N S L  +  GT  +MAPE++     S  +DIWSLGATVVEMLT NPPYH+L      Y + N +   Y P    S  ++ F+ + F+    +R TA+ LL   +I S
Sbjct:   23 VQYHLKQVIGRGSYGVVYKAINKHTDQVVAIKEVV------YENDEELND---IMAEISLLKNLN-HNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIV---------------------------NSSAL--TLAGTLNWMAPEILGNRGASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDT---YYPPSSFSEPLKDFLSKCFVKNMYKRPTADQLLKHVWINS 274          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 155.992 bits (393), Expect = 4.396e-39
Identity = 104/320 (32.50%), Postives = 157/320 (49.06%), Query Frame = 3
Query:  918 DYKKGPLLGRGGFGQVYKCLDSESGREFAMKEV-ILASPYGYSSDAIK----------------------------------KDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLL 1772
            ++ KG  +G G FG VY  +++ +G   A+K+V I  +  G  +D  K                                  K  + L++E+ + KEL  H+ IV YYGA ++   + IF+EY+ GGSV   L  YG     ++  +T+QIL G+A+LH+K IIHRDIK ANIL D+ G VK++DFG S+ L  ++                     K NK     S  G+ ++M+PEV++  + +  ADIWS G  V+EM TG  P+ D     A+++I   +  E  P    S E + F+ + F    Q R +A  LL
Sbjct:  414 NWLKGACIGSGSFGSVYLGMNAHTGELMAVKQVEIKNNNIGVPTDNNKQANSDENNEQEEQQEKIEDVGAVSHPKTNQNIHRKMVDALQHEMNLLKELH-HENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLN--------------------KKQNKRA---SLQGSVFWMSPEVVKQTATTAKADIWSTGCVVIEMFTGKHPFPDFSQMQAIFKIGTNTTPEI-PSWATS-EGKNFLRKAFELDYQYRPSALELL 707          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Yeast
Match: SSK2 (MAP kinase kinase kinase of HOG1 mitogen-activated signaling pathway; interacts with Ssk1p, leading to autophosphorylation and activation of Ssk2p which phosphorylates Pbs2p; also mediates actin cytoskeleton recovery from osmotic stress; a HOG-independent function of Ssk2p mediates the calcium-sensitive phenotype of the ptp2 msg5 double disruptant; SSK2 has a paralog, SSK22, that arose from the whole genome duplication [Source:SGD;Acc:S000005314])

HSP 1 Score: 152.91 bits (385), Expect = 2.168e-37
Identity = 99/312 (31.73%), Postives = 169/312 (54.17%), Query Frame = 3
Query:  921 YKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVK-YTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMN---------------SAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYS---NSADIWSLGATVVEMLTGNPPYHDLE-PYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFITSV 1796
            ++K   +G G FG+VY  +D ++G   A+KE+ +       S +++K    ++ E+ +  E+  H  IV YYG +     + IFMEY  GGS+   L ++G +   +V + YT Q+L+GLA+LH+  I+HRD+K  NIL D +G +K  DFGA++         ++ N + ++SMN               S + A K+N++ L++   GT  +MAPE I G +      + D+WSLG  V+EM+TG  P+ +L+  +A +Y +A     ++   + +S     F+++  I  P +RA+A  LL   +I  +
Sbjct: 1266 WQKRNFIGGGTFGRVYSAVDLDNGEILAVKEINIQD-----SKSMQKIFPLIKEEMSVL-EILNHPNIVSYYGVEVHRDKVNIFMEYCEGGSLA-ALLEHGRIEDEMVTQVYTLQLLEGLAYLHESGIVHRDVKPENILLDFNGVIKYVDFGAAK--------KIANNGTRLASMNKIENADGEHEDVTHVSDSKAVKNNENALLD-MMGTPMYMAPESITGSTTKGKLGADDVWSLGCVVLEMITGRRPWANLDNEWAIMYHVAAGHTPQFPTKDEVSSAGMKFLERCLIQNPSKRASAVELLMDPWIVQI 1561          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 149.058 bits (375), Expect = 2.118e-36
Identity = 96/294 (32.65%), Postives = 146/294 (49.66%), Query Frame = 3
Query:  921 YKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVI-RGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPV----EPISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            +K+  ++GRG FG VYK  + ++GR +A+K + L        D+   + E ++ EI     L     I +YYG+   + +++I ME+ +GGS++  LR  G +  + +    +++L  L  +H+  +IHRDIKAAN+L   +GNVKL DFG +  +   S+                             +  GT Y+MAPEVI  G  Y    DIWSLG T  E+ TGNPPY D+E   A+  I     ++ KP        S  ++ FI       P+ER +A+ LL   FI
Sbjct:   23 FKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNL--------DSDSDEVEDVQREIQFLASLKQISNITRYYGSYLKDTSLWIIMEHCAGGSLRSLLRP-GKIDEKYIGVIMRELLVALKCIHKDNVIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRR--------------------------QTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQLI-----IKSKPPRLEDRSYSTSLKEFIALCLDEDPKERLSADDLLKSKFI 276          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 233.032 bits (593), Expect = 8.180e-69
Identity = 126/299 (42.14%), Postives = 179/299 (59.87%), Query Frame = 3
Query:  918 DYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEP-----ISREMEAFIDQMFISIPQERATAESLLSCAFITSVS 1799
            +++KG LLG G FGQVY C D ++GRE A+K++      G  + + K + + LE EI   K    ++RIVQYYG + D+  +YIFMEY+ GGS+ + ++Q+G L   +  KY++QIL+G+ +LH   I+HRDIK ANILRD+ GNVKL+DFGAS+ L++I                        +K+G   S  GT Y+MAPEVI GE Y   AD+WS+G TVVEMLT  PP+ D EP AAL++IA       +P EP     +S +   F+        + R +A+ LL  +F+T+ S
Sbjct:    3 NWRKGKLLGAGAFGQVYMCHDLDTGRELAVKQI----ETGQLNSSTKNEVKALEGEIEFMKAFR-NERIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRLQTI-----------------------RSKTGF-RSVHGTPYWMAPEVINGEGYGRKADVWSVGCTVVEMLTTKPPWADFEPMAALFKIAT------QPTEPELPSDLSVDAVEFVRSTLRMNSKSRPSADELLRFSFVTNSS 266          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Nematostella
Match: EDO47821 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL88])

HSP 1 Score: 166.392 bits (420), Expect = 1.201e-45
Identity = 101/293 (34.47%), Postives = 158/293 (53.92%), Query Frame = 3
Query:  915 VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDN--FAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            ++++KG +LG+G FG V+  L   +G   A+K+V L   +  + DA ++  E L+ E+ + K L  H+ IVQY G   D+    + IFME++ GGS+   L+++G     V  +YT+QIL G+++LH   +IHRDIK  NI+   +G +KL DFG ++ +  +  H                     +KS ++ S  GT Y+MAPEVIR   +   +DIWS+G TV EM TG PP+ ++ P +A++ I N S V  +  E  S     F+          R +A+ LL   F+
Sbjct:    3 IEWQKGNVLGKGAFGTVFLGL-VNTGELIAVKQVEL---HPNNVDAAERQYEKLQEEVGLLKSLK-HKNIVQYIGTCMDDSQCTINIFMEFVPGGSIAQALKRFGAFVEPVFRRYTRQILDGVSYLHNNNVIHRDIKGGNIMLMPNGVIKLIDFGCAKKICMVGAH--------------------VSKSNILRSMRGTPYWMAPEVIRETGHGRKSDIWSIGCTVFEMATGQPPWSNVPPLSAIFAIGNGSPVP-RLDESFSAAAIDFVTSCMTRDQDTRPSADELLRHDFL 269          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Nematostella
Match: EDO42845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0A9])

HSP 1 Score: 148.673 bits (374), Expect = 5.872e-39
Identity = 99/292 (33.90%), Postives = 145/292 (49.66%), Query Frame = 3
Query:  939 LGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQR-----IVQYYGAKRDNFAMYIFMEYMSGGSVKDQLR-QYGTLPH---RVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            LG G +G V+K +  ESG+  A+K+V +             D +  E    I KE++  Q+     +V+YYG+   N  ++I MEY   GSV D ++ +  TL     + V+KYT   L+GL +LH +  IHRDIKA NIL + +G+ KL+DFG +  L                                 N+  GT ++MAPEVI+   Y   ADIWSLG T +EM  G PPY D+ P  A++ I       ++     S + + F+ +  +  P+ERATA  LL  +FI
Sbjct:   30 LGEGSYGSVFKAMHKESGQVVAIKQVPV-------------DTDLQE----IIKEISMMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDLMKIRNKTLTEEEIKCVLKYT---LKGLEYLHLRRKIHRDIKAGNILLNSEGHAKLADFGVAGQLTDTMAKR--------------------------NTVIGTPFWMAPEVIQEVGYDCLADIWSLGITAMEMAEGKPPYADIHPMRAIFMIPTKPPPTFRDPGQWSEDFKDFVSKCLVKNPEERATATELLQHSFI 275          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Nematostella
Match: EDO36150 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJF2])

HSP 1 Score: 157.532 bits (397), Expect = 9.273e-39
Identity = 97/290 (33.45%), Postives = 149/290 (51.38%), Query Frame = 3
Query:  915 VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDG-NVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLE---PYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLL 1772
            V +KKG LLG G F   Y   D  +G   A+K+V          D +    + + +EI I   L  H  +++  GA R      IF+E+M+GGS+   L +YG     ++++Y +QILQG+++LH+  ++HRDIK ANIL D  G +++++DFGA+  L +                    GA +     L     GT  FMAPEV+RGESY  S D+WS+G  ++EM TG PP++  E     A +++IA        P E ++  +   + +   S P++R  A  LL
Sbjct:  575 VHWKKGELLGTGAFSSCYGARDVMTGSLMAVKQVSFCRNSKSEQDKV---CQTIMDEIAILARLK-HPHLIKCLGATRHTGHFNIFLEWMAGGSISMLLSKYGPFEEAILIRYLRQILQGVSYLHENQVVHRDIKGANILVDSTGQDIRIADFGAAARLAT-----------------QITGAGEFQGQLL-----GTIAFMAPEVLRGESYGRSCDVWSVGCVLIEMATGKPPWNAHEHSNHLALIFKIACAIGPPDIP-EHLNPGVRDVVLRCLESKPEDRPAAVDLL 837          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Nematostella
Match: EDO45846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRL1])

HSP 1 Score: 136.732 bits (343), Expect = 4.509e-35
Identity = 90/286 (31.47%), Postives = 140/286 (48.95%), Query Frame = 3
Query:  939 LGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFITSV 1796
            +G G  G V    D  +GR+ A+K++ L           ++  E L NE++I ++   H  IV+ YG+      +++ ME++ GG++ D +  +  L    V    + +L+ L FLH + +IHRDIK+ +IL   +G VKLSDFG                C+ ++                  S  GT Y+MAPEVI  + Y    DIWSLG  V+EM+ G PPY +  P  A+ ++ +      +    IS  +++F+D   I  P  RATA  LL+  FI +V
Sbjct:   35 IGEGSTGIVCLATDKRTGRQVAVKKMDLKK---------QQRRELLFNEVVIMRDYP-HPNIVEMYGSHLVGDELWVVMEFLEGGTLTD-IVTHTNLSEEQVACVCRAVLKALTFLHSQGVIHRDIKSDSILLTSNGTVKLSDFGF---------------CAQVTEDMPRR-----------KSLVGTPYWMAPEVISRKPYGTEVDIWSLGIMVLEMVDGEPPYFNEPPLQAMRKLRDLEPPTSRNPIQISPRLQSFLDNALIRDPLYRATAFELLNHPFIRNV 283          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Medaka
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101169290])

HSP 1 Score: 287.73 bits (735), Expect = 4.267e-83
Identity = 217/608 (35.69%), Postives = 306/608 (50.33%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILVTSNIPHRVASS----------------SVSDYSI-------------HKSYHTRPGSPPPGYLHPNDVHVERSTSFPISHVDGEFIPE--DDAIXXXXXXXXXXXXXXXXLIDTNWGG-SGRRQKLSNLKSHSELPDEPGIHQQ--------KIGTFPLRVHPSTYTKP--EGRQTLPHIRNSE--MFQQIIXXXXXXXXXXXXXFYL-----PSLMLDKTMTKSKAPSL-VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNF--AMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPI-----SREMEAFIDQMFISIPQERATAESLLSCAF 1784
            +R+KFEF  + R L   RPV+FEE+ QK+ S    L    L+Y+N   E+   +  Q +L++ V  +D ++  +S+RIL+ +   HR A+S                S  D S                S +T   SPPPGY+      + R  S+   + +GEFIPE  D  +    S   +  S     +++N    S R+ ++   KS+ +   E    +         K GT+P R H S + K   EGR+T P IR  +  +F  + S    NS+      +        L   +     K+PS  V +++G LLG+G FG VY C D ++GRE A K+V     +   S    K+   LE EI + K L  H+RIVQYYG  RD+    + IFMEYM GGSVKDQL+ YG L   V  KYT+QIL+G+++LH  +I+HRDIK ANILRD  GNVKL DFGAS+ L++I +              S  G         + S  GT Y+M+PEVI GE Y   AD+WSLG TVVEMLT  PP+ + E  AA+++IA       +P  P+     S +   FI  +F+   + R +AE LL   F
Sbjct:   45 VRIKFEFSGERRILMFERPVQFEEIQQKVKSVFGQLLD--LYYVN--NEMSIPLRGQDDLDKAVDLLDRSSNMKSIRILLLTQ-EHRHATSPSHHAPCKQVRIKSSQSTGDVSTLYQSSEPRGRHLSTGSQNTGRSSPPPGYVPERQQRIARQGSYTSINSEGEFIPETSDQCMLEPWSSTENSISGSCQSLESNSDSPSVRKSRMHRAKSYPDNRQECADRENYMYDRVAGKGGTYPRRYHVSLHCKDHNEGRRTFPRIRRPQGNLFTLVPSRRSLNSTEDGLGSWQMVDAQGRLRPQERSVSHKSPSAPVTWRRGKLLGQGAFGLVYLCYDVDTGRELAAKQV----QFDPDSPETSKEVSALECEIQLLKNLH-HERIVQYYGCLRDHSEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICM--------------SGTG---------IRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIAT------QPTNPLLPSHTSDQARDFIHCIFVEA-KHRPSAEELLRHPF 612          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Medaka
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:101160297])

HSP 1 Score: 275.404 bits (703), Expect = 1.599e-78
Identity = 211/628 (33.60%), Postives = 309/628 (49.20%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILVTSNIPHRVASSSVSDY------------------------SIHKSYHTRPGSPPPGYLHPNDVHVERSTSFPISHVDGEFIPED-DAIXXXXXXXXXXXXXXXXL--IDTNWGGSGRRQKLSNLKS----HSELP--DEPGIHQQ-KIGTFPLRVHPSTYTKP-------EGRQTLPHIRNSEM--FQQIIX---XXXXXXXXXXXXFYLPSLM-------------LDKTMTKSKAPSL---------------VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNF--AMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            +RVKFEF  + R L  PRPVK ++L  K   +     G  LHY N   E+   +  Q +L++ V  +D +   +SL+IL+   +  + + +S  D                             S  T   SPPPGY+      V R+ SF   + +GEFIPE  D +    S  S  +S+  S   +D+   G   + ++   +S    H + P  D P   +  K GT+P R     Y  P       +GR+T P  R +++  F+  +S   +    S+++ ++ + P L              ++     S  P+L                +++ G LLG+G FG+VY C D+++GRE A+K+V     +   S    K+   LE EI + K L CH+RIVQYYG  RD     + IFME+M GGS+KDQL+ YG L   V  +YT+QIL+G+++LH  +I+HRDIK ANILRD  GNVKL DFGASR L++I +              S  G         + S  GT Y+M+PEVI GE Y   ADIWS+G TVVEMLT  PP+ + E  AA+++IA        PV  +S     F+ ++F+   Q R +A+ LL   F+
Sbjct:   61 VRVKFEFRGEKRILQFPRPVKLDDLKAKAKVAFGQAMG--LHYSN--NELLIPLVTQDDLDKAVELLDRSVHMKSLKILLVVQMSSQNSPASNMDLLPSHEELDNRGFGVADKKSMLSLIGQSGSLSTDRSSPPPGYIPDPLPQVARNGSFTSINSEGEFIPESMDPMFDPLSMSSPENSASGSCPSLDSPLDGEYPKSRMPRAQSYPDNHQDFPESDLPVFEKSGKGGTYPRR-----YGIPYGLQDYSDGRKTFPRARRTQVHNFRSPVSFSPTEQSPSTSSGSSVFTPDLEEAPGPARRRRGSDIESNANPSAGPTLSVMDISPPSRSPRAPTNWRLGKLLGQGAFGRVYLCYDADTGRELAVKQVQ----FDPESPETSKEVSALECEIQLLKNL-CHERIVQYYGCLRDTMERTLSIFMEHMPGGSIKDQLKSYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSVGNVKLGDFGASRRLQTICL--------------SGTG---------IKSVTGTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTQRPPWAEFEAMAAIFKIATQPTNPELPVH-VSDHCREFLRRIFVETKQ-RPSADELLRHIFV 649          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 263.462 bits (672), Expect = 5.013e-75
Identity = 204/598 (34.11%), Postives = 295/598 (49.33%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILV-TSNIPHRVASSSVSDYSIHKS-------------------------YHTRPGSPPPGYLHPNDVHVERSTSFPISHVDGEFIPED------DAIXXXXXXXXXXXXXXXXLIDTN-WGGSGRRQKLSNLKSHSELPDEPGIHQQKIGTFPLRVHPSTYTKPEG--RQTLPH--IRNSEMFQQIIXXXXXXXXXXXXXFYLPSLMLDKTMTKS------KAP-SLVDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRD--NFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            LRVK E + + R +   RP+K +EL QK++ +      +        KE+   +  Q +L+Q V     +     LRIL+ T    H +  +S    S  KS                          HT   SPPPG +      + R  S+   H +GEFIPE+      D   ++ +  SS   S    +D+  +  + R     NL    +     G H  K GTFP +      +K  G  R+TLP   +    +FQ + SS   + +  S   +     L ++  KS      K+P + V++++G LLGRG FG+VY C D+++GRE A K+V    P+        K+   LE EI + K L  H RIVQYYG  RD     + IF+E+M GGS+KDQL+ YG L  +V  +YT+QILQG+++LH  +I+HRDIK ANILRD  GNVKL DFGAS+ +++I +              S  G         + S  GT Y+M+PEVI GE Y   AD+WS+  TVVEMLT  PP+ + E  AA+++IA        P E +S     F+ Q+F+   + R TA+ LL+  F+
Sbjct:   30 LRVKLEHEREKRIIPFQRPLKIKELLQKVTEAFGQQMDMFFL----EKELVLPLKTQEDLDQAVLAGSSSVTNGLLRILLKTPQNNHYLQVNSRDKQSEMKSSRSLGDLKGSLLKSSERVRKHSTGSMHTGRTSPPPGSVPEEQQQIARQGSYTSIHSEGEFIPENPDQNMLDPFGSAGNSLSSSCQSIDQALDSPPFSQNNRDNNYLNLNYEYK-----GRHG-KGGTFPRQFQLPNRSKDYGDRRRTLPRSFMPQENLFQLVPSSRTRSYNGESTLQFTELRSLGRSADKSCQRGTAKSPRAPVNWRQGKLLGRGAFGEVYLCYDADTGRELAAKQV----PFDPDCQETSKEVNALECEIQLLKNLR-HDRIVQYYGCLRDLDQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVSYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTICM--------------SGTG---------IKSVTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIATQPTKPTLP-EGVSDASRDFLRQVFVE-EKWRPTADILLNHPFV 587          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 263.848 bits (673), Expect = 7.260e-75
Identity = 204/598 (34.11%), Postives = 295/598 (49.33%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILV-TSNIPHRVASSSVSDYSIHKS-------------------------YHTRPGSPPPGYLHPNDVHVERSTSFPISHVDGEFIPED------DAIXXXXXXXXXXXXXXXXLIDTN-WGGSGRRQKLSNLKSHSELPDEPGIHQQKIGTFPLRVHPSTYTKPEG--RQTLPH--IRNSEMFQQIIXXXXXXXXXXXXXFYLPSLMLDKTMTKS------KAP-SLVDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRD--NFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            LRVK E + + R +   RP+K +EL QK++ +      +        KE+   +  Q +L+Q V     +     LRIL+ T    H +  +S    S  KS                          HT   SPPPG +      + R  S+   H +GEFIPE+      D   ++ +  SS   S    +D+  +  + R     NL    +     G H  K GTFP +      +K  G  R+TLP   +    +FQ + SS   + +  S   +     L ++  KS      K+P + V++++G LLGRG FG+VY C D+++GRE A K+V    P+        K+   LE EI + K L  H RIVQYYG  RD     + IF+E+M GGS+KDQL+ YG L  +V  +YT+QILQG+++LH  +I+HRDIK ANILRD  GNVKL DFGAS+ +++I +              S  G         + S  GT Y+M+PEVI GE Y   AD+WS+  TVVEMLT  PP+ + E  AA+++IA        P E +S     F+ Q+F+   + R TA+ LL+  F+
Sbjct:   60 LRVKLEHEREKRIIPFQRPLKIKELLQKVTEAFGQQMDMFFL----EKELVLPLKTQEDLDQAVLAGSSSVTNGLLRILLKTPQNNHYLQVNSRDKQSEMKSSRSLGDLKGSLLKSSERVRKHSTGSMHTGRTSPPPGSVPEEQQQIARQGSYTSIHSEGEFIPENPDQNMLDPFGSAGNSLSSSCQSIDQALDSPPFSQNNRDNNYLNLNYEYK-----GRHG-KGGTFPRQFQLPNRSKDYGDRRRTLPRSFMPQENLFQLVPSSRTRSYNGESTLQFTELRSLGRSADKSCQRGTAKSPRAPVNWRQGKLLGRGAFGEVYLCYDADTGRELAAKQV----PFDPDCQETSKEVNALECEIQLLKNLR-HDRIVQYYGCLRDLDQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVSYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTICM--------------SGTG---------IKSVTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIATQPTKPTLP-EGVSDASRDFLRQVFVE-EKWRPTADILLNHPFV 617          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 263.848 bits (673), Expect = 7.260e-75
Identity = 204/598 (34.11%), Postives = 295/598 (49.33%), Query Frame = 3
Query:  132 LRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILV-TSNIPHRVASSSVSDYSIHKS-------------------------YHTRPGSPPPGYLHPNDVHVERSTSFPISHVDGEFIPED------DAIXXXXXXXXXXXXXXXXLIDTN-WGGSGRRQKLSNLKSHSELPDEPGIHQQKIGTFPLRVHPSTYTKPEG--RQTLPH--IRNSEMFQQIIXXXXXXXXXXXXXFYLPSLMLDKTMTKS------KAP-SLVDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRD--NFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            LRVK E + + R +   RP+K +EL QK++ +      +        KE+   +  Q +L+Q V     +     LRIL+ T    H +  +S    S  KS                          HT   SPPPG +      + R  S+   H +GEFIPE+      D   ++ +  SS   S    +D+  +  + R     NL    +     G H  K GTFP +      +K  G  R+TLP   +    +FQ + SS   + +  S   +     L ++  KS      K+P + V++++G LLGRG FG+VY C D+++GRE A K+V    P+        K+   LE EI + K L  H RIVQYYG  RD     + IF+E+M GGS+KDQL+ YG L  +V  +YT+QILQG+++LH  +I+HRDIK ANILRD  GNVKL DFGAS+ +++I +              S  G         + S  GT Y+M+PEVI GE Y   AD+WS+  TVVEMLT  PP+ + E  AA+++IA        P E +S     F+ Q+F+   + R TA+ LL+  F+
Sbjct:   60 LRVKLEHEREKRIIPFQRPLKIKELLQKVTEAFGQQMDMFFL----EKELVLPLKTQEDLDQAVLAGSSSVTNGLLRILLKTPQNNHYLQVNSRDKQSEMKSSRSLGDLKGSLLKSSERVRKHSTGSMHTGRTSPPPGSVPEEQQQIARQGSYTSIHSEGEFIPENPDQNMLDPFGSAGNSLSSSCQSIDQALDSPPFSQNNRDNNYLNLNYEYK-----GRHG-KGGTFPRQFQLPNRSKDYGDRRRTLPRSFMPQENLFQLVPSSRTRSYNGESTLQFTELRSLGRSADKSCQRGTAKSPRAPVNWRQGKLLGRGAFGEVYLCYDADTGRELAAKQV----PFDPDCQETSKEVNALECEIQLLKNLR-HDRIVQYYGCLRDLDQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVSYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTICM--------------SGTG---------IKSVTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIATQPTKPTLP-EGVSDASRDFLRQVFVE-EKWRPTADILLNHPFV 617          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Planmine SMEST
Match: SMESG000024792.1 (SMESG000024792.1)

HSP 1 Score: 1127.85 bits (2916), Expect = 0.000e+0
Identity = 597/597 (100.00%), Postives = 597/597 (100.00%), Query Frame = 3
Query:   15 MADIEENIKNMLKVSLKKQTHSIINNNNTDDNEKVVGKMLRVKFEFDNQTRALSLPRPVKFEELYQKIXXXXXXXXXXILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILVTSNIPHRVASSSVSDYSIHKSYHTRPGSPPPGYLHPNDVHVERSTSFPISHVDGEFIPEDDAIXXXXXXXXXXXXXXXXLIDTNWGGSGRRQKLSNLKSHSELPDEPGIHQQKIGTFPLRVHPSTYTKPEGRQTLPHIRNSEMFQQIIXXXXXXXXXXXXXFYLPSLMLDKTMTKSKAPSLVDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFITSVSTD 1805
            MADIEENIKNMLKVSLKKQTHSIINNNNTDDNEKVVGKMLRVKFEFDNQTRALSLPRPVKFEELYQKISSSLNNLNGLILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILVTSNIPHRVASSSVSDYSIHKSYHTRPGSPPPGYLHPNDVHVERSTSFPISHVDGEFIPEDDAISTSQSGDSSYSSSRQSLIDTNWGGSGRRQKLSNLKSHSELPDEPGIHQQKIGTFPLRVHPSTYTKPEGRQTLPHIRNSEMFQQIISSSGHNSSNASNNFYLPSLMLDKTMTKSKAPSLVDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFITSVSTD
Sbjct:    1 MADIEENIKNMLKVSLKKQTHSIINNNNTDDNEKVVGKMLRVKFEFDNQTRALSLPRPVKFEELYQKISSSLNNLNGLILHYINPNKEIFGQITNQIELEQIVHCVDHNNKYRSLRILVTSNIPHRVASSSVSDYSIHKSYHTRPGSPPPGYLHPNDVHVERSTSFPISHVDGEFIPEDDAISTSQSGDSSYSSSRQSLIDTNWGGSGRRQKLSNLKSHSELPDEPGIHQQKIGTFPLRVHPSTYTKPEGRQTLPHIRNSEMFQQIISSSGHNSSNASNNFYLPSLMLDKTMTKSKAPSLVDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFITSVSTD 597          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Planmine SMEST
Match: SMESG000026756.1 (SMESG000026756.1)

HSP 1 Score: 221.09 bits (562), Expect = 4.389e-59
Identity = 115/285 (40.35%), Postives = 167/285 (58.60%), Query Frame = 3
Query:  921 YKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLS 1775
            +++G  +G G FG+ +K    ++ +E  +K   + S   Y    I K           Y ++  H  IVQY+GA      +YI+MEY+SGGS++DQ+++ G++ H  ++ Y+KQILQGLAFLH K IIHRDIK  NIL + +  +KLSDFG S+ LK  +  +  +N                       +FCGT  ++APE++  E Y   ADIWS GAT+ EMLTG  P+H +  +A +Y+I NT K+E+ P EP+S + + FIDQM    P+ERA+A SLLS
Sbjct:  551 FQEGEFIGSGSFGRAFKYKLPQNNKEIVIKYTEIDSESKYIERNINK-----------YVKIIRHINIVQYFGALEVCGKLYIYMEYLSGGSLEDQIKKLGSIAHEKIIFYSKQILQGLAFLHSKKIIHRDIKPGNILMNEEELIKLSDFGLSKSLKITTARDTIEN---------------------AKTFCGTPNYIAPEIVNEEPYDFPADIWSTGATITEMLTGLAPFHGMNQFAVIYKIGNTKKIEFTPREPVSEQFQIFIDQMLKPNPKERASAASLLS 803          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Planmine SMEST
Match: SMESG000026756.1 (SMESG000026756.1)

HSP 1 Score: 220.705 bits (561), Expect = 5.399e-59
Identity = 115/285 (40.35%), Postives = 167/285 (58.60%), Query Frame = 3
Query:  921 YKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLS 1775
            +++G  +G G FG+ +K    ++ +E  +K   + S   Y    I K           Y ++  H  IVQY+GA      +YI+MEY+SGGS++DQ+++ G++ H  ++ Y+KQILQGLAFLH K IIHRDIK  NIL + +  +KLSDFG S+ LK  +  +  +N                       +FCGT  ++APE++  E Y   ADIWS GAT+ EMLTG  P+H +  +A +Y+I NT K+E+ P EP+S + + FIDQM    P+ERA+A SLLS
Sbjct:  557 FQEGEFIGSGSFGRAFKYKLPQNNKEIVIKYTEIDSESKYIERNINK-----------YVKIIRHINIVQYFGALEVCGKLYIYMEYLSGGSLEDQIKKLGSIAHEKIIFYSKQILQGLAFLHSKKIIHRDIKPGNILMNEEELIKLSDFGLSKSLKITTARDTIEN---------------------AKTFCGTPNYIAPEIVNEEPYDFPADIWSTGATITEMLTGLAPFHGMNQFAVIYKIGNTKKIEFTPREPVSEQFQIFIDQMLKPNPKERASAASLLS 809          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Planmine SMEST
Match: SMESG000034928.1 (SMESG000034928.1)

HSP 1 Score: 212.616 bits (540), Expect = 6.908e-55
Identity = 126/268 (47.01%), Postives = 166/268 (61.94%), Query Frame = 1
Query: 3043 IVLIDAEYSTSESNLMVPLYIIIIN*YGKTIKNVYLTPREKVRHLNSRIHGITEGTSRNQNDQYEEMKEIQKLLSGK----Y*LVMTI*FLKIWTDQLYGVWNLATAQARQIMGLSRKREFFKLKTFIQERFDEQTQVCIHYALEDLNSMRKIYLEIENQWVDDIKVPKKLPSEKYSLDKYRRFNGNDTPTMTATTTSRGTVGILEDIVAIPVEINITFPVDMEIDIETPTDQLKFVTKIYLDPVEESLAVIINPVIQRIQISLERGP 3834
            I+ IDAEY +S+S  MVPL   I+N YGKTIK+VYLTPR  + H NS+IHGITE  SRNQ DQY  MKE+QKL+ GK    + L   I +LK+W D L+G+ +LATAQA + +G+ R+ EFFKLKT +QE F +Q  V IH ALED+ ++R                  K PS KYSL++YR+ + + + +MT         GI E       EI++T   DME D ET T QLK+ T+  ++ +E+SL +IIN  I RIQ   E GP
Sbjct: 1218 ILFIDAEYGSSKSKQMVPLSTAIMNYYGKTIKDVYLTPRGNLWHFNSQIHGITEVASRNQYDQYAIMKEVQKLVVGKILIDHDLHAEIQYLKLWIDHLHGIRDLATAQALEKIGMFRRGEFFKLKTVVQEMFGDQMWVAIHSALEDVRNIR------------------KQPSRKYSLEEYRKLHNSTSTSMT---------GITE-------EIDLTAAEDMETDGETQTVQLKWATEESIEIIEKSLGLIINEPIHRIQPIFEHGP 1451          

HSP 2 Score: 107.842 bits (268), Expect = 6.327e-26
Identity = 58/109 (53.21%), Postives = 74/109 (67.89%), Query Frame = 1
Query: 5140 HLTSSGKIRDFNSRIHGIVEVTSRNQ*DQFTEMKDIQWLMVGKILVGHDLQAERQYL*IWTDQLYGIRDFAVAQVLLH-------DWFKLLTVVKEIFVKKQ-IGIHSA 5442
            +LT  G +  FNS+IHGI EV SRNQ DQ+  MK++Q L+VGKIL+ HDL AE QYL +W D L+GIRD A AQ L         ++FKL TVV+E+F  +  + IHSA
Sbjct: 1252 YLTPRGNLWHFNSQIHGITEVASRNQYDQYAIMKEVQKLVVGKILIDHDLHAEIQYLKLWIDHLHGIRDLATAQALEKIGMFRRGEFFKLKTVVQEMFGDQMWVAIHSA 1360          

HSP 3 Score: 31.5722 bits (70), Expect = 6.327e-26
Identity = 18/45 (40.00%), Postives = 27/45 (60.00%), Query Frame = 2
Query: 5009 KEIYPDEIHKRILFINAKYST*EI**TTLLTVPIMNYNGKIKKTI 5143
            KE+  +EI  +ILFI+A+Y + +      L+  IMNY GK  K +
Sbjct: 1207 KEMNQEEIRSKILFIDAEYGSSKSKQMVPLSTAIMNYYGKTIKDV 1251          
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Planmine SMEST
Match: SMESG000071511.1 (SMESG000071511.1)

HSP 1 Score: 188.734 bits (478), Expect = 2.862e-53
Identity = 110/291 (37.80%), Postives = 164/291 (56.36%), Query Frame = 3
Query:  918 DYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKDAECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLRQYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLSDFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVN-SFCGTFYFMAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTSKVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFI 1787
            +Y+K   +G+G FG V+KC++  S + FA+K VIL         AI K    L +EILI +E+  H+R+V++YG+K  +F++ IF E+++ GS++D + + G L  +   KYT++ L+GL FLH+  +IHRDIK  NIL     ++KL+DFG S+ ++                          NKS + N +FCGT YFMAPE+I    YS+S DIW+LG TVVEMLTG P +  L P   +  I N +  + K +   + E+  F   +F+     R  A  LL C F+
Sbjct:    6 EYEKLEKVGQGSFGTVWKCVEKSSRKVFALKVVIL-------DIAILKS---LISEILILREIANHERLVKFYGSKLVDFSICIFTEFVTKGSLRDVINKNGNLTVKQTAKYTRESLEGLDFLHEHNVIHRDIKCGNILLTEHDHIKLTDFGLSKCVE--------------------------NKSVIDNHTFCGTLYFMAPEIIEKTGYSSSIDIWALGVTVVEMLTGAPVFISLPPMLFILAILNFNPNDIK-IPNGTNELSYFFKLVFVKNAASRPKARDLLRCKFL 259          
The following BLAST results are available for this feature:
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP3K31.093e-8335.71mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K31.219e-8335.12mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K31.717e-8335.12mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K31.786e-8335.71mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K31.786e-8335.71mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cst-23.864e-3833.68Caenorhabditis STE20-like kinase [Source:UniProtK... [more]
gck-12.854e-3732.12Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-13.680e-3731.23Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
cst-13.863e-3733.68Serine/threonine-protein kinase cst-1 Serine/threo... [more]
cst-13.955e-3733.68Serine/threonine-protein kinase cst-1 Serine/threo... [more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pak1.210e-3732.53gene:FBgn0267698 transcript:FBtr0334539[more]
Pak1.210e-3732.53gene:FBgn0267698 transcript:FBtr0081714[more]
Pak1.210e-3732.53gene:FBgn0267698 transcript:FBtr0081716[more]
Pak1.210e-3732.53gene:FBgn0267698 transcript:FBtr0081715[more]
Pak1.210e-3732.53gene:FBgn0267698 transcript:FBtr0334544[more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k33.294e-8434.98mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k36.265e-8435.29mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k34.229e-8034.62mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k21.154e-7734.78mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k21.730e-7734.80mitogen-activated protein kinase kinase kinase 2 [... [more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
samd82.194e-8234.19sterile alpha motif domain containing 8 [Source:Xe... [more]
samd83.670e-8134.21sterile alpha motif domain containing 8 [Source:Xe... [more]
MAP3K23.067e-7333.66mitogen-activated protein kinase kinase kinase 2 [... [more]
MAP3K21.007e-7134.24mitogen-activated protein kinase kinase kinase 2 [... [more]
dennd1a6.386e-6737.08DENN domain containing 1A [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Map3k39.422e-8435.23mitogen-activated protein kinase kinase kinase 3 [... [more]
Map3k25.085e-7533.88mitogen-activated protein kinase kinase kinase 2 [... [more]
Map3k192.486e-4033.44mitogen-activated protein kinase kinase kinase 19 ... [more]
Map3k152.958e-3836.61mitogen-activated protein kinase kinase kinase 15 ... [more]
Map3k193.162e-3833.44mitogen-activated protein kinase kinase kinase 19 ... [more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99759|M3K3_HUMAN5.249e-8335.71Mitogen-activated protein kinase kinase kinase 3 O... [more]
sp|Q61084|M3K3_MOUSE6.591e-8335.23Mitogen-activated protein kinase kinase kinase 3 O... [more]
sp|Q9Y2U5|M3K2_HUMAN2.580e-7433.93Mitogen-activated protein kinase kinase kinase 2 O... [more]
sp|Q61083|M3K2_MOUSE1.312e-7133.55Mitogen-activated protein kinase kinase kinase 2 O... [more]
sp|Q9CAD5|YODA_ARATH1.980e-5040.27Mitogen-activated protein kinase kinase kinase YOD... [more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2I3TPU45.221e-8335.93Mitogen-activated protein kinase kinase kinase 3 O... [more]
A0A2R9B6G66.311e-8335.93Mitogen-activated protein kinase kinase kinase 3 O... [more]
A0A452HBA11.156e-8235.36Mitogen-activated protein kinase kinase kinase 3 O... [more]
G3P5R11.286e-8234.63Mitogen-activated protein kinase kinase kinase 3 O... [more]
A0A3B4A3L42.119e-8236.24Mitogen-activated protein kinase kinase kinase 3 O... [more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k38.649e-8335.09mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k38.649e-8335.09mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k38.649e-8335.09mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k221.262e-7635.18mitogen-activated protein kinase kinase kinase 3-l... [more]
map3k221.280e-7635.18mitogen-activated protein kinase kinase kinase 3-l... [more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k21.403e-7632.92mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k197.381e-4433.56mitogen-activated protein kinase kinase kinase 19 ... [more]
pak41.852e-3431.45p21 protein (Cdc42/Rac)-activated kinase 4 [Source... [more]
MAP4K34.692e-3431.89mitogen-activated protein kinase kinase kinase kin... [more]
ENSPMAT00000006402.16.722e-3432.28pep scaffold:Pmarinus_7.0:GL481397:10373:21355:-1 ... [more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
BCK14.497e-4536.64MAPKKK acting in the protein kinase C signaling pa... [more]
CDC155.189e-4035.37Protein kinase of the Mitotic Exit Network; locali... [more]
STE114.396e-3932.50Signal transducing MEK kinase; involved in pheromo... [more]
SSK22.168e-3731.73MAP kinase kinase kinase of HOG1 mitogen-activated... [more]
KIC12.118e-3632.65Protein kinase of the PAK/Ste20 family, required f... [more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO414108.180e-6942.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478211.201e-4534.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428455.872e-3933.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361509.273e-3933.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458464.509e-3531.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k34.267e-8335.69mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k21.599e-7833.60mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k225.013e-7534.11mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k227.260e-7534.11mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k227.260e-7534.11mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024792.10.000e+0100.00SMESG000024792.1[more]
SMESG000026756.14.389e-5940.35SMESG000026756.1[more]
SMESG000026756.15.399e-5940.35SMESG000026756.1[more]
SMESG000034928.16.908e-5547.01SMESG000034928.1[more]
SMESG000071511.12.862e-5337.80SMESG000071511.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032406 ID=SMED30032406|Name=Mitogen-activated protein kinase kinase kinase 3|organism=Schmidtea mediterranea sexual|type=transcript|length=6484bp
TAAATCTTATATGAATGGCTGATATAGAGGAAAACATAAAAAATATGCTG
AAAGTTTCTTTAAAGAAACAAACACACTCTATTATCAATAATAACAATAC
AGATGATAATGAGAAAGTTGTTGGTAAAATGTTGCGAGTTAAATTTGAAT
TTGATAATCAAACAAGAGCATTGAGTTTACCTCGTCCTGTGAAATTTGAG
GAACTATATCAAAAAATTAGCTCGTCTTTGAATAATCTCAATGGTTTGAT
TTTGCATTATATCAATCCCAACAAGGAGATCTTTGGACAAATTACCAATC
AAATCGAACTAGAGCAAATTGTACACTGTGTCGATCACAACAATAAATAT
CGCAGCTTGAGGATTCTAGTGACCTCGAACATTCCACATAGAGTAGCTTC
TTCATCTGTATCAGATTATTCCATCCACAAATCATATCACACTCGCCCAG
GCTCACCGCCTCCTGGCTACCTTCATCCCAATGATGTTCATGTCGAACGC
AGCACCAGTTTCCCAATTTCACATGTGGATGGGGAATTCATCCCAGAAGA
TGATGCCATATCAACTTCACAATCTGGAGATTCTTCTTATTCCAGCAGTC
GACAGAGTCTCATTGACACAAATTGGGGAGGCAGCGGTCGGCGGCAAAAG
TTATCTAATTTAAAAAGTCATTCCGAACTGCCAGATGAACCAGGTATACA
TCAGCAGAAAATCGGGACGTTCCCCCTGAGAGTCCATCCAAGCACATATA
CGAAACCGGAAGGCCGGCAAACTCTACCTCACATCAGAAATAGTGAAATG
TTTCAACAAATAATTTCGTCATCTGGTCACAATTCCTCCAATGCTTCTAA
CAATTTCTATTTGCCCAGTCTTATGCTTGATAAAACTATGACAAAATCAA
AAGCTCCGTCATTGGTCGACTACAAAAAAGGCCCATTATTGGGCCGAGGG
GGATTCGGGCAGGTTTACAAATGTCTGGACTCCGAATCTGGGAGAGAGTT
CGCCATGAAAGAGGTTATATTGGCATCGCCGTACGGATATTCGAGTGACG
CCATCAAGAAGGATGCAGAGTGCCTGGAGAACGAGATATTGATCTACAAA
GAGTTGACATGTCACCAGCGAATTGTACAATATTACGGGGCGAAACGAGA
CAATTTTGCGATGTACATATTCATGGAGTACATGTCTGGGGGCTCCGTGA
AGGATCAATTGCGTCAATATGGGACGCTGCCACATAGAGTTGTGGTCAAA
TACACAAAACAGATCCTGCAAGGCCTGGCGTTCCTCCATCAGAAGTTGAT
CATCCATAGAGACATCAAAGCTGCAAATATACTGAGGGATGTCGATGGCA
ACGTCAAGCTCAGTGATTTCGGGGCCAGCCGATATCTCAAATCGATATCA
ATCCACAATGTCAGCCAAAACTGCTCACTGATGAGCTCCATGAATTCCGC
TGCTGGTGCCAGTAAGCACAACAAAAGCGGATTGGTGAATTCATTTTGTG
GAACATTTTACTTCATGGCACCCGAAGTGATTCGGGGAGAATCCTACAGT
AATTCAGCTGATATCTGGTCTCTTGGCGCCACTGTTGTCGAGATGCTAAC
GGGAAATCCGCCGTATCATGATCTGGAGCCATATGCGGCGCTATATCGCA
TTGCAAACACCAGCAAGGTTGAATACAAGCCCGTTGAACCGATATCGAGA
GAAATGGAAGCCTTCATTGACCAAATGTTCATATCGATTCCCCAGGAGCG
AGCAACTGCTGAGTCGCTGTTGAGCTGTGCTTTCATCACATCAGTATCTA
CAGATTGATGCTGTCAGCAGCAGCAGCAGCAAATAACGGCAGCGACAAAT
AGACAGGCAGAGAGAGAGAGAGAGAGGAGGAGATGACACATGTCTGTATG
TGCCTGTGTGTGTGCGTGTGAATACGTATCCATTATTACTATTATTTTTA
TTATTATTATTAATATTATCAGTAGTTCTTGAAAGCCTCAAATCCCGAAG
TTCGAGATTTGAGACACACAAGAAGAACCACCATCCCATGTCTGCAGCCT
GGCGCAACCAACAGGAGGAATGGAACATTTTAATATTTAACTTATATAAA
TCATCCATAAATAGTATATAATTTCGATGCGAGTTGTCAAGAGACCTAGG
AACTTTTTTAATTAGAAAAGAACAACTTAGATTATAAGCAAAAAAAAATT
CCGTTATCTTTACCATAAATTAATCCGTGAACATGCTTCAATATTTCATG
TGTAGCAGATCTTTCAGTGGCAGCCTGCATAATTTATTTTTGCTTCAGAC
TGTAGAAGTCAATTGATTCGCAGGCTAGTTGTGCATCGGGTTTTCCGTTC
AAGTAGAGAAAAGAGAACATTTTGTTTGGGGTTTTGCGAGGCTTTTGGTG
CTGATCTAGGACATAGACTAATAAAAAAGTTCTAGTAATTAAATTCAAAA
AAAATTTAATCTTAAAATTATTATTGAAATTTATAATTATATGGAAATAA
ATAATTAAATGACAATCTCAGAATTTGCGCAGAATTTGTCGATTCTCCTT
TATAGCATCCATGAGTGGAACAACTTCACATATCAAGAACCAAACATGAA
GATCCAAAAAAATCATGTTGGCAAAATCTATTTTGCATAAACCACAATGC
GCAAGTATCAAAGTATCTCTGTGTCAATGATAAAAAATGAAGATACAAAT
ATTTAAATTAACAAGTAATGCGAGGATAAAACTAGGGGATCAGTCAGAAA
AGAAAGAAAGTGAGTGTCGAAATAATTAACAAAAAAGAAAAAGTATGTTA
TGAAATGCGTCAATGTTCTTCGTGGAAGATCCAGAAGAAAACACTAGCAA
AGAGACTGCGAGCGGCTAATGAAGATTCAATAGTTGCAATGGAAATAAGG
GCAGAAAAAGAGCTATAAGTAGTTCTACAGAGTAAATAACAATAAGAAAC
AAACCAAAAATTTCTGCCAATTACCGAAAAAATGTTAAAGAGAAAGAAGT
CATTTCTCAGAAAAATATGATGCTAGAAGAAATAAGAAATAAATAGTCTT
GATAGATGCTGAATATAGTACCTCAGAAAGTAATCTGATGGTGCCACTAT
ATATAATCATAATAAATTAGTATGGGAAAACAATTAAAAATGTATACTTG
ACTCCCAGAGAAAAGGTGAGGCACCTCAATTCCCGAATTCATGGCATTAC
AGAGGGTACCAGTCGTAATCAAAATGACCAATATGAAGAAATGAAGGAAA
TACAAAAACTGTTGTCAGGAAAATATTAATTGGTCATGACAATATAATTT
CTGAAAATATGGACAGATCAGCTATACGGTGTTTGGAACTTAGCAACGGC
ACAAGCTCGTCAAATTATGGGACTATCGAGAAAAAGGGAATTCTTTAAAT
TAAAAACTTTCATTCAAGAAAGGTTTGATGAACAAACGCAAGTTTGTATA
CACTATGCTTTAGAAGATCTGAATAGCATGCGGAAGATATATTTGGAAAT
TGAAAATCAATGGGTGGACGATATTAAAGTGCCAAAGAAACTACCATCAG
AGAAATATTCTTTAGACAAGTATCGTAGATTCAATGGAAATGACACACCG
ACAATGACAGCAACGACAACATCCAGAGGAACTGTTGGTATTCTTGAAGA
CATTGTGGCGATACCGGTGGAAATCAATATCACGTTTCCAGTAGACATGG
AAATAGATATCGAAACTCCTACTGATCAGTTAAAATTTGTAACTAAAATA
TATTTGGATCCAGTTGAAGAAAGTTTGGCAGTGATAATTAACCCAGTAAT
CCAGAGAATTCAAATATCGCTTGAGCGTGGGCCATTCTCTATTGAGAAAA
AAGCAGAAAAACAAGATATTTATCTAGAATAAAAGCCAGCCAAAGAATCA
TGGTGAATGGTATCGTTTATCGGCGCGAAAAAACATTTATTCGTTATGTA
AGTGACGCTGGCAAAATCGAACTGAATATTTATTAAAAAACGTTATTGTT
ATTTATATTTCAAAATAAAATATATCAAATAAATTAATTCCATTCCGAAA
AACAACAAAAAATATAAATAATATTAAATAAATGGAAACACTATAAGATA
GTCTTTATTAGCACTACCGAATTAATATTATTTCATGAATTATAGTAAAT
TATATTATTGGTATTAACATAAATTATTGTGAAATATTATTATTATAAAT
AAATAATTATTGTTACTACAAATTAAATATTATTTGTATTATTATTGTCA
TTAAAGGTATAATAAATGTCTTGGGAATCCAAAACCTCGAACTTCGAGAT
TCGAGACAACCAAGAAAAACCACTTCTCTTGCTTGCAGCCTGGCGTAACC
AACAGGAGAGGTGGTCTAAATGAAGTAGAATTTCCAAAAGAAGAAAAATA
AAGAAAGAATTCACCTATTTATATAATAAAAGAAAATGGAAAGGGAATCT
ATGGGAAAAAAGATAGAAGAAAATAACTAAGATGCAACAGAGCAAATCAG
AATTAGAAGTGGATACAAAATATCTACTAGTAACTGAAGAAATGCTGAAA
AAGAAGATGTCCTTTATTAGGAAAGGAATGAACCAAGAAGAAATACGAAA
TAGAATATTGTTTAGAGATGCGGAATTTAGGAAACTCAGAAAACGAACAA
ATGACACCATTTCAGAGAATAAATTGAAAAGGGTACCGGAAACATGTCTG
AAACCAATTGAAAAAAGTCTTGTCATAATAATAAGGATGCAGAAGAATTA
TGCCGGACAACAAAAGTATCAAATAGCAAATAATTTACAAATCTCAAATT
ACCTAAGAATAGAAGACCGAAAAATGAAAATCCAAATACATACAGTAAGC
CGAAAATCAGAGTTGAATCAATGAAGATCAATGAATGTTTTGAAAATAAA
AGCAAAAAATGAAGCGCATGAGTGTTATGTGCACAGCCAACTGAAAACAG
GACTCCAACAAGGTTTTAAATTTCAGAAGAAATCTTGAAGAAAGTGTTAT
TTATTAGAAAGGAAATATACCCTGACGAAATCCATAAAAGAATATTATTC
ATAAATGCCAAATACAGTACCTAAGAAATATAATAAACAACCCTCTTGAC
AGTCCCAATTATGAATTACAACGGAAAAATAAAAAAAACCATTTAACTTC
AAGTGGGAAAATACGAGATTTTAATTCAAGGATTCATGGAATCGTAGAAG
TGACCAGCAGAAATCAATGAGACCAATTTACTGAAATGAAAGATATTCAA
TGGTTGATGGTGGGCAAAATACTAGTTGGCCATGATCTACAAGCAGAGCG
TCAATATTTGTGAATATGGACAGATCAATTGTATGGAATTCGGGATTTCG
CAGTGGCACAAGTTCTTTTACACGATTGGTTTAAATTGCTAACTGTTGTA
AAGGAAATATTTGTAAAAAAACAGATTGGTATACATTCGGCCTGAAATGC
GTAAAAATTATTCTCAAGATATAGTAGTGAATGGAGCACCGATGAATTGA
CGATAAATCAAGGCCCAAAATGAACCATCAAAGCGATGTTTATTAGAAGA
AAATAGGAAGTTGTGTGAAATCAAATTCAAATTTGGCTGCATTACAAAAT
CAAGAAGATGATAAAGCAGATTGAGGTTTGAGAATTGGAAATCGAATCAG
CAAAAGAGCTGGTACAAGAAATGGAGTCGTAATTGGAGTGGTTTCTCAAG
ATGAATAACCAACTGTCACTCAATATTGATGAGCTGAAGCAGAAAGAGAA
ACAAGCAACAACAAACAAGCTACAAGAGATGTAAAGACCCAAGTACGACG
ATTCACAATCGATTTATATAATTGCGTCTGTCACATTCAAGAAGCATATC
CTAGAAGACGTGACCAATGAAGCATCCGTTGATGCGGCCATCAGAAGGAA
TTCACTCTAGAACGTTCCGTGGCATCATTGAGAAACAACTTATCGAAAGT
TTCGGAAATTCATTGAGCCGATTATGTCAGAATTATGCAGGTTCTGATTT
GGTGATTTTATCGGTGCGTTCTAGGAGAATGTCTCGCTTATCAAGGAAAT
AAACGATTTGCGAAAGGAACTGAAAACAGTAAGACATACAATCACGATCT
GGAGGCCGCTATGGAGCTGCACCGGAATCAGGGTGAAGATGCTAGACAAA
TAGTTGCTGCGGTGACGGCCAATAAATCGCAACCGTTGGTGGATAAGGAG
CTCGAAGAAGTAGCAGGACTAATTGAGATGCAGCGGGCGCTAATTGGTCA
ATTGAGGGCCAAAATTTTCGGCATGTAGAGTGGCCGATTAGCAAATAGCA
GTAAAAACCGGTGTAACACTGGGGCTGCAGATGAAATTGCATCCAGACCA
ATCCTCAGCGTATGAGAACTGGTGCCTCCAATTGACACGTTATGGAGCGG
ATGGTATCAAGTACTGTCCAGGTTGTGTGGCCGTAATGTGCACTGATAAT
GATGTTAGTAGCGCTAATGATAATAATATGTATA
back to top

protein sequence of SMED30032406-orf-1

>SMED30032406-orf-1 ID=SMED30032406-orf-1|Name=SMED30032406-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=172bp
MGLSRKREFFKLKTFIQERFDEQTQVCIHYALEDLNSMRKIYLEIENQWV
DDIKVPKKLPSEKYSLDKYRRFNGNDTPTMTATTTSRGTVGILEDIVAIP
VEINITFPVDMEIDIETPTDQLKFVTKIYLDPVEESLAVIINPVIQRIQI
SLERGPFSIEKKAEKQDIYLE*
back to top

protein sequence of SMED30032406-orf-2

>SMED30032406-orf-2 ID=SMED30032406-orf-2|Name=SMED30032406-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=131bp
MQQSKSELEVDTKYLLVTEEMLKKKMSFIRKGMNQEEIRNRILFRDAEFR
KLRKRTNDTISENKLKRVPETCLKPIEKSLVIIIRMQKNYAGQQKYQIAN
NLQISNYLRIEDRKMKIQIHTVSRKSELNQ*
back to top

protein sequence of SMED30032406-orf-3

>SMED30032406-orf-3 ID=SMED30032406-orf-3|Name=SMED30032406-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=598bp
MADIEENIKNMLKVSLKKQTHSIINNNNTDDNEKVVGKMLRVKFEFDNQT
RALSLPRPVKFEELYQKISSSLNNLNGLILHYINPNKEIFGQITNQIELE
QIVHCVDHNNKYRSLRILVTSNIPHRVASSSVSDYSIHKSYHTRPGSPPP
GYLHPNDVHVERSTSFPISHVDGEFIPEDDAISTSQSGDSSYSSSRQSLI
DTNWGGSGRRQKLSNLKSHSELPDEPGIHQQKIGTFPLRVHPSTYTKPEG
RQTLPHIRNSEMFQQIISSSGHNSSNASNNFYLPSLMLDKTMTKSKAPSL
VDYKKGPLLGRGGFGQVYKCLDSESGREFAMKEVILASPYGYSSDAIKKD
AECLENEILIYKELTCHQRIVQYYGAKRDNFAMYIFMEYMSGGSVKDQLR
QYGTLPHRVVVKYTKQILQGLAFLHQKLIIHRDIKAANILRDVDGNVKLS
DFGASRYLKSISIHNVSQNCSLMSSMNSAAGASKHNKSGLVNSFCGTFYF
MAPEVIRGESYSNSADIWSLGATVVEMLTGNPPYHDLEPYAALYRIANTS
KVEYKPVEPISREMEAFIDQMFISIPQERATAESLLSCAFITSVSTD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0000463cholinergic neuron
Vocabulary: INTERPRO
TermDefinition
IPR012337RNaseH-like_sf
IPR000270PB1_dom
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0005515protein binding
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 303..591
e-value: 2.4E-78
score: 276.3
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 303..590
e-value: 1.3E-63
score: 214.9
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 303..591
score: 46.591
IPR000270PB1 domainSMARTSM00666PB1_newcoord: 39..122
e-value: 0.0092
score: 25.2
IPR000270PB1 domainPFAMPF00564PB1coord: 41..120
e-value: 3.4E-6
score: 26.9
IPR000270PB1 domainPROSITEPS51745PB1coord: 39..122
score: 11.522
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 39..122
e-value: 5.2E-17
score: 63.8
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 285..594
e-value: 1.9E-74
score: 252.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 182..210
NoneNo IPR availablePANTHERPTHR45832FAMILY NOT NAMEDcoord: 274..591
NoneNo IPR availablePANTHERPTHR45832:SF5coord: 274..591
NoneNo IPR availableSUPERFAMILYSSF54277CAD & PB1 domainscoord: 40..119
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 309..332
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 302..594