Dachsous

Overview
NameDachsous
Smed IDSMED30032404
Length (bp)10181
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dachsous (SMED30032404) t-SNE clustered cells

Violin plots show distribution of expression levels for Dachsous (SMED30032404) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dachsous (SMED30032404) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dachsous (SMED30032404) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032404

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30032404h1SMcG0018952 SmedASXL_007558SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30032404h1SMcG0018952 Contig13714newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032404h1SMcG0018952 Contig13714uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30032404h1SMcG0018952 dd_Smed_v4_11744_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated epidermisSMED30032404h1SMcG0018952 dd_Smed_v4_11744_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dachsous vs. Ensembl Human
Match: DCHS1 (dachsous cadherin-related 1 [Source:HGNC Symbol;Acc:HGNC:13681])

HSP 1 Score: 277.715 bits (709), Expect = 1.398e-73
Identity = 432/1926 (22.43%), Postives = 779/1926 (40.45%), Query Frame = 2
Query: 2957 NGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNVFY-IHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQ-PHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHK------QMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVKIRIFVS--DLGFPKMTSSVDTLLK-----PLYEPKSEEFLINKN--------LTFIIPDHSQPGYVVGDLNIFPENYGAKCL-FISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRL----KNLEVVYSI---KQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVK-IADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEIHLV---SSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLTVVANDPDLGIFGRIIYS-LEGDTFDKKIFIDPSTGKL-SCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIF---VQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKP--PVNSEIFYVLNPGHSHI-QINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQ----PQKPLTKLSATDSDKTSN--ITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAI-FRVKENSVDGTFIGQIKMVNYCKDHSA-KFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEF-YSSQEEFLIDANGDVKTNIP-LNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFA-LTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDK---AIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSP---EKITSFNLSVQIEKENKGPN------------LIDNKYI----TLSLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYDPPSFQID-SSNILWWINGDLFESRIWNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHDIQYF---------LTP----HENFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIVENPSENFGINNETGAIYIK 8464
             G ++Y +      G ++PF + P +G L + ++L+   +    I+ ++ +               + V I++ N HSP L     F  + +    GT VG +   D D G NG +  SL+Q     + F I   +     ++    E  +SY     +++   D GSP +S+   + +  ++ N N P  +            Q+    P   G+ + T+ A DPD+G N    Y+  L     +  ++   +G + T   L  A+     + +S  D G P  ++S+  L++      L EP  +  L  ++        LT    +  +PG ++G +   PE  G   L +        +G   L   S +L L +         +    V  +    + +  L + V V       P F++D P  L + EN   G+ + +F          N +V Y +   + P     ++  TG L   R  DRET   +   VE      +  +           + DENDN P   SPS   VR+        +   +VA D D G  ++++Y++    DG F ++  +G + +V      + + + L V   D G  P+S + V ++    +  ++   F     S+ L    +  G  +  L  +      N  + Y    G  ++ FS+DP TG + T  ++ REE    E + + V  Q            + + ++  N++ P F  +   +++PE +       + A+DPD+G  G++ Y  L+GD       +D ++G+  +  PL+   +  + L+I A D      G+   +  ++    V +   H  AF    +S++V E+ P GT+L ++    P    N  + Y L  G +    +  ++GELRT   L  E       ++ A     +   + TT ++        +     P  +P+++ +P        P   L  L A D D  +N  I Y+   + P   T+      D  +G + +  S ++       L ++ +D G P++  T +I + L  + +     P  +    ++EN+  GT I   + V+    +    +SI+ G       +  STG I V +A  +D E   ++ L  Q   GG+    +  + + + D +DN P F +  +VAFL E +P + P++++   D D G   Q+ Y +     ++  F +D      T    L+    +   LV+ A+ + SP +     LTV +++ ND RP I  P   L++  +  +GS I ++T  D D    + Y +      +     +V    G + L+  L      +++  ++  D      A + + VED N++ P   ++   + L      GS IL + A D+D   NG +++ L S +  F +   D N   LF I      GH     + +   A D      +  A + V L+    + P    +H   + + E L  GS +      D D  +   A+ Y I     IS N    F+          +    PR L    C ++  P   E +T +NL+V      + P             + DN  +    +  + VPE     A + ++   D +   +     +V+   P  +     F++D SS  L   +    E++  +   ++V+A     +   L       V IEV  + + +      +  L+  + EN+PP T V  L     D   F           P     E F L  S  +     ++++   D+E  E++RL +    +     + S ++ V + V   DEY P F+  +F   V  G  + G  L    A+D+D G  G+V Y +  + S  FGIN  TGA+Y++
Sbjct: 1029 GGPITYHLAA---EGASSPFGLEPQSGWLWVRAALD-REAQELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSY----QLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVP--PGTLVTTLQAKDPDEGENGTILYT--LTGPGSELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPD--LAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAA-PEPAGVGALTYTLVGGADPEGTFALDAASGRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARD-PLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPSR--VRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGGDGHFRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPT-FQQQEYSVLLRE-NNPPGTSLLTLRATDPDVGANGQVTY---GGVSSESFSLDPDTGVLTTLRALDREE---QEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLEVPEGQDPQTLTMLRASDPDVGANGQLQYRILDGDP-SGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARDG-----GQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAV-DGAAAGPLSTTVSVTITVRDVNDHAPTFPT-SPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTTV------DSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSPRAVHAGGTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGA--FAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQP-WELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQDP---FSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADGFSV---DPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSH-YRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSI-----ISGNWGRVFQLEPRLAEAGESAGPGPRAL---GCLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGL-----FELDESSGTLRLAHALDCETQARHQ--LVVQAADPAGAHFALAP-----VTIEV--QDVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGE-----LRARVPFDYEHTESFRLLVGAADAG----NLSASVTVSVLVTGEDEYDPVFLAPAFHFQVPEGA-RRGHSLGHVQATDEDGGADGLVLYSLATS-SPYFGINQTTGALYLR 2871          

HSP 2 Score: 194.897 bits (494), Expect = 1.978e-48
Identity = 448/2042 (21.94%), Postives = 805/2042 (39.42%), Query Frame = 2
Query: 2666 YQIIQSQYSDWLSIHSKTGQIFLNKQFDRE---QVSYLVVTVQ--LKNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTN-VFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCP--LLSGSEIFTVNAVDPDKGLNSIFNYSIEL-AIDNEDQINIDSWTGLITT-----KVSLSCAQNVKIRIFVSDLGFPKM--TSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKF-LEIKENLPSGSHVASFNIRRLKNLEVVY--SIKQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIF---TVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDG--IFMINGDSGEI---HLVSSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXP-----QSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHD-------ASIYDLQRIFINIDYGNENPPRFSRS--------IFKVKLPEDEAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIF-IDPSTGKLSCS-PLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVL---GRINIVKPPVNSEIFYVL---NPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSD--KTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDIS---LNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSII-DGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIR-GYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLID-ANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDI-VVDDAR---FSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGS----KILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFA-------------LTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKAIFYKIDNFHPISNNLYLDFESGDLYLTKS-----------LNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEM--IQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESRIWNLTIMIVKAQKYQNSPSNLYENGYLFVNI--------EVPE----KMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHDIQYFLTPHENFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIVENPSENFGINNETGAIY 8458
            Y +    ++ W SI   +G I      D E   Q   +VV     L  L  SAT+ + L  ++ N  +P  + +  N +  + +  G     +  +DADS P G LSY +        + PF I+  +G +    +L+  +  PS   +  V   D G  K +   V + V + D N++ P          I   +  GT V  L   D D G +G +   +   +    F +++ S     +        NS  +   + + A D G         + I+ +     PP      +  Q +F  P  +  G+ +  V A +P   L  +   ++ L   D     ++D+ +GL+ T     +  L     +++R   +  G P     + V  LL  + +  S  F   ++ T ++P ++ PG  +  L     + G              G   +   +  + L++         + L +          +S+  + V+V  VG        +SP + +++     +G+ V     +      + Y  + +     F + P +G L      DRE   Q  + ++V+A   S  ++        + V I ++N++ P  LS   + + ++       S+ ++ ATD DSGPN +LTY +   S+    F I+  +GE+     +   + S+Y+L V V+D G  P+S +    +    +   S   FL  S +    LP     +   G ++  L         N  I Y L  G  +++FS+ P +G + T   + R E  +       V+  S HD       AS+  L ++  +     E PP  +          +  V   E     + L  VA  P+    G + Y+L G    +  F +D ++G+L  + PL+F     +    +  +  G +  R    +V + VQ+  +H  AF     +L + EN   G  L      +   P  NS++ Y L    P    ++++  TG L     L  E    + L + A  +  +    +       V + D NDN P+ A +P ++ +P    P      + A D D  + + ++Y+              + L   +G L +   +    +  H L V+ SD+G P +  T ++ +S   +N +    Q      + R  EN+  GT +  ++  +   D  A   +   GV+ E   L   TG +    A  +DRE+ ++I L       GS  +  +  V + V+D +D+ P F        + EGQ P+T +  L   DPD+G N Q++Y I        F++D A+G+  T  PL+   +  + L I+A     P + A   LTV +++ ND  P   +P  ++++  + P G+ + ++ A D D G +G ++Y +          FL +   SGE+  +  L       + F +  VD A     S+T  + I V D N+H P    +   + L       S     +  L A D+D   N  + + L  T P       D+ T  + +   P                A+ P+ R++ I A             + V L+      PR     S+E TI E+   G+ I         S +A+     N  PI+ ++    E G   +  S           L++ + PR  L++  A  G     T   L++Q   +N  P  +   Y+     +PE   ++ P +      +D+ S     Y  S+A  QP        F +D +         + +  IW  T +++ A   + SP+ L  +  L V +         +P+    ++  +     EI ++TG   ++ P    VL    WY  +     P + F +        G  +     LDFE  + Y+LQLL        R  + T++VE    D+++  P F    +   +    P  G  + +  A+D+D G  G +SY +  +P++ F ++   G ++
Sbjct:  510 YSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQDVNDN--EPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLD-RDQGPSSF-DFTVTAVDGGGLKSM---VYVKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQS-GLLTVAWPLARRANSVVQ---LEIGAEDGGGLQAEPSARVDISIVPGTPTPPIF----EQLQYVFSVPEDVAPGTSVGIVQAHNPPGRLAPV---TLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLGPVLELEVR---AGSGVPPAFAVARVRVLLDDVND-NSPAFPAPED-TVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGGPITYHLAAEGASSPFGLEPQSGWLWVRAALDREA--QELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPR-LSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPT-FLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLT-GPGSELFSLHPHSGELLTAAPLIRAERPHY------VLTLSAHDQGSPPRSASLQLLVQVLPSARLA-EPPPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAA-PEPAGVGALTYTLVGGADPEGTFALDAASGRLYLARPLDFEAGPPWRALTVRAEGPGGAGAR--LLRVQVQVQDENEHAPAFARDPLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFA-SPSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGG------DGHFRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLR--ENNPPGTSLLTLRATD--PDVGANGQVTYGGVSSESFSLDPDTGVLTTLRA--LDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLEVPEGQDPQT-LTMLRASDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYL---GAGTAGAFL-LEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTT--VDSYTGEIRVARSPV---------------ALGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPRFP-RASSEATIRENAPPGTPIV--------SPRAVHAGGTN-GPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQ-AESGGAFAFTVLTLTLQDANDNA-PRFLRPHYVAF---LPESRPLEGPLLQVEADDLDQGSGGQISY--SLAASQPARGL----FHVDPTTGTITTTA-ILDREIWAETRLVLMATD-RGSPA-LVGSATLTVMVIDTNDNRPTIPQPWELRVSEDALLGSEIAQVTGNDVDSGP----VL----WY--VLSPSGPQDPFSVG-----RYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGR-ANLTVLVE----DVNDNAPAFSQSLYQVMLLEHTPP-GSAILSVSATDRDSGANGHISYHLA-SPADGFSVDPNNGTLF 2432          

HSP 3 Score: 159.458 bits (402), Expect = 1.093e-37
Identity = 342/1588 (21.54%), Postives = 621/1588 (39.11%), Query Frame = 2
Query: 3134 PLETEVEISVRIIDANNHSPILISTNV-FYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLS-------KNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSI-ELAIDNEDQINIDSWTGLITTKVSLSCAQNV--KIRIFVSDLG-FPKMTSSVDTLL---KPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQ----LILLKDNLNVKNVH-YSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIR-------RLKNLEVVYSIKQPEK--YFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAP--TTENASIFQIVATDADSGPNSKLTYQINP----SSDGIFMINGDSGEI----HLVSSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLTVV-ANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCSPLNFMEKNIYN--LKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKP--PVNSEI-FYVLNPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRS----IQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIV-----SDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAK--FSIIDGVNHELVF-LHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVI-IHXXXXXXNKPVFSQNKFVAF------LNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIV----------NINDQRPKISIPN--RNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFSSTA---VIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKD-LRDNGKVTFELVSTSPWFGLRGFDNNTAALFL---IDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKA--IFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKEN-KGPNLIDNKYITL 7639
            P    VE++VR+ D N+H+P          + +   +GT       +D D G  G    +L      + F +E              V      E  + Y     + L A D GSP + +   L +  ++ N + P     + H   +    L  GS +  V A D D G+N    Y I     + +   +ID+ TGL+  +  L   Q    ++ +   D G  P++ S+  T+        +P      ++ + +  + + + PG +V  +++   + G    F     +   G  H    +Q     L+ +   L+ +    Y+L V         + +     + V  V  + P F +     L   E LP  +   SF +R       +  N +V YS+       +F I+P +G + T    D E E Q Q  V  +AT    P + +   + V + D NDNEP       +    S P  T       Q+ ATDADSGP   L+Y +      S    F I+  SG++     L      S+++  VT  D G +    S+V+   F S +  +  +F     + ++S  QS  G  + +L         +  + Y+++AG    +F++D  +G +     ++R     + +VQ+ +  +           R+ I+I  G   PP F +  +   +PED A    + +V A++P  G    +  SL G        +D  +G L    L  +++ +    L++      G+        +V + + +   ++ AF A   ++ +  N+  GT +  +  + P   VNS + F +L  G     ++ TTG +R   PL        EL + A       R+    ++     +  R +    N P       ++ +P+       + ++ A   D    ITY         +     + L+ +SG L++++++    +  + LKV+      ++ G  +   TV + I LNQ+    ++  +     V EN   GT +G++   +     + +  +S+         F +H  TG+  V     +DRE+     L  QV  GGS  R     + + V D++DN P F Q    A       + +  PP T V  L   DPD G N  + Y +    S+   L   +G++ T  PL    +  Y L + A  + SP   A  +L V ++          ++ ++ P   +P        +  RP GS +  + A +  G   ++Y +        T  L+ A  SG ++L+R L            V  +    + A    +++ V+D+N H P    +   + L  + + G+ +    A D D    N  V + L+   P       D  T AL     +D  +E      L ++ TD   +  +R  +  +  V +       P  +    + + +PE    G      V +D D  +A  + Y++ +      +  L   +G L + + L+   +   +L V  +  GSP +  +  L+V +   N + P     +Y  L
Sbjct:  122 PDGATVEVTVRVADINDHAPAFPQARAALQVPEHTAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDRENRSHYM----LQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHA--VVSESLAPGSPVLQVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISVSDPDDGD---FAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQ----LYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIV--VATDGGLPPLASSATVSVALQDVNDNEPQF---QRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGGGL---KSMVYVKVFLSDENDNPPQFYPREYAASISA-QSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLTVAWPLARRA---NSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHNPP-GRLAPVTLSLSGGDPRGLFSLDAVSGLLQT--LRPLDRELLGPVLELEVRAGSGVPPAFA-VARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPT-----YRVDLPSGTTAGTQVLQVQAQAPDG-GPITYHL-----AAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSI-LNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGE--VTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVLTVTAAEGLRP-GSLLGSVAAPEPAGVGALTYTLVGGADPEGTFALDAA--SGRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARDPLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLD--RETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAP--VFASPSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGG--DGHFRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVL 1657          

HSP 4 Score: 150.984 bits (380), Expect = 3.538e-35
Identity = 148/638 (23.20%), Postives = 266/638 (41.69%), Query Frame = 2
Query:  116 LIFSIKENVPIGEVVGQIES---PGFSPPFEMH--DFQEKKFI-----ISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDF-FTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNS--PPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDAISTSFDLEILNRS------PFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEIDSTILNENQHVTFVKTTKRLPTKP-----IFIFKIFVLNNLFKINETTGEILSKRSIDCGKYFFNVSMLSLKTNSLIDQTKLEIVVKSGRKLPLY------------------FDRGFRKILVTTG--KSQCFSEIAVRNRHCG--MRIQYSYDLLLKTDG--ILRINEH-GALCTAENVKHNKLMSTRYLYQIKALD 1882
            L   I E  P G ++G I +    G + P  M+    QE   +     I + +GV++ + ++DRE+++ Y F  ++ +G T  V +++ D+ND+ P F        +PE+   G++  L    D D G+   Q   +    + + F ++     +G     L++   LD E  S + L ++A DGG PP +A  L+ + + + ND+ P F+ SRY A + E        L+V A+D DAGV+G + Y ++      D  F++D  TG + L + LDFE+ + H + +  RD    P   ++ V V +   + N    ++  L   G  +++    P  +VA + ++D D      D   +N S       F L      ++ + +   +   + ++ NL + A D   P L    A  + + +      +F    ++ E    +      V  V+ T R P +       +        + F I+ T+G I +  S+D                 L  Q +L +V   G   PL                   F R F    +  G     CF ++   +   G    + YS    L + G    RI+ H G +CT   +  ++  S+ + + + A+D
Sbjct:   47 LDLQIDEEQPAGTLIGDISAGLPAGTAAPL-MYFISAQEGSGVGTDLAIDEHSGVVRTARVLDREQRDRYRFTAVTPDGATVEVTVRVADINDHAPAFPQARAALQVPEHTAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISVSDPD----DGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFV--VRVTARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLDY---------------ELEPQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSS-FDFTVTAVD 661          

HSP 5 Score: 122.865 bits (307), Expect = 1.274e-26
Identity = 332/1587 (20.92%), Postives = 596/1587 (37.56%), Query Frame = 2
Query:  179 GFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGD------TKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQ-FNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLS----------EINRDISPNTIVAHVKLTDYDAISTSFDLEILN-RSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEIDSTILNENQ----HVTFVKTTKRLPTKP--IFIFKIFVLNN---LFKINETTGEILSKRSIDCGKY---------------------FFNVSMLSLKTNSLIDQTKLEIVVKSGRKLPLYF-DRGFRKILVTTGKSQCFSEIAVRNRHCGMRIQYSYDLLLKTDGILRINEH-GALCTAENVKHNKLMSTRYLYQIKALDETNS--SAVCVVLFAIQPSKVFDVLPTEI-----NITLPIIDSPKFNFSLPIGKIIGTFSKLPPAQFIGFIQYHLVPEELSTGAITVDSQSGEI-LMKKFPIHKNPIRLIVKSVIRKPFNVSP------LNIVAINFQKLFFARSLYQFILTKSEIKGNLVKIGQVS-MDSSCTES-VSYDLFGVKNDHSHFTIDVATGVIYG-KDLGSISNKTLMFQVSA------KAPKSQTSFAQVIIYIEDGIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSDEYQI---IQSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIG---SATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNN-PFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLE-----TINSYFEP-LNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVKIRIFVSDL-----GFPKMTSSVDTLLKPL--YEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFI------SNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLK--NLEVVYSI--KQPEKYFVINPVTGQLV--TFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPS-SSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPS--SDGIFMIN 4615
            G SPP          F + + +G++ V+  + R   ++    I + +G       +  V I I+      P F    +  S+PE+   G+ V +    +P  G+ +  ++ +  GD   +F++D   + +G+    L   + LD E++     L ++A   G PP  A   V++++ + NDN P F        +  +         +RA D D+GV+  + + L   +     FTVD  TG+V L + L      +H + +  RD   P  TS   + +           +Q + T GL+          ++    +  T V  V+    D    ++ L      SPF L      +W    ++           L + AV   +  L   Q  T  +  SIL +N  S  R   +     + ENQ     V  V  T R  + P     + +  L+     F+I+  TGE+ + +++D  +                        +V++L L  NS    T L+    +G  LP+   DR     LVTT        +  ++   G      Y L      +  ++ H G L TA  +   +     Y+  + A D+ +   SA   +L  + PS      P ++        +P++ +      L  G ++G+ +   PA  +G + Y LV      G   +D+ SG + L +       P    +      P           + +   N     FAR      L ++   G  +   + S  D     S V Y L   +       +D  TG +   + L   +   L+  V A       + +     +  +   ++  + P F  S   V + E+   G   + V  + P + +  ++   + S       +HS TG + + +  DREQ +  V+TV   +      SAT  L +++ D+ND  P  +  + +    + +  G     L+ +D D   NG ++Y        G+++  F ++P TG L  + +L+         INL V   D G   P  T V + V + D N+H+P   S    ++      G +  TL +      + G            Q   ++      FV+ + S E      ++   EP   + + A D G P+ S+ + L +  +++N + P   +P    ++    P  +G+ +  + A DPD G N    Y   L         ++  +G + T  +L   Q       VS +     G    T SV   ++ +  + P      +   L    P  S P   +  L     + GA    +          T+VD +      + ++ + +  + +      L +V       + S+   I V +       P F + S +   I+EN P G+ + S         N  + YSI     +  F I P TG +   +    D E   +++    V+         FTVL L ++  D NDN P  L P   + +  S P      + Q+ A D D G   +++Y +  S  + G+F ++
Sbjct:  727 GNSPPL---------FTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHNP-PGRLAPVTLSLSGGDPRGLFSLD---AVSGL----LQTLRPLDRELLGPVLELEVRA-GSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTL--LAGGGGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPRTSHFRLRVV----------VQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGGPITYHLAAEGASSPFGLEPQSGWLWVRAALD---REAQELYILKVMAVSGSKAELG-QQTGTATVRVSILNQNEHS-PRLSEDPTFLAVAENQPPGTSVGRVFATDRD-SGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNS---PTFLQASGAAGGGLPIQVPDRVPPGTLVTT--------LQAKDPDEGENGTILYTLTGPGSELFSLHPHSGELLTAAPLI--RAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPEPAG-VGALTYTLVGGADPEGTFALDAASGRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARDPLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVF-ASPSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGGDGHFRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYG-------GVSSESFSLDPDTGVLTTLRALDREEQE---EINLTVYAQDRG-SPPQLTHVTVRVAVEDENDHAPTFGSA---HLSLEVPEGQDPQTLTMLRASDPDVGANGQ-------LQYRILDGDPSGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVP--AGTLLLQLQAHDPDAGANGHVTYY--LGAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTTVDSY------TGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSE-ATIRENAPPGTPIVSPRAVHAGGTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRL---VLQAESGGAFAFTVLTLTLQ--DANDNAPRFLRPHYVAFLPESRPL--EGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVD 2223          

HSP 6 Score: 121.709 bits (304), Expect = 2.755e-26
Identity = 257/1212 (21.20%), Postives = 462/1212 (38.12%), Query Frame = 2
Query:  347 ILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD-NSPP--FHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYD-AISTSFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEID-----STIL----------NENQHVTFVKTTKRLPTKPIFIFKIFVLNNLFKINETTGEILSKRSID---CGKYFFNVSMLSLKTNSLIDQT-KLEIVVKS-GRKLPLYFDRGFRKILVTTGKS-----QCFSEIAVRNRHCGMRIQYSYDLLLKTDGILRINEHGALCTAENVKHNKLMSTRYLYQIKA-LDETNSSAVCVVLFAIQP----SKVFDVLPTEINI------TLPIIDSPK----------FNFSLPIGKIIGTFSKLPPAQFIGFIQYHLVPEELSTGAITVDSQSGEILMKKFPIHKNPIRLIVKSVIRK--PFNVSPLNIVAINFQKLFFARSLYQFILTKSE-IKGNLVKIGQVSMDSSCTESVSYDLFGVKNDHSHFTID-----VATGVIYGKDLGSISNKTLMFQVSAKAPKSQTSFAQVIIYIEDGIHQPGFDFSDLLVNIWENTTVGIEIMQV----FPKYPSVSDEYQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNG-PFKPLETEVEISVRIIDANNHSP-ILISTNVFYIHQTAVYGTEVGTL-LXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINS--YFEPL--------NVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVKIRIFV 3757
            + D NDN P F A+     +PE+ P G         DPD G+ +  S R+ SG  +  F +  H S+  +  VR      LD E  ++  L + A D G PP  A+ ++ + V + ND  P F    Y   ++E+     + L +RATD D G +G++ Y       SS+ F++D  TG +   ++LD E+ +  ++++  +D  SPP   H +    + D  D      S  +       E+     P T+   ++ +D D   +      IL+  P     +     E   +  +      +  L ++A D  +P+LS T  LT+ + ++     +F    + VE+       T+L            N HVT+              +        F +  ++GE+ +  ++D   C  Y F+VS +       +  T  + I V+      P +     R  L   G S        + +   +R  G      Y L         ++ +                 R L+ +   L     SA  V++  +Q        F    +E  I        PI+ SP+            +S+  G   GTFS  P                 STGAITV S  G      F +    +RL++++       F V  L +   N     F R  Y   L +S  ++G L+++    +D      +SY L   +     F +D     + T  I  +++ + +   LM      +P    S    ++ I+   ++P        + + E+  +G EI QV        P +   Y +  S   D  S+    G++ L    D EQ     + +   +       +L + + D+NDN P    S       + +  G     +  +D DS  NG++SY +    P    + F ++P  G L  I        + SG +++++   D+G P +       + V++ D N+H+P   +S     + +    G+ + TL     +    +  ++ S+   ++ + F +E                +      EPL        N+ + A DRG P +SSV+ + +  ++ N NPP          +    P+  G+E+  V A D D G + +  +++  + D      +D  +G +    +L C    + ++ V
Sbjct: 1536 VTDENDNAPVF-ASPSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASG-GDGHFRL--HSSTGALSVVR-----PLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTY----GGVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSL-----EVPEGQDPQTLT-MLRASDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTY--------------YLGAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIV-SPRAVHAGGTNGPITYSILSGNEKGTFSIQP-----------------STGAITVRSAEG----LDFEVSPR-LRLVLQAESGGAFAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLM-ATDRGSPALVGSATLTVMVIDTNDNRPTIP-QPWELRVSEDALLGSEIAQVTGNDVDSGPVL--WYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLA--SPA---DGFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGR--AARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPV--GAELLHVEASDADPGPHGLVRFTVS-SGDPSGLFELDESSGTLRLAHALDCETQARHQLVV 2677          

HSP 7 Score: 94.7449 bits (234), Expect = 4.090e-18
Identity = 62/218 (28.44%), Postives = 106/218 (48.62%), Query Frame = 2
Query:  329 KNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSV--RIVSGDSEKVFAIDYHDSSNGIFYVR-------LILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD 955
              V +++ D ND+ P F  +++  ++ E+ P GS +      D D G  S  +V   I+SG+  +VF ++   +  G            L+L + LD+E ++Q+NL + A D G PP  + + V + V + NDN P F  + Y  ++ ED  +    L V A+D D G  G + + + +  PS   F +D  +G + L  +LD E    H + +   D
Sbjct: 2466 ATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDAD-GSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSG-LFELDESSGTLRLAHALDCETQARHQLVVQAAD 2681          

HSP 8 Score: 92.4337 bits (228), Expect = 2.098e-17
Identity = 62/204 (30.39%), Postives = 97/204 (47.55%), Query Frame = 2
Query:  359 NDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAID--GGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSS---DFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD 955
            NDN P F   ++  ++PE+ P+G+++      D D G + +    + SGD   +F +D    S+G     L L  +LD E  ++  LV+QA D  G H  L     V I VQ+ ND+ P F ++    S+ E+Q        + A D DAG  G L Y L    P     + F ++  TG +  R   D+E ++S  + +G  D
Sbjct: 2596 NDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELD---ESSGT----LRLAHALDCETQARHQLVVQAADPAGAHFALAP---VTIEVQDVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTESFRLLVGAAD 2789          

HSP 9 Score: 85.5001 bits (210), Expect = 2.413e-15
Identity = 64/272 (23.53%), Postives = 123/272 (45.22%), Query Frame = 2
Query:  215 EKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNG---DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVS-------------GELFYFLDNTSPSSDFFTVDHKT-GNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTS 979
            +  F + +  G + ++G +D E+ + Y   +++ +G      N+ + + DVNDN P F+ + ++  + E+ P GS +   +  D D G N   S  + S      F++D    +NG  +  ++   +L ++     ++V++A D G P   A   V + +Q+ ND+ P F +S Y  ++ ED     T L + ATD D   S             G +F      + + +      +  G + L + LDFE    +++++   D   P  +S
Sbjct: 2319 QDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLAS--PADGFSVD---PNNGTLFT-IVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQSS 2584          

HSP 10 Score: 84.7297 bits (208), Expect = 3.732e-15
Identity = 69/274 (25.18%), Postives = 124/274 (45.26%), Query Frame = 2
Query:  125 SIKENVPIGEVVGQIESPGFSP-PFEMHDFQEKK------FIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKN-----VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGK-NSIQSVRIVSG---DSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLR 898
            ++ E+ P+G  +  +E+    P P  +  F          F + +++G ++++  +D E Q  +  ++ + +    +     V I++ DVND+ P F       S+ EN P G+ V      D D G    ++   + +G   +  + FA++   SS G    R+      DYE    F L++ A D G+  L AS+ V ++V   ++  P F    +   + E      +   V+ATD D G  G + Y L  +SP   +F ++  TG +YLR
Sbjct: 2610 TVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAADPAGAHFALAPVTIEVQDVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALN---SSTGELRARV----PFDYEHTESFRLLVGAADAGN--LSASVTVSVLVTGEDEYDPVFLAPAFHFQVPEGARRGHSLGHVQATDEDGGADGLVLYSLATSSP---YFGINQTTGALYLR 2871          

HSP 11 Score: 82.4185 bits (202), Expect = 1.996e-14
Identity = 79/311 (25.40%), Postives = 124/311 (39.87%), Query Frame = 2
Query:  122 FSIKENVPIGEVVGQI------ESPGFSPPFEMHDFQE--KKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGD------TKNVQIKILDVNDNEPKF------NATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASL-LVKIIVQNANDNVPKFDISRYIASIKEDQEINIT---------FLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSP 964
             ++ EN P G  VG++        P     + +    E  K F I   TG +     +DRE+Q+ Y  L+   +G       T  V + +LD+NDN P F              +P+  P G+ V      DPDEG+N    +  ++G   ++F++  H          L+    L       + L + A D G PP  ASL L+  ++ +A    P  D++    +      + +T          L   A    AGV G L Y L   +     F +D  +G +YL + LDFE       ++ VR   P
Sbjct: 1112 LAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGT-ILYTLTGPGSELFSLHPHSG-------ELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPEPAGV-GALTYTLVGGADPEGTFALDAASGRLYLARPLDFEAGPPWR-ALTVRAEGP 1412          

HSP 12 Score: 71.633 bits (174), Expect = 3.649e-11
Identity = 99/449 (22.05%), Postives = 179/449 (39.87%), Query Frame = 2
Query:  125 SIKENVPIGEVV---GQIESPGFSPPFE---MHDFQEKKFIISKTTGVIKV---SGL-----------IDREKQNLYSFLIISMNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQS-----LDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDAIST---SFDLEILNRSPFQLIKILPKMWELKLIND---IGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEI 1378
            +I+EN P G  +     + + G + P     +   ++  F I  +TG I V    GL           +  E    ++F ++++          + D NDN P+F   ++   +PE+ P+   +      D D+G     S           +++     + G+F+V            LD EI ++  LV+ A D G P L  S  + ++V + NDN P      +   + ED  +     +V   D D+G    L+Y L  + P  D F+V    G V L   LDFE+   + + +   D   P        ++     ++ P   Q L+   L E      P + +  V  TD D+ +    S+ L     SP     + P    L  I     +G+  S ++++ L+A D+  P  +    + +++ +      SF+ S ++V +
Sbjct: 2076 TIRENAPPGTPIVSPRAVHAGGTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFTVLTLT---------LQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQIS-----------YSLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIP-QPWELRVSEDALLGSEIAQVTGNDVDSGPV--LWYVLSPSGP-QDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDG--PHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLE---HTPPGSAILSVSATDRDSGANGHISYHLA----SPADGFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAV 2491          

HSP 13 Score: 71.633 bits (174), Expect = 4.035e-11
Identity = 70/285 (24.56%), Postives = 124/285 (43.51%), Query Frame = 2
Query:  119 IFSIKENVPIGEVVGQIES---PGFSPPFEMH---DFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDT--------KNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDN--VPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSK 925
            +FS+ E+V  G  VG +++   PG   P  +          F +   +G+++    +DRE   L   L + +   +          V++ + DVNDN P F A      +P N   G+ +      DPD G NS  +  +++G     F +   D + G  +VRL+  + L         L ++A DGG PP  +   ++++VQ+       P+F+   Y   +          L+V+A   D    G + Y L     SS  F ++ ++G +++R +LD E  +
Sbjct:  796 VFSVPEDVAPGTSVGIVQAHNPPGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDREL--LGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGG-GAFTV---DPTTG--HVRLM--RPLGPSGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDG---GPITYHLAAEGASSP-FGLEPQSGWLWVRAALDREAQE 1066          

HSP 14 Score: 62.3882 bits (150), Expect = 2.319e-8
Identity = 60/236 (25.42%), Postives = 103/236 (43.64%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREK-QNLYSFLIISMNGDTKN----VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFE 916
            F I   +G +  +  +DR++  + + F + +++G        V++ + D NDN P+F    +  SI    P G+ V      DPD+G +   S  I++G+S  +F +D     +G+  V   L +  +    S   L I A DGG    + S  V I +       P F+  +Y+ S+ ED     +   V+A  N  G    +   L    P    F++D  +G +   + LD E
Sbjct:  629 FRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGGGLKSMVYVKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQ---SGLLTVAWPLARRAN----SVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQA-HNPPGRLAPVTLSLSGGDPRG-LFSLDAVSGLLQTLRPLDRE 855          

HSP 15 Score: 58.9214 bits (141), Expect = 2.444e-7
Identity = 134/583 (22.98%), Postives = 230/583 (39.45%), Query Frame = 2
Query: 6065 FRVKENSVDGTFIGQIKMVNYCKDHSAKFSIID-----GVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDAN-GDVKTNIP-------LNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFS---STAVIEIDVEDKNNHVP-----ILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLI------DEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVL-LKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLD--SDKAIFYKIDNFHPISNNLY--LDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKNS 7711
             ++ E    GT IG I         +     I      GV  +L  + E +G   V  A  +DRE+ D+   +T V+  G+ +    +V + V D++D+ P F Q +    + E     T        D D G      Y +    + E F ++   G   T +P       L+   +S Y L ++A    SP   A+  L V +++IND  P  +    +  +  +   GS + ++ A D+D G +G ++Y I  R+      F ++   +G + L R L       HE  +   D        +A + + V D N++ P      L  +G    +S +   G  +  +   D D  D   V   L      F L   D+    ++L+      D  +E+   Y L +  TD+   P  R  + F L V  +      F R +  +  E  +PE    GS + +   +D D  ++  + Y +    P ++  +  +D  SG +    SL+Y ++P+  LIV     G P   +S  +SV ++  N         +   SL  PE  Q       +   D +S
Sbjct:   49 LQIDEEQPAGTLIGDISAGLPAGTAAPLMYFISAQEGSGVGTDLA-IDEHSG--VVRTARVLDREQRDRY-RFTAVTPDGATV----EVTVRVADINDHAPAFPQARAALQVPEHTAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGVNGAVTYEINRRQSEGDGPF-SIDAHTGLLQLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHVRDANDNQPSMTVIFLSADGSP-QVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDS---VIYLVCVARRLD--REERDAYNLRVTATDSG-SPPLRAEAAFVLHVTDVNDNAPAFDRQL--YRPE-PLPEVALPGSFVVRVTARDPDQGTNGQVTYSL---APGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQFQRTFYNASL--PEGTQPGTCFLQVTATDADS 607          
BLAST of Dachsous vs. Ensembl Human
Match: FAT4 (FAT atypical cadherin 4 [Source:HGNC Symbol;Acc:HGNC:23109])

HSP 1 Score: 257.684 bits (657), Expect = 1.855e-67
Identity = 512/2250 (22.76%), Postives = 916/2250 (40.71%), Query Frame = 2
Query: 2066 GFIQYHLVP--EELSTGAITVDSQSGEI-LMKKFPIHKNPI-RLIVKSVIRK--PFNVSP---LNIVAINFQKLFFARS-LYQFILTKSEIKGNLVKIGQVSMDSSCTESVSYDLFGVKNDHSHFTIDVATGVIY-GKDLGSISNKTLMFQVSAK----APKSQTSFAQVIIYIED-GIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSD----EYQIIQSQ-YSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKN-----SKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGII-NLLVIVSDNGP-FKPLETEVEISVRIIDANNHSPIL--------------ISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSL--ETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVKIRIFV-SDLGFPKMTSSVDTLLKPL--YEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYG--AKCLFISNTTTSVDGFLHLR-----FDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLK---NLEVVYSIKQPEKY--FVINPVTGQLVTFRMFDRETENQIQFYVEVIATH----VSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQI-NPSSDGIFMINGDSGEIHLVSS---PRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAI--TNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCS-PLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPVNSEIFYVLNPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGG-SEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLID-ANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWF------------------GLRGFDN-NTAALFLIDEPQEKGHPYFLG-IQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKAIFYKIDNFHPISNNL---YLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYDPPSFQIDSS-NILWWINGDLFE-SRIWNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHD------IQYFLTPHENFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIVENP-SENFGINNETGAIYIKNQFIIEKKDKQRV 8503
            G I Y ++   EE       +DS SG++ L+ K      P   L++++V     P N +    ++I+  N     F +S L+  +L    I   +  +     DS     + Y + G  N+H  F+I   TG I+  K L   +       ++AK     P+S T    V+I++ D   + P F   D+  +I EN  +G  ++ V    P         Y IIQ     +  +I    G I+ N + DRE  +   +TV+  +         +              N     S+     +  + +G +   +  +D D   NG + Y  +II   G  + F ++  +G L + S+L      PS +I NL+V  +D GP  +   TE+ I ++ +D     P+               I TNV  I   +  G+E            E   + +  ++    + F I    ++T +I+  ++      +    ++V  I      P ++    + I   + N NPP  V P     +     +  GS+I  + A+D D+G N++  Y+I    D  D   ID  +G +     L   +  K  + V +D G       ++  +  +  + PK    +     +F IP+ + PG +V  +    ++ G   +  +I N     DG   L      F+  +L+    +  V+  +Y L V          +  +Y N++   V  + P+FS +S     + ENLP GS V  FN+       N ++ YSI   +    F ++   G L   +  DRE+++   FY  V+  H    +   +  +   + + + D NDN P  LSP  + +  + P   +  +F+  ATD DSGPNS + Y + NP  +  F I    GE+ L        VS Y L V   D G+   S S    +    I   + I   + +L        + +G  I Q+  +      N  +RY ++ G   Q F +D +TG++     + RE+     +        S        +  + ++I   N+  P F  S + V +PE+        L VVA D D G   ++ Y L G   D   F   ++G+L  +  L+   K  + L I ATDS   S        + + V +   +   F +  +   + E++P GT +  +N      +      +  G+S   IN +TG++ T+  L  E  +   L +        +    ++S  + V + D+NDN P    +P    IP+   P   +  ++ TD+D   N    +  S   ++  +    +D   G +     +  + ++     V V D G   K  +  + +       + ++  ++  F   EN    + +  I   +  +     + I  G       + + TG++ ++    +D EKI K ++W +   GG      Y+K+ I V DV+DN P+F ++ F++ + E   P+  ++ ++  D D G N Q++Y I   + +  F I+ A G++++  PL+    S Y L IK+S K SP      ++ + I++ ND  P+ S    +  +  N P+G  +T++T  D D   GI+   R+  + + +L   +   +G+I +SR L   D  ++   +   D+ ++ +  + I V D N++ P        ++     + GSK+  + A D D   NG+V + + S S +F                   + GF N N      I    ++G P  +    +T N +D                    YF        T +T  +++K G+K+ +    D D D  +  +++ F    N+L    LD ++G + +  SL   +   F + VT    G+P   +   + + + +EN         +  +S  +PE     +I+  +   D+++        S++    E I     F I+SS  IL       +E  +   +TI  +           +   GY  V + V +  + +             + EN P  TTV+ L     D      I Y +   ++       +      I ++  LDFET ++Y L +         R CS    V I +   +EY P FV + +   +    PK G I+   +ASD+D G  G V Y I  N   + F IN +TG IY+    I++++ ++RV
Sbjct: 1243 GLIHYSIIKGNEERQ---FAIDSTSGQVTLIGKLDYEATPAYSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGDNADLYYSITGT-NNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSST--MSVVIHVRDFNDNPPSFPPGDIFKSIVENIPIGTSVISVTAHDPDADINGQLSYTIIQQMPRGNHFTIDEVKGTIYTNAEIDREFANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFISQNALAADPSAVIGSVLTTIMAADPDEGANGEIEY--EIIN--GDTDTFIVDRYSGDLRVASALV-----PSQLIYNLIVSATDLGPERRKSTTELTIILQGLDG----PVFTQPKYITILKEGEPIGTNVISIEAASPRGSEA---------PVEYYIVSVRCEEKTVGRLFTI---GRHTGIIQTAAILDREQGACLYLVDVYAIEKSTAFP-RTQRAEVEITLQDINDNPP--VFPTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYTIISGAD--DSFRIDPESGDLIATRRLDRERRSKYSLLVRADDGLQSSDMRINITVSDVNDHTPKFSRPV----YSFDIPEDTIPGSLVAAILATDDDSGVNGEITYIVNEDDE-DGIFFLNPITGVFNLTRLL----DYEVQQ-YYILTVRAEDGGGQFTTIRVYFNIL--DVNDNPPIFSLNS-YSTSLMENLPVGSTVLVFNVTDADDGINSQLTYSIASGDSLGQFTVDK-NGVLKVLKALDRESQS---FYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLTYIPENTPI--DTVVFKAQATDPDSGPNSYIEYTLLNPLGNK-FSIGTIDGEVRLTGELDREEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPI--FAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGAITVAKPLDREKTPTYHLTVQATDRGSTPRTDTSTVSIVLLDI---NDFVPVFELSPYSVNVPENLGTLPRTILQVVARDDDRGSNSKLSYVLFGGNEDNA-FTLSASGELGVTQSLDRETKERFVLMITATDSG--SPALTGTGTINVIVDDVNDNVPTFASKAYFTTIPEDAPTGTDVLLVNASDADASKNAVIRIIGGNSQFTINPSTGQIITSALLDRETKDNYTLVV--VCSDAGSPEPLSSSTSVLVTVTDVNDNPPRFQHHPYVTHIPSPTLPGSFVFAVTVTDADIGPNSELHYSLSGRNSEKFH----IDPLRGAIMAAGPLNGASEVT--FSVHVKDGGSFPKTDSTTVTVRFVNKADFPKVRAKEQTFMFPENQPVSSLVTTITGSSL-RGEPMSYYIASGNLGNTFQIDQLTGQVSISQ--PLDFEKIQKYVVWIEARDGGFPPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLSPRK-ILTVSAMDKDSGPNGQLDYEIVNGNMENSFSINHATGEIRSVRPLDREKVSHYVLTIKSSDKGSPSQSTSVKVMINILDENDNAPRFS-QIFSAHVPENSPLGYTVTRVTTSDED--IGINAISRY-SIMDASLPFTINPSTGDIVISRPLNREDTDRYRIRVSAHDSGWTVSTDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFATDPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLK--------SKYF--------TPVT--KNVKVGTKLIRVTAID-DKDFGLNSEVEYFISNDNHLGKFKLDNDTGWISVASSLISDLNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSH--MSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGI-----FAINSSTGILTLAKALDYELCQKHEMTISAIDGGW-------VARTGYCSVTVNVID--VNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYTVQSSDSDLFVIDPNTGV---ITTQGFLDFETKQSYHLTVKAFNVPDEER-CSFA-TVNIQLKGTNEYVPRFVSKLYYFEISEAAPK-GTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSG--ILDREKEERV 3369          

HSP 2 Score: 217.238 bits (552), Expect = 4.002e-55
Identity = 549/2422 (22.67%), Postives = 982/2422 (40.55%), Query Frame = 2
Query:  212 QEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNG------DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLT--------------DYDAISTSFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDY-PEPSLSTTQALTIKIHESILFENSFSHSRFQVEIDSTILNENQH-----VTFVKTTKRLPTKPIFIFKIFV------LNNLFKINETTGEILSKRSID--CGKYFFNVSMLSLKTNSLIDQTK---LEIVVKSGRKLPLYFDRGFRKILV--TTGKSQCFSEIAVRNRHCGMRIQYSYDLLLKTDGILRIN-EHGALCTAENVKHNKLMSTRYLYQIKALDETNSSAVCVVLFAIQPSKVFDVLPTEINITLPIIDSPKFNFSLPIGKIIGT-----FSKLPPAQFIGFIQYHLVPEELSTGAITVDSQSGEILMKK---FPIHKNPIRLIVKS--------VIRKPFNVSPLNIVAINFQKLFFARSLYQFILTKSEIKGNLVKIGQVS-MDSSCTESVSYDLFGVKNDHSHFTID--VATGVIYGKDLGSISNKTLMFQVS--AKAPKSQ-TSFAQVIIYIEDGIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSD----EYQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIG---SATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNVFYIHQTAVYGTE-VGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYF-----EPLNVMLIATDRGSPS--KSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSL--SCAQNVKIRIFVSDLGFPKMTSSVDTLLKPLYEPKSE--EFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQL---ILLKDNLN-VKNVHYSLNVVFNKKNLFSISSNLYINV-IVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLKNLEVVYSIKQPE--KYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSN-PKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENAS---IFQIVATDADSGPNSKLTYQI-NPSSDGIFMINGDSGEIHLV---SSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLT-VVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCSPL-------NFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPP---VNSEI-FYVLNPGH-SHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSK---CTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFS-IIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIR-GYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLID-ANGDVKTNIPLNFHTKSVYDLVIKASSKAS--PFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIV-VDDARFSST--AVIEIDVEDKNNHVPILK-ENGRVINLSSSLKRGSKILYLHAIDKDLRDN-GKVTFELVSTSP 7111
            +E++F I  T+G + + G +D E    YS +I +++        T  + I ILD NDN P F  +     + EN  IG  V   T  D D G N+     I   ++   F+I  +  S       + L + LD+E  S + L I A D G PP  +++ V I V++ NDN P F       SI E+  I  + + V A D DA ++G+L Y +    P  + FT+D   G +Y    +D E +    +++   D + P  T +  +    I + D   ++ +     +S+      P+ ++  V  T              +Y+ I+   D  I++R    L ++   +   +LI           NL + A D  PE   STT+ LTI +    L    F+  ++      TIL E +      ++    + R    P+  + + V      +  LF I   TG I +   +D   G   + V + +++ ++   +T+   +EI ++     P  F      + V    G      ++   +   G     +Y ++   D   RI+ E G L     +   +   ++Y   ++A D   SS + +           ++  +++N   P    P ++F +P   I G+      +    +   G I Y +V E+   G   ++  +G   + +   + + +  I L V++         IR  F     NI+ +N     F+ + Y   L ++   G+ V +  V+  D      ++Y +    +    FT+D      V+   D  S S   L+ QV    + P S+ TS AQV I + D    P    S  L  I ENT +   + +     P        EY ++ +   +  SI +  G++ L  + DRE+VS   +TV   +      S++ ++ + +LDINDN P    +       + +  G     +  +D D   NG + Y    I     N  F I+  TG + +   L   +   +   +L V  +D G     +T   +S+ ++D N+  P      VF +   +V   E +GTL      +    +   S  +  Y           N F +       +         E   +M+ ATD GSP+   +  IN++++ +  N N P          +    P  +G+++  VNA D D   N++        I    Q  I+  TG I T   L      N  + +  SD G P+  SS  ++L  + +       F  +  +T  IP  + PG  V  + +   + G      S    S+ G    +F    L   I+    LN    V +S++V       F  + +  + V  VN+  F  P        F+   EN P  S V +     L+   + Y I        F I+ +TGQ+   +  D E   +IQ YV  I       P   +   L + + D NDN P I      I  I     EN S   I  + A D DSGPN +L Y+I N + +  F IN  +GEI  V      +VS Y L +   D G   +S SV   I+    +  +  RF     +       S  G+ + +++ S      N   RY ++       F+++P TG +     ++RE+   ++  +I V   S HD+       + I +   N+N PRFSR+ + +  PE   I + +T V A DPD G  G++ Y ++  +  +   I+ +TG++    +        F   NI     I T S+         T V I + ++  +   F  + +   V +N   GT L R+  +      +NSE+ +++ N  H    +++  TG +     L  +L +   +T+ A  K     S Q T   + + + + N + P  +++ +   IP S+     +  +SA D D   N   ++  S    + ++    ++  +G L L  ++   +  +H + +   D G  ++   C+  +  I +N +      + +     V EN+  GT +  +   +     +A  +  +   + +L  +  +TG   +     +D E      L  +      E R  +  V I +   ++  P F    +   ++E  P  T V  +   D D+G + +V Y I   S ++ F I+   G +  +  L+   +    L + A +  S       E  + V +++ ND  P  ++   ++++    P+G+ +T ++A DSD     S         N+    ++   +G+I ++ +L    +  +   ++ VD    S+T  A + + +ED N++ P+L    G V+    + + G+ ++ L + D DL  N G  T+ L+ST P
Sbjct: 1254 EERQFAIDSTSGQVTLIGKLDYEATPAYSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGDNADLYYSITGTNNHGTFSISPNTGS-------IFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMSVVIHVRDFNDNPPSFPPGDIFKSIVENIPIGTSVISVTAHDPDADINGQLSYTIIQQMPRGNHFTIDEVKGTIYTNAEIDREFANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMF----ISQNALAADPSAVIGSVLTTIMAADPDEGANGEIEYEIINGDTDTFIVDRYSGDL-RVASALVPSQLI----------YNLIVSATDLGPERRKSTTE-LTIILQG--LDGPVFTQPKY-----ITILKEGEPIGTNVISIEAASPRGSEAPVEYYIVSVRCEEKTVGRLFTIGRHTGIIQTAAILDREQGACLYLVDVYAIEKSTAFPRTQRAEVEITLQDINDNPPVFPTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYTIISGADDSFRIDPESGDLIATRRLDRER--RSKYSLLVRADDGLQSSDMRI-----------NITVSDVNDHTPKFSRPVYSFDIPEDTIPGSLVAAILATDDDSGVNGEITY-IVNEDDEDGIFFLNPITGVFNLTRLLDYEVQQYYI-LTVRAEDGGGQFTTIRVYF-----NILDVNDNPPIFSLNSYSTSLMENLPVGSTVLVFNVTDADDGINSQLTYSI-ASGDSLGQFTVDKNGVLKVLKALDRESQSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLL-NPLGNKFSIGTIDGEVRLTGELDREEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYG---IVNGNTNQEFRIDSVTGAITVAKPL---DREKTPTYHLTVQATDRGSTPRTDTST-VSIVLLDINDFVP------VFELSPYSVNVPENLGTLPRTILQVVARDDDRGSNSKLSY---VLFGGNEDNAFTLSASGELGVTQSLDRETKERFVLMITATDSGSPALTGTGTINVIVDDV--NDNVPTFASKAYFTTIPEDAP--TGTDVLLVNASDADASKNAVIRI-----IGGNSQFTINPSTGQIITSALLDRETKDNYTLVVVCSDAGSPEPLSSSTSVLVTVTDVNDNPPRFQHHPYVTH-IPSPTLPGSFVFAVTVTDADIGPN----SELHYSLSGRNSEKFHIDPLRGAIMAAGPLNGASEVTFSVHV--KDGGSFPKTDSTTVTVRFVNKADF--PKVRAKEQTFM-FPENQPVSSLVTTITGSSLRGEPMSYYIASGNLGNTFQIDQLTGQVSISQPLDFE---KIQKYVVWIEARDGGFPPFSSYEKLDITVLDVNDNAP-IFKEDPFISEI----LENLSPRKILTVSAMDKDSGPNGQLDYEIVNGNMENSFSINHATGEIRSVRPLDREKVSHYVLTIKSSDKGSPSQSTSVKVMINILD-ENDNAPRFSQIFSAHVPE--NSPLGYTVTRVTTSDEDIGINAISRYSIMDASLP--FTINPSTGDIVISRPLNRED---TDRYRIRV---SAHDSGWTVSTDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFATDPDEGSNGQVFYFIKSQS--EYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISNDNHLGKFKLDNDTGWISVASSLISDLNQNFFITVTAKDKGNPPLSSQAT---VHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGIFA---INSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPV--FLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYTVQSSDSDLFVIDPNTG--VITTQGFLDFETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDP-PIFTLNIYSVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTAELDRETLPIYNLSVLAVDSGTPSATGSASLLVTLEDINDNGPMLTVSEGEVM---ENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGP 3553          

HSP 3 Score: 196.052 bits (497), Expect = 8.506e-49
Identity = 411/1749 (23.50%), Postives = 731/1749 (41.80%), Query Frame = 2
Query: 2717 TGQIFLNKQFDREQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKP--YCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSD--NGPFKPLETEVEISVRIIDANNHSPILISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVKIRIFV--SDLG-FPKM-TSSVDTLL------KPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRL-KNLEVVYSIKQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPK-IFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEIHLVSSPRVSAYEL--NVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLD-IRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKL-SCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPV--NSEIFYVLNPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSN--ITY------QFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPS--KCTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSI---IDGVNHELVF-LHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDANGDVKT-NIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVD-----DARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQK----------------RLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKAIFYKIDNFHPISNN----LYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKEN-KGPNLIDNKYITLSLQVPEMIQ--KPAIISNLLQ-----MDKNSFRYSYYLISVAP 7747
            TG   L +  D E   Y ++TV+ ++  G  T       +   ++ P  +  NS +    E+L  +G        +DAD   N  L+Y +     +G    F ++   G L ++ +L+  + +     NL+V V D    P     +  ++S+ ++D N++ P  +S  + YI +     T V      D D G N  IE +L  P   + F I  +     +      E +++Y     + ++ATD+G PS SS   +V+  ++ N N P  +  +   ++      L+G++I  V A D D+G N    Y I     N+ +  IDS TG IT    L   +     + V  +D G  P+  TS+V  +L       P++E       + +NL  +     Q   V  D +    +  +  LF  N     D    L    +  +    +   K   + L +        +++    INVIV+ V  + P F+  +  F  I E+ P+G+ V   N      +   V  I      F INP TGQ++T  + DRET++   + + V+ +   +P+ + +   ++V + D NDN P        +  I +PT   + +F +  TDAD GPNS+L Y ++  +   F I+   G I + + P   A E+  +V V+D G  PK+ S   ++ F +     K+R    +     + P       +  L  + T SS   + + YY+ +G     F +D +TG V     +  E+I    +V I          S Y  +++ I +   N+N P F    F  ++ E+ +    LTV A D D G  G++ Y +     +    I+ +TG++ S  PL+  + + Y L I ++D    S  +    KV+I + +   +   F+   FS  V ENSP G  + R+      +  N+   Y +        IN +TG++  + PL+ E  +   + + A        S  T S  + + + DINDN P  +     +  P   +    +T++ ATD D+ SN  + Y      ++ R + TT  ++   +L  ++   F   ++      RH   V  SD G PS    TTV I+I ++ +    Q +  K    V +N   GT + ++  ++  KD      +   I   NH   F L   TG I VA++   D  + +  I  T    G   +     V I V + + + P FSQ+   A + E     + V  ++  D D   N  ++Y I   + +  F I+++  + T    L++     +++ I A           C +TV ++++ND  P     +    +  N P G+ +  + A D+D G +  I+Y ++    ++  LF+    D     ++ +  +    K  + + V      D    S A + I ++  N +VP          +S +  +G+ +  + A D+DL  +G+V + +           F N+    F I+  ++ G  Y  GI      +D +K                R   I  +TV +    +  P +   +   + I E +  G+ +T FV    DSD    +   ++   S N      ++ ++G + +T  L+    P + L V     G+P    S +L V +E  N  GP         L++   E+++  +P  +   LQ     +  N   ++YYL+S  P
Sbjct: 1895 TGVFNLTRLLDYEVQQYYILTVRAEDGGGQFTTIRVYFNILDVNDNPPIFSLNSYSTSLMENLP-VGSTVLVFNVTDADDGINSQLTYSIASGDSLGQ---FTVD-KNGVLKVLKALDRESQS---FYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPLGNK-FSIGTIDGEVRLTGELDREEVSNY----TLTVVATDKGQPSLSSSTEVVVMVLDINDNNP--IFAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQ-EFRIDSVTGAITVAKPLDREKTPTYHLTVQATDRGSTPRTDTSTVSIVLLDINDFVPVFELSPYSVNVPENLGTLPRTILQ--VVARDDDRGSNSKLSYVLFGGNE----DNAFTLSASGELGVTQSLDRETKE-RFVLMITATDSGSPALTGTGTINVIVDDVNDNVPTFASKA-YFTTIPEDAPTGTDVLLVNASDADASKNAVIRIIGGNSQFTINPSTGQIITSALLDRETKDN--YTLVVVCSDAGSPEPLSSSTSVLVTVTDVNDNPPR-FQHHPYVTHIPSPTLPGSFVFAVTVTDADIGPNSELHYSLSGRNSEKFHIDPLRGAI-MAAGPLNGASEVTFSVHVKDGGSFPKTDSTTVTVRFVNKADFPKVRAKEQTFMFPENQP-------VSSLVTTITGSSLRGEPMSYYIASGNLGNTFQIDQLTGQVSISQPLDFEKI-QKYVVWIEARDGGFPPFSSY--EKLDITVLDVNDNAPIFKEDPFISEILENLSPRKILTVSAMDKDSGPNGQLDYEIVNGNMENSFSINHATGEIRSVRPLDREKVSHYVLTIKSSDKG--SPSQSTSVKVMINILDENDNAPRFSQI-FSAHVPENSPLGYTVTRVTTSDEDIGINAISRYSIMDASLPFTINPSTGDIVISRPLNREDTDRYRIRVSAH------DSGWTVSTDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFATDPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQILKYQNVTGFSNVNIN-----RHSFIVTSSDRGKPSLISETTVTINI-VDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDD-KDFGLNSEVEYFISNDNHLGKFKLDNDTGWISVASSLISDLNQ-NFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYTVQS---SDSDLFV---IDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLI-----------FGNSRKKGFQIN--KKTGQIYVSGI------LDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDPPIFTLNIYSVQISEGVPIGTHVT-FVSA-FDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTAELDRETLPIYNLSVLAVDSGTPSATGSASLLVTLEDINDNGP--------MLTVSEGEVMENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGP 3553          

HSP 4 Score: 188.348 bits (477), Expect = 1.943e-46
Identity = 601/2810 (21.39%), Postives = 1136/2810 (40.43%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQN-----LYSFLIISMNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYL--RKSLDFEKSKS--HHISIGVRDNSP-PFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDAISTSF-DLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEIDSTILNENQHVTFVKTTKRLPTKPIFIFKIFVLNN--LFKINETTGEILSKRSIDCGK---YFFNVSMLSLKTNSLIDQTKLEIVVKSGRKLPLYFDRG--FRKILVTTGKSQCFSEIAVRNRHCGMRIQYSYDLL--LKTDGILRINE-HGALCTAENVKHNKLMSTRYLYQIKALDETNSSAVCVVLFAIQPSKVFDVLPTEINITLPIIDSPKFNFSLP---IGKIIGTFSKLPPAQFI-GFIQYHLVPEELSTGAITVDSQSGEILMKKFPIHKNPI-RLIVKSVIRKPF---NVSPLNIVAINFQKLFFARSLYQFILTKSE-IKGNLVKIGQVSMDSSCTESVSYDLFGVKNDHSH----FTIDVATGVIYGKDLGSISNKTLMFQVSAKAPKSQTSF-----AQVIIYIEDGIHQPGFDFSDLL-VNIWENTTVGIEIMQVFPKYPSVSDE-------YQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPIL-ISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSK-SSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLS--GSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVKIRIFVSDLGFPKMTSSVDTLL--------KPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPE-NYGAKCLFISNTTTSVDGFLHLRFDS--QQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGS----HVASFNIRRLKNLEVVYSI--KQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSS-SIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEI---HLVSSPRVSAYELNVTVRDSGE---VPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENP-PRFSRSIFKVKLPEDEAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCS-PLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLEN-SPGGTVLGRINIVKPPVNSEIFYVLNPGH--SHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIF---IPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNG--VPSKCTTVLIDISLNQDH----QYVQIVPE-----KAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVFLHESTGKIF---------VAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLT-VYDPDIGFNSQVEYFIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGP-DG-ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARF---SSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAAL----FLIDEPQEKGHPYFLGIQLTDNAID-PQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVC--KDLDSDKAIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGS--PEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKNSF----RYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESRIWNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHDIQYFLTPHENFELTCSQ-----SQSSGCNIKSKSVLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDE 8269
            F I++  G I + G +D    +     L S + +     +  + + + DVNDN P F+  ++E ++ E+ P+ S+       D D G N   +  I  G++   F I + D        +L +K  LD E+  ++ L++ A D    PL A++ V +I+++ NDN P F+ + Y    +E+Q       +V A D D G +GE+ Y  +   P  +   +  +  N +   R+SL   +  +      I      P P        +      ++ P  ++  +   +SE   ++   T V  V  +D D  +       I+  +  +   I     ++ LI  +    + + +L ++AVD     L++T  L I I +      SF  S   V++   +       +   T           + I   NN   F I+  TG I   + +D      Y  N++              + I V+     P  F  G  F+ I+           +   +    +  Q SY ++  +       I+E  G + T  N + ++  +  +   +KA D+  +  +    +A+   K   +L T++N  +P+  S     + P   IG ++ T     P +   G I+Y ++  +  T    VD  SG++ +    +    I  LIV +    P    + + L I+        F +  Y  IL + E I  N++ I   S   S    V Y +  V+ +       FTI   TG+I    +        ++ V   A +  T+F     A+V I ++D    P    +D+L + + EN   G +IMQ+       +DE       Y II S   D   I  ++G +   ++ DRE+ S   + V+  + + S+ + +++ + D+ND+ P       +F   + +  G +   +  +D DS  NG ++Y   I+     +  F +NP TG   +   L+           +L + +++G  +   T + +   I+D N++ PI  +++    + +    G+ V    + D D G N ++  S+        F ++   KN  +  +K+L+  +  F  L V +    +   S+ +S   + I  ++ N NPP  + PK     + + P  +   + +F   A DPD G NS   Y++   + N+  I        +T ++      N  + +  +D G P ++SS + ++         P++     +  IN+N T    D  Q     GD     +  YG     I N  T+ +     R DS    + + K     K   Y L V    +     +    +++++  +    P+F   SP  + + ENL +       V + +  R  N ++ Y +     +  F ++  +G+L   +  DRET+   +F + + AT   +P +     + V + D NDN P   S +  + +   APT     +  + A+DAD+  N+ +   I  +S   F IN  +G+I    L+       Y L V   D+G    +  S SV+ ++   +    +  RF  +    ++  P     F+   ++ +      N ++ Y L +G+ ++ F +DP+ G++     ++    G SE+      +      S        + + + N+   P+          PE++ +++ +T +      G    + Y +          ID  TG++S S PL+F +   Y + I A D  G       + K+ I V +   +   F    F  ++LEN SP   +           N ++ Y +  G+  +   IN  TGE+R+  PL  E V    LTI +  K   +   Q+TS  + + I+D NDN P  ++    IF   +P ++     +T+++ +D D   N   ++   D +       + ++  +G++ +   +      R+ ++V   D+G  V +  T  + DI+ N        Y    PE       + +V     D    GQ+    + K  S  F I           + +TG+IF         V   + ++  +   I+  T    G   +     V I++ D +DN P F ++K+   + +     T +IR+T + D D G NS+VEYFI   +   +F +D + G +     L       + + + A  K +P + ++  + + +   N   P+ S  + +  +  +  +GS +  ++A+D D   +G I Y I      N+     +   +G + L++ L      KHE  I   D  +   +    + ++V D N++ P+   +     +  +   G+ +++L+A D D   N  + + + S+     L   D NT  +    FL  E ++  H       LT  A + P +   S   + + LK    Y PR + +      I E+   G+ + +     +DL +D  + Y I   +       ++ ++G +Y++  L+   + R  L V     GS     I    ++V +   N  P    N Y   S+Q+ E +     ++ +   D +S     R+SY+ I    E      +P + QI  +  L     D     I+NL+++ V +     +PS       L    ++ +   G +    E     G + EN+ P T V+ L     D+     P   + L+        S S+   + +   +D E   ++ L ++ K S   +   S T  V I+V+D ++
Sbjct:  940 FAINEKNGTISLLGPLDVHAGSYQIEILASDMGVPQLSSSVILTVYVHDVNDNSPVFDQLSYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTIAEGNTGDAFGI-FPDG-------QLYIKSELDRELQDRYVLMVVASDRAVEPLSATVNVTVILEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSFEMVQPDFELHAISGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKFLKDFYQATISESAANL---TQVLRVSASDVDEGNNGLIHYSIIKGNEERQFAIDSTSGQVTLIGKLDYEATPAYSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGDNADLYYSITGTNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMSVVIHVRDFNDNPPSFPPGDIFKSIVENIPIGTSVISVTAHDPDADINGQLSYTIIQQMPRGNHFTIDEVKGTIYT--NAEIDREFANLFELTVKANDQ--AVPIETRRYAL---KNVTILVTDLNDNVPMFISQNALAADPSAVIGSVLTTIMAADPDEGANGEIEYEIINGDTDT--FIVDRYSGDLRVASALVPSQLIYNLIVSATDLGPERRKSTTELTIILQGLDGPVFTQPKYITILKEGEPIGTNVISIEAASPRGS-EAPVEYYIVSVRCEEKTVGRLFTIGRHTGIIQTAAILDREQGACLYLVDVYAIEKSTAFPRTQRAEVEITLQDINDNPPVFPTDMLDLTVEENIGDGSKIMQLTAMD---ADEGANALVTYTII-SGADDSFRIDPESGDLIATRRLDRERRSKYSLLVRADDGLQSSDMRINITVSDVNDHTPKFSRPVYSFDIPEDTIPGSLVAAILATDDDSGVNGEITY---IVNEDDEDGIFFLNPITGVFNLTRLLDYEVQQ----YYILTVRAEDGGGQ--FTTIRVYFNILDVNDNPPIFSLNSYSTSLMENLPVGSTVLVFNVTDADDGINSQLTYSIASGDSLGQFTVD---KNGVLKVLKALDRESQSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPK-----LTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPLGNKFSIGTIDGEVRLTGELDREEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYKVEINEN-TLTGTDIIQVFAADGDEGTNGQVRYG-----IVNGNTNQE----FRIDSVTGAITVAKPLDREKTPTYHLTVQATDRGSTPRTDTSTVSIVLLDINDFVPVFEL-SPYSVNVPENLGTLPRTILQVVARDDDRGSNSKLSYVLFGGNEDNAFTLS-ASGELGVTQSLDRETKE--RFVLMITATDSGSPALTGTGTINVIVDDVNDNVPTFASKAYFTTIPEDAPT--GTDVLLVNASDADASKNAVIRI-IGGNSQ--FTINPSTGQIITSALLDRETKDNYTLVVVCSDAGSPEPLSSSTSVLVTV---TDVNDNPPRFQHHPYVTHIPSPTLPGSFVFA-VTVTDADIGPNSELHYSL-SGRNSEKFHIDPLRGAIMAAGPLN----GASEVT---FSVHVKDGGSFPKTDSTTVTVRFVNKADFPKVRAKEQTFMFPENQPVSSLVTTITGSSLRG--EPMSYYIASGNLGNTFQIDQLTGQVSISQPLDFEKIQKYVVWIEARD--GGFPPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLSPRKILTVSAMDKDSGPNGQLDYEIVNGNMENSFSINHATGEIRSVRPLDREKVSHYVLTIKSSDKGSPS---QSTSVKVMINILDENDNAPRFSQ----IFSAHVPENSPLGYTVTRVTTSDEDIGINAISRYSIMDASLP-----FTINPSTGDIVISRPLNREDTDRYRIRVSAHDSGWTVSTDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFATDPDEGSNGQV--FYFIKSQSEYFRI-----------NATTGEIFNKQILKYQNVTGFSNVNINRHSFIV--TSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISNDNHLGKFKLDNDTGWISVASSLISDLNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISS---GNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYTVQSSDS--DLFVIDPNTGVITTQGFLDFETKQSYH-------LTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFV-SKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFG-NSRKKGFQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDPPIFTLNIY---SVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYF-IGSGNENGAFSINPQTGQITVTAEL-----DRETLPIYNLSVLAVDS----GTPSATGSASLLVTLEDINDN--GPMLTVSE-----GEVMENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGPATSYFSLSTAGVLSTTREIDREQIADFYLSVVTKDS--GVPQMSSTGTVHITVIDQND 3609          

HSP 5 Score: 185.652 bits (470), Expect = 1.336e-45
Identity = 441/1861 (23.70%), Postives = 766/1861 (41.16%), Query Frame = 2
Query: 2363 SVSYDLFGVKNDHSHFTIDVATG---VIYGKDLGSISNKTLMFQVSAKAPKSQTSFAQVIIYIED-GIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSD----EYQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVSYL---VVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILI----STNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVM-------LIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGL-ITTKVSLSCAQNVKIRIFVSDLGFPKMTSSVDTLL--------KPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKC-LFISNTTTSVDGFLHL---------RFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFS-ISSNLYINVIVNRVGFSWPLFSKD--SPKFLEIKENLPSGSHVASFNIRRLKNLEVVYSI--KQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIV----ATDADSGPNSKLTYQINPSSD-GIFMINGDSGEIHLVSS---PRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKT-----------KSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYS--QTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLH-DASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLTVVANDPDLGIFGRIIYSL-EGDTFDKKIFIDPSTGKLSCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKP-----PVNSEIFYVLNPGHS---HIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSN--ITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHE--LVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDANGDVKTNIPLNFHTKSVYDLVIKASS----KASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDD---ARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEP--QEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSK-ITKFVCKDLD--SDKAIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKG-PNLIDNKYITLSLQVPE 7657
            +V + L   + D   F +D  +G    I   D    +  +L+   +      Q+S A++ + + D   + P F       +I EN   G  I  V    P +      +Y I     S +  +++++G I      DRE+ +     +V     NL       + + +LD  DN P       +F   +  +LG     +  S  D   N N+SY +      GM   F IN  TG L   ++ N+ +        L V+ S  G     +T V I+V+  D N++SP  +    S NV    Q    G  +      D D G NG +  SLKQ             KN F I  K+  TI S   PL+V        ++A+D G P  SS + L +   + N N P  V  +   ++         S  F V A D D G N    Y+I    +  D   I     L I +++         + +  SD     ++++V+  +        +PL+         + N TF   +  + G  VG ++   +++G    +  S      D  LH          +FD + L+  +         +S  V+   + +   +     ++V +  +  + P F KD       E   NL     V++ ++    N  + YSI     E+ F I+  +GQ+      D E        ++ + +      + +   L + I DENDN P    P S++        EN  I ++V    ATD+DSG N+ L Y I  +++ G F I+ ++G I L         S Y+LN+T +D G  P+S ++   IH +               KS +  +    S+           I GQLSY+  Q    GN               F++D + G++ T   + RE   N   + +    Q++  +   Y L+ + I +   N+N P F         P     +   T++A DPD G  G I Y +  GDT      +D  +G L  +      + IYNL + ATD       RK  T++ I +Q        F    +   + E  P GT +  I    P     PV   I  V     +      I   TG ++T   L  E    + L +  +A   ST   +T  A +++ + DINDN P+   + + + +  +      + +L+A D+D+ +N  +TY               + +D +SG+L     +    + ++ L ++ +D+G+ S    + I +S   DH      P  + F + E+++ G+ +  I   +     + + + I   + E  + FL+  TG   +     +D E     IL  +   GG +    + V  ++ DV+DN P+FS N +   L E  P  + V+   V D D G NSQ+ Y I    S  +F +D NG +K    L+  ++S Y+LV++        AS F  +  ++++ ++++ND  P    P     +  N P+ + + K  A D D GP+  I Y + +  L N+    ++    GE+ L+ +L   +V  +   +V  D      SS+  + + V D N++ PI  +    + ++ +   G+ I+ + A D D   NG+V + +V+ +     R  D+ T A+  + +P  +EK   Y L +Q TD    P+    ++   +++L     + P +       + +PE+L +  + I + V +D D  S+  + Y +  F    +N +    SG+L +T+SL+   + RF+L++T    GSP    +  ++V ++  N   P      Y T    +PE
Sbjct:  617 TVRFSLQEAETDRRSFRLDPVSGRLSTISSLDREEQAFYSLLVLATDLGSPPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGSYITTVSATDPDLGTNGTVKYSISAGDRSRF-QVNAQSGVISTRMALDREEKTAYQLQIVATDGGNLQSPNQAIVTITVLDTQDNPPVFSQVAYSFVVFENVALGYHVGSVSASTMDL--NSNISYLITTGDQKGM---FAINQVTGQL---TTANVIDREEQSFYQLKVVAS--GGTVTGDTMVNITVK--DLNDNSPHFLQAIESVNVVENWQA---GHSIFQAKAVDPDEGVNGMVLYSLKQN-----------PKNLFAINEKN-GTI-SLLGPLDVHAGSYQIEILASDMGVPQLSSSVILTVYVHDVNDNSP--VFDQLSYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTIAEG-NTGDAFGIFPDGQLYIKSELDRELQDRYVLMVVASDRAVEPLSATVNVTVILEDVNDNRPLFN--------STNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSFEMVQPDFELHAISGEITNTHQFDRESLMRRR-----GTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKFLKDFYQATISESAANLTQVLRVSASDVDEGNNGLIHYSIIKGNEERQFAIDSTSGQVTLIGKLDYEATPAYSLVIQAVDS--GTIPLNSTCTLNIDILDENDNTPSF--PKSTLF---VDVLENMRIGELVSSVTATDSDSGDNADLYYSITGTNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMSVVIHVRDFNDNPPSFPPGDIFKSIVENIPIGTSVISVTAHDPDADINGQLSYTIIQQMPRGNH--------------FTIDEVKGTIYTNAEIDRE-FANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFISQNALAADPSAVIGSVLTTIMAADPDEGANGEIEYEIINGDT--DTFIVDRYSGDLRVASALVPSQLIYNLIVSATDLG--PERRKSTTELTIILQGLDGP--VFTQPKYITILKEGEPIGTNVISIEAASPRGSEAPVEYYIVSVRCEEKTVGRLFTIGRHTGIIQTAAILDREQGACLYL-VDVYAIEKSTAFPRTQRAEVEITLQDINDNPPVFPTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYTI------ISGADDSFRIDPESGDLIATRRLDRERRSKYSL-LVRADDGLQSSDMRINITVSDVNDHTPKFSRPVYS-FDIPEDTIPGSLVAAILATDDDSGVNGEITYIVNEDDEDGIFFLNPITGVFNLTRL--LDYEVQQYYILTVRAEDGGGQFTTIR-VYFNILDVNDNPPIFSLNSYSTSLMENLPVGSTVLVFNVTDADDGINSQLTYSIASGDSLGQFTVDKNGVLKVLKALDRESQSFYNLVVQVHDLPQIPASRFT-STAQVSIILLDVNDNPPTFLSPKLTY-IPENTPIDTVVFKAQATDPDSGPNSYIEYTLLN-PLGNK---FSIGTIDGEVRLTGELDREEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEFR-IDSVTGAI-TVAKPLDREKTPTYHLTVQATDRGSTPRTDTSTV---SIVLLDINDFVP-VFELSPYSVNVPENLGTLPRTILQVVARDDDRGSNSKLSYVL--FGGNEDNAFTLSASGELGVTQSLDRETKERFVLMITATDSGSPALTGTGTINVIVDDVNDNVPTFASKAYFT---TIPE 2375          

HSP 6 Score: 164.081 bits (414), Expect = 4.125e-39
Identity = 474/2131 (22.24%), Postives = 849/2131 (39.84%), Query Frame = 2
Query: 2474 LMFQVSAKAPKSQTSFAQVIIYIED-GIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSDEYQI---IQSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQ-----LKNLIGSATXXXXXXXXXXXXXKP-----YCKNSKTNFTFEDLSSLGEMECPLKCSDADS-FPNGNLSYRMKIIKPVGMNNP--FEIN----PTTGCLLIISSLNIWNSNPSGIINLLVIVSDN---GPFKPLETEVEISVRII---DANNHSPILISTNVFYIH--QTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLI-ATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHK-QMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNV--KIRIFVSDLGFPKMTSSVD---TLL-----KPLYEPKSEEFLINKN---------LTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRL---KNLEVVYSIKQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEIHLVSSPRVSA--YELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQ---RIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFL-TVVANDPDLGIFGRIIYSLE--GDTFDKKIFIDPSTGKLSCSPLNFMEKN---IYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINI--VKPPVNSEIFYVLNPGHSHIQ--INTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKP-----------------LTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFR-VKENSVDGTFIGQIKMVNYCKDHSAKFS--IIDGVNHELVF-LHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGS--EIRGY--KKVIIHXXXXXXNKPVF-SQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDG-ISYRIRHRKLTNQTL--FLNVAFDSGEIFLSRKLLVSDVGKHEFDIVV----DDARFSST--AVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTS-PWFGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDS--DKAIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESR-IWNLTIMIVKAQKYQNSPSNLYENG------YLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKL--------PEWYHDIQY-FLTPHEN-FELTCSQSQSSGCNIKSKSVLDFETHENYRLQLLI--KGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIVE-NPSENFGINNETGAIYIKNQFIIEK 8485
            L+ +V  K    +  + QV + ++D   + P F  S     + E+  VG  ++QV            I   +Q + + +  +  +TG I + +  D E      +TVQ     + +L G A  +  + +LD+NDN P     Y   +    + ++ + +G +   L  +DADS   NGN+S ++     +G N    FE+     P    + + S+L+     PS   NL V VSDN    P   ++    ++  +I   D N+H P+  S  V+ ++  + A  G+ V  +   D D G N  +  S+   +    F+I   S+++ ++   S   ++       V+ I A D+G   K S   LV+  ++ N   P    P+ +   ++   P  +G+E+  + A D D G N    +S++ A  +     +D  +G ++T  SL   +     + +  +DLG P  +S      +LL      P++ P      I +N         ++   PD    G V      +  + G +  F  N  + V         S ++ L ++    +   Y L +V          +   + + V     + P+FS+ +  F+ + EN+  G HV S +   +    N+  + +    +  F IN VTGQL T  + DRE ++  Q  V      V+   +  +      + D NDN P+ L    S V +        SIFQ  A D D G N  + Y +  +   +F IN  +G I L+    V A  Y++ +   D G    S SV+ +++   +   S +    +            S F   ++  S   S  N +I Y +  G     F + P  G +  +  + R      E+    V++    D ++  L     + + ++  N+N P F+ + +     E++   +F+  V A D D G  G + YS E     F+        T        + M +    +++  +IATD +G+    KD   V +++++   +   F    +   + E++   T + R++   V    N  I Y +  G+   Q  I++T+G++   G L  E      L I A    + + +I   S                     + I   N N P  P                 ++ ++ATDSD   N    +     T    +  + +   +G++FL   +    +  + L +   D G P + +T+ + I +   +      P   IF+ + EN   GT +  +   +   D + + S  II  +     F + E  G I+    A+IDRE  +   L  + +      E R Y  K V I V D++DN P+F SQN   A  +      + +  +   DPD G N ++EY I      + F++D  +GD++    L   ++ +Y+L++ A+        +   LT+ +  ++   P  + P     L    P+G+ +  I A    G +  + Y I   +   +T+     +   +G I  +  +L  + G   + + V        F  T  A +EI ++D N++ P+   +   + +  ++  GSKI+ L A+D D   N  VT+ ++S +   F +     +  A   +D  +E+   Y L ++  D+ +      ++I    V    P+  F R +        IPE    GS +   +  D DS  +  I Y I N        +L+  +G   LT+ L+Y +Q  ++L V     G   + T+  +   I   N  P +      + SL     +    ++ N+   D        Y I+      +       F +D + +L  +     ES+  +NL   +V+       P++ + +        L VN   P  +   L            I EN P  T V K         P  Y  I+Y  L P  N F +     +     ++    LD E   NY L ++   KG      S S +  V + VLD+++  P F    +   +       G  +   +A+D D G  G V Y IV  N ++ F I++ TGAI +      EK
Sbjct:  218 LLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTPF-QMDPETGLITVREPLDFEARRQYSLTVQAMDRGVPSLTGRA--EALIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQI-----LGGNEQRHFEVQSSKVPNLSLIKVASALD-RERIPS--YNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVF-SQQVYRVNLSEEAPPGSYVSGISATDGDSGLNANLRYSIVSGNGLGWFHI---SEHSGLVTTGSSGGLDRELASQIVLNISARDQGVHPKVSYAQLVVTLLDVNDEKPVFSQPEGYDVSVVENAP--TGTELLMLRATDGDLGDNGTVRFSLQEAETDRRSFRLDPVSGRLSTISSLDREEQAFYSLLVLATDLGSPPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGSYITTVSATDPDLGTNGTVK-----YSISAGDRSRFQVNAQSGVI--------STRMALDRE----EKTAYQLQIVATDGGNLQSPNQAIVTITVLDTQDNPPVFSQVAYSFV-VFENVALGYHVGSVSASTMDLNSNISYLITTGDQKGMFAINQVTGQLTTANVIDREEQSFYQLKVVASGGTVTGDTMVNI-----TVKDLNDNSPHFLQAIES-VNVVENWQAGHSIFQAKAVDPDEGVNGMVLYSLKQNPKNLFAINEKNGTISLLGPLDVHAGSYQIEILASDMGVPQLSSSVILTVYVHDVNDNSPVFDQLSYEVTLSESEPVNSRFF--KVQASDKDSGANGEIAYTIAEGNTGDAFGIFP-DGQLYIKSELDR------ELQDRYVLMVVASDRAVEPLSATVNVTVILEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSFEMVQPDFELHAISGEITNTHQFDRESLMRRRGTAVFSFTVIATD-QGIPQPLKDQATVHVYMKDINDNAPKFLKDFYQATISESAANLTQVLRVSASDVDEGNNGLIHYSIIKGNEERQFAIDSTSGQVTLIGKLDYEATPAYSLVIQA----VDSGTIPLNSTCTLN----------------IDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGDNADLYYSI---TGTNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMSVVIHVRDFNDNPPSFPPGDIFKSIVENIPIGTSVISVTAHDPDADINGQLSYTIIQQMPRGNHFTIDEVKGTIYT--NAEIDREFANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFISQNALAA--DPSAVIGSVLTTIMAADPDEGANGEIEYEI-INGDTDTFIVDRYSGDLRVASAL-VPSQLIYNLIVSATDLGPERRKSTTELTIILQGLDG--PVFTQPKYITILKEGEPIGTNVISIEAASPRGSEAPVEYYIVSVRCEEKTVGRLFTIGRHTG-IIQTAAILDREQGACLYLVDVYAIEKSTAFPRTQRAEVEITLQDINDNPPVFPTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYTIISGADDSFRIDPESGDLIATRRLD--RERRSKYSLLVR-ADDGLQSSDMRINITVSDVNDHTPK--FSRPV----YSFDIPEDTIPGSLVAAILATDDDSGVNGEITY-IVNEDDEDGIFFLNPITGVFNLTRLLDYEVQQYYILTVRAEDGGG--QFTTIRVYFNILDVNDNPPIFSLNSYSTSLMENLPVGSTVLVFNVTDADDGINSQLTYSIASGDSLGQ-------FTVDKNGVLKVLKALDRESQSFYNL---VVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLT----------YIPENTPIDTVVFKAQATDPDSGPNSY--IEYTLLNPLGNKFSIGTIDGE-----VRLTGELDREEVSNYTLTVVATDKGQ----PSLSSSTEVVVMVLDINDNNPIFAQALYKVEINENT-LTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGAITVAKPLDREK 2221          

HSP 7 Score: 135.961 bits (341), Expect = 1.202e-30
Identity = 120/417 (28.78%), Postives = 212/417 (50.84%), Query Frame = 2
Query:  119 IFSIKENVPIGEVVGQIES-PGFSPPF-EMHDFQEKKFIISKTTGVIKVSGLIDREK--QNLYSFLIISMNGDTKNVQIKIL--DVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSI--QSVRIVSGDSEKVFAID--YHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFL-DNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQILW---TGGLSEINRDISPNTIVAHVKLTDYD--AISTSFDLEILNRSPFQLIKI----LPKMWELKLINDIGNYKSNSINLTLKAVD-YPEPSLSTTQA 1306
            +F + E  P G +VG I++ PGF+    E H      F I+ +TG +  +  IDRE    ++ + +++S +  T   ++++L  D+NDN P F   +   +  E+   G +V L T  D D G N +  +S RI+ G+    F +D   + S  G F + L+ K  LD E+  Q+ L+++  D G P  +  L V + VQ+ NDN P F  S Y A + ED  +  + L+V A D D G + ++ Y L D  +P    F +D +TG + +R+ LDFE  + + +++   D   P  T +   +I ++D+NDN P ++  +   T   + ++ +    T+VA + +TD D  A + +  ++IL  +  +  ++    +P +  +K+ + +   +  S NLT+   D Y  P  +  QA
Sbjct:   48 VFQVLEEQPPGTLVGTIQTRPGFTYRLSESHAL----FAINSSTGALYTTSTIDRESLPSDVINLVVLS-SAPTYPTEVRVLVRDLNDNAPVFPDPSIVVTFKEDSSSGRQVILDTATDSDIGSNGVDHRSYRIIRGNEAGRFRLDITLNPSGEGAF-LHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTP----FQMDPETGLITVREPLDFEARRQYSLTVQAMDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQSSKVPNLSLIKVASALDRERIPSYNLTVSVSDNYGAPPGAAVQA 454          

HSP 8 Score: 121.709 bits (304), Expect = 2.891e-26
Identity = 271/1286 (21.07%), Postives = 529/1286 (41.14%), Query Frame = 2
Query: 4859 SSGNLDIRYYLI-----AGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIV---QIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAI-TNFLTVVANDPDLGIFGRIIYSL--EGDTFDKKIFIDPSTGKLSC-SPLNFMEKNIYNLKIIATDSEGLS-TGRKDFTKVIIFVQNTKQHT--LAFNATHFSLKVLENSPGGTVLGRINIV---KPPVNSEIFYVLNPGHS--HIQINTTT----GELRTNGPLHLELVEFIELTIHAFAKFIS--TRSIQTTS--AXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKM-----YLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISL--NQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVN--YCKDHSAKFSIIDGVNHELVF-LHESTGKIFVAAAAKIDREK---IDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDS--DKAIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKN-----SFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESR---IWNLTIMIVKAQKYQNSPSNLYENGYLFVNI-EVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHDIQYFLTPHENFELTCSQSQSSGCNIKSKSVLDFETHENYRL--QLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIV-ENPSENFGINNETGAIYIKNQFIIE----------KKDKQRVKRSET 8518
             S  +D R Y I     AG+F    +++P +G     H VS+  + + E+    Q+ V ++   +       ++ + +   N+NPP F  S ++  +PED  + ++ L V A D D G    I Y L  EG  F     +DP TG ++   PL+F  +  Y+L + A D    S TGR +    ++ V +         F AT     V EN+  GTV+  + +     P  N  I   +  G+   H ++ ++       ++    L  E +    LT+     + +    ++Q  S  A + + + DIND+ P+ ++   ++ +     P   ++ +SATD D   N   ++          + +      +  G SG L         +  +  L +   D GV  K +   + ++L    D + V   PE     V EN+  GT +  ++  +     + + +FS+ +       F L   +G++  +  + +DRE+      ++L T +  G        ++ + + D++DN PVF   ++ A + E +P  + +  ++  DPD+G N  V+Y I     +  F ++A +G + T + L+   K+ Y L I A+   +     +  +T+ +++  D  P  S    +  +  N  +G  +  ++A   D    ISY I      +Q     +   +G++  +  +   +   ++  +V      +   ++ I V+D N++ P   +    +N+  + + G  I    A+D D   NG V + L        L   +     + L+         Y + I  +D  + PQ  L S   LTV +       P +    S E+T+ ES    S+  K    D DS  +  I Y I   +  + + +  F  G LY+   L+  +Q R++L+V  +         + N++V +E  N    L ++   T   +  E  +  + +  +  +DK+       RYS+ ++     QP+  ++  +   + +N   +    L   R   +++ T++       Q  P  L +   + V + ++ +     L+   +        N  +  + +   + E  + + ++     N E   +   +SG  +     LD+E    Y L  Q +  G+     +C+    + I +LD ++  P F   +   +V   + ++G+++ +  A+D D G    + Y I   N    F I+  TG+I++  +   E           KD+ R  RS T
Sbjct:  165 GSNGVDHRSYRIIRGNEAGRFRLDITLNP-SGEGAFLHLVSKGGL-DREVTPQYQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTPFQ----MDPETGLITVREPLDFEARRQYSLTVQAMDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQSSKVPNLSLIKVASALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFSQQVYRVNLSEEAPPGSYVSGISATDGDSGLNANLRYSIVSGNGLGWFHISEHSGLVTTGSSGGL------DRELASQIVLNISARDQGVHPKVSYAQLVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGTELLMLRATDGDLGDNGTVRFSLQEAETDRRSFRLDPVSGRL--STISSLDREEQAFYSLLVLATDL--GSPPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGSYITTVSATDPDLGTNGTVKYSIS-AGDRSRFQVNAQSGVISTRMALDREEKTAYQLQIVATDGGNLQSPNQAIVTITVLDTQDNPPVFSQVAYSFVVFENVALGYHVGSVSASTMDLNSNISYLI---TTGDQKGMFAINQVTGQLTTANVIDREEQSFYQLKVVASGGTVTGDTMVNITVKDLNDNSPHFLQAIESVNVVENWQAGHSIFQAKAVDPDEGVNGMVLYSLKQNPK--NLFAINEKNGTISLLGPLDVHAGSYQIEILASDMGV-PQ--LSSSVILTVYVHDVNDNSP-VFDQLSYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTIAEGN--TGDAFGIFPDGQLYIKSELDRELQDRYVLMVVASDRAVEPLSATVNVTVILEDVNDNRPLFNSTNYTFYFE--EEQRAGSFVGKVSAVDKDFGPNGEVRYSFEMV-----QPD--FELHAISGEITNTHQFDRESLMRRRGTAVFSFTVIATD----QGIPQPLKDQATVHVYMKDINDNAPKFLKDFYQATISESAANLTQVLRVSASDVDEGNNGLIHYSIIKGNEERQFAIDSTSG-QVTLIGKLDYEATPAYSLVIQAVDSGTIPLNSTCT----LNIDILDENDNTPSFPKSTLFVDVLENM-RIGELVSSVTATDSDSGDNADLYYSITGTNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSST 1403          

HSP 9 Score: 119.398 bits (298), Expect = 1.544e-25
Identity = 93/310 (30.00%), Postives = 152/310 (49.03%), Query Frame = 2
Query:  104 NSNLLIFSIKENVPIGEVVGQIES--PGFSPPFEMH---DFQEKKFIISKTTGVIKVSGLIDREK------QNLYSFLIISMN-------GDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTS 979
            NS    F  +E    G  VG++ +    F P  E+    +  +  F +   +G I  +   DRE         ++SF +I+ +        D   V + + D+NDN PKF    ++ +I E+    ++V   +  D DEG N +    I+ G+ E+ FAI   DS++G   V LI K  LDYE    ++LVIQA+D G  PL ++  + I + + NDN P F  S     + E+  I      V ATD+D+G + +L+Y +  T+ +   F++   TG+++L K LDFE    + ++I  +D   P  +S
Sbjct: 1101 NSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSFEMVQPDFELHAISGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKFLKDFYQATISESAANLTQVLRVSASDVDEGNNGLIHYSIIKGNEERQFAI---DSTSG--QVTLIGK--LDYEATPAYSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGDNADLYYSITGTN-NHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSS 1402          

HSP 10 Score: 112.079 bits (279), Expect = 2.314e-23
Identity = 81/256 (31.64%), Postives = 125/256 (48.83%), Query Frame = 2
Query:  194 FEMHDFQEKKFIISKTTGVIKV-SGLIDREKQNLYSFLIISMNGD-----TKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISI 943
            F  +D    KF +   TG I V S LI    QN +  +     G+        V I + + N + P+F+ ++   +IPE++ IGS V   +  D D   N +    I SG+ E +FAI+   SS GI    L L ++LDYE+  +  + I AIDGG         V + V + NDN P F    Y  ++ E+     T + + ATD D+G +  + Y +   S  SD F +D  TG +  +  LDFE  +S+H+++
Sbjct: 3022 FISNDNHLGKFKLDNDTGWISVASSLISDLNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGIFAIN---SSTGI----LTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYTVQ--SSDSDLFVIDPNTGVITTQGFLDFETKQSYHLTV 3268          

HSP 11 Score: 110.538 bits (275), Expect = 7.052e-23
Identity = 93/303 (30.69%), Postives = 148/303 (48.84%), Query Frame = 2
Query:  128 IKENVPIGEVVGQIESP---GFSPPFEMH----DFQEKK----FIISKTTGVIKVSGLIDREKQN-LYSFLIISMNGDTK-------NVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQAS-LLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHT 976
            +KE  PIG  V  IE+    G   P E +      +EK     F I + TG+I+ + ++DRE+   LY   + ++   T         V+I + D+NDN P F     + ++ EN   GSK+   T  D DEG N++ +  I+SG ++  F ID            LI  + LD E  S+++L+++A DG    LQ+S + + I V + ND+ PKF    Y   I ED         + ATD+D+GV+GE+ Y ++       FF ++  TG   L + LD+E  + + +++   D    F T
Sbjct: 1638 LKEGEPIGTNVISIEAASPRGSEAPVEYYIVSVRCEEKTVGRLFTIGRHTGIIQTAAILDREQGACLYLVDVYAIEKSTAFPRTQRAEVEITLQDINDNPPVFPTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYTIISG-ADDSFRIDPESGD-------LIATRRLDRERRSKYSLLVRADDG----LQSSDMRINITVSDVNDHTPKFSRPVYSFDIPEDTIPGSLVAAILATDDDSGVNGEITYIVNEDDEDGIFF-LNPITGVFNLTRLLDYEVQQYYILTVRAEDGGGQFTT 1927          

HSP 12 Score: 107.457 bits (267), Expect = 6.174e-22
Identity = 85/262 (32.44%), Postives = 131/262 (50.00%), Query Frame = 2
Query:  203 HDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGD----TKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPP---LQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
             D ++  F ++  TGV  ++ L+D E Q  Y   + + +G     T  V   ILDVNDN P F+  ++  S+ EN P+GS V +  V D D+G NS  +  I SGDS   F +D     NG+  V     ++LD E  S +NLV+Q  D    P     ++  V II+ + NDN P F +S  +  I E+  I+    + +ATD D+G +  + Y L N  P  + F++    G V L   LD E+  ++ +++   D   P
Sbjct: 1882 EDDEDGIFFLNPITGVFNLTRLLDYEVQQYYILTVRAEDGGGQFTTIRVYFNILDVNDNPPIFSLNSYSTSLMENLPVGSTVLVFNVTDADDGINSQLTYSIASGDSLGQFTVD----KNGVLKVL----KALDRESQSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTF-LSPKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLN--PLGNKFSIGTIDGEVRLTGELDREEVSNYTLTVVATDKGQP 2132          

HSP 13 Score: 101.679 bits (252), Expect = 3.246e-20
Identity = 78/274 (28.47%), Postives = 136/274 (49.64%), Query Frame = 2
Query:  122 FSIKENVPIGEVVGQIESPGFSPPFEMHDF-----QEKKFIISKTTGVIKVSGLIDREKQNLYSFLIIS----MNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFE 916
            F + ENV +G  VG + +        +        Q+  F I++ TG +  + +IDRE+Q+ Y   +++    + GDT  V I + D+NDN P F       ++ EN+  G  +      DPDEG N +  +  +  + + +FAI+  + +       + L   LD    S + + I A D G P L +S+++ + V + NDN P FD   Y  ++ E + +N  F +V+A+D D+G +GE+ Y +   + + D F +    G +Y++  LD E
Sbjct:  800 FVVFENVALGYHVGSVSASTMDLNSNISYLITTGDQKGMFAINQVTGQLTTANVIDREEQSFYQLKVVASGGTVTGDTM-VNITVKDLNDNSPHFLQAIESVNVVENWQAGHSIFQAKAVDPDEGVNGM-VLYSLKQNPKNLFAINEKNGT-------ISLLGPLDVHAGS-YQIEILASDMGVPQLSSSVILTVYVHDVNDNSPVFDQLSYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTIAEGN-TGDAFGI-FPDGQLYIKSELDRE 1061          

HSP 14 Score: 98.2117 bits (243), Expect = 3.504e-19
Identity = 83/308 (26.95%), Postives = 144/308 (46.75%), Query Frame = 2
Query:  107 SNLLIFSIKENVPIGEVVGQI--ESPGFSPPFEMH-----DFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNG--------DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKN-SIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVS-GELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTS 979
            S L  F I E  P G +VG++           E+H     + ++K F I+K TG I VSG++DREK+   S  +++ N         D   V + +LD ND  P F    +   I E  PIG+ V   + FD D   + S  S  I SG+    F+I+           ++ +   LD E +  +NL + A+D G P    S  + + +++ NDN P   +S     + E++      + +++TD D   + G   Y+L +T P++ +F++    G +   + +D E+    ++S+  +D+  P  +S
Sbjct: 3300 SKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDAND-PPIFTLNIYSVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTG-------QITVTAELDRETLPIYNLSVLAVDSGTPSATGSASLLVTLEDINDNGPMLTVSE--GEVMENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGPATSYFSL-STAGVLSTTREIDREQIADFYLSVVTKDSGVPQMSS 3596          

HSP 15 Score: 81.6481 bits (200), Expect = 3.184e-14
Identity = 71/259 (27.41%), Postives = 124/259 (47.88%), Query Frame = 2
Query:  224 FIISKTTGVIKV--SGLIDREKQNLYSFLIISMNGDTKNVQIKI---------LDVNDNEPKFN-ATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEK-VFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNS 961
            F IS+ +G++    SG +DRE   L S ++++++   + V  K+         LDVND +P F+    ++ S+ EN P G+++ +    D D G N      +   ++++  F +D           RL    SLD E  + ++L++ A D G PP  +   + + + + NDN P F   +Y A IKE++        V ATD D G +G + Y +     S   F V+ ++G +  R +LD E+  ++ + I   D  
Sbjct:  523 FHISEHSGLVTTGSSGGLDRE---LASQIVLNISARDQGVHPKVSYAQLVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGTELLMLRATDGDLGDNGTVRFSLQEAETDRRSFRLDPVSG-------RLSTISSLDREEQAFYSLLVLATDLGSPPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGSYITTVSATDPDLGTNGTVKYSISAGDRSR--FQVNAQSGVISTRMALDREEKTAYQLQIVATDGG 769          

HSP 16 Score: 80.8777 bits (198), Expect = 5.488e-14
Identity = 89/397 (22.42%), Postives = 155/397 (39.04%), Query Frame = 2
Query:  215 EKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMN------GDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISI------------------GVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQIL--WTGGLSEINRDISPNTIVAHVKLTDYDAISTSFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHE 1327
             + F +   +G +     +DRE+Q  YS L+++ +           + + +LD+NDN P F    +   I EN P GS +   +  DPD G N      I +GD  + F ++   + +G+   R+    +LD E  + + L I A DGG+       +V I V +  DN P F    Y   + E+  +      V A+  D  ++  + Y +  T      F ++  TG +     +D E+   + + +                   + DNSP F                   S+ ++  W  G S           +   K  D D       L  L ++P  L  I  K   + L+  + +  + S  + + A D   P LS++  LT+ +H+
Sbjct:  629 RRSFRLDPVSGRLSTISSLDREEQAFYSLLVLATDLGSPPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGSYITTVSATDPDLGTNGTVKYSISAGDRSR-FQVN---AQSGVISTRM----ALDREEKTAYQLQIVATDGGNLQSPNQAIVTITVLDTQDNPPVFSQVAYSFVVFENVALGYHVGSVSASTMD--LNSNISYLI-TTGDQKGMFAINQVTGQLTTANVIDREEQSFYQLKVVASGGTVTGDTMVNITVKDLNDNSPHF--------------LQAIESVNVVENWQAGHS-----------IFQAKAVDPDEGVNGMVLYSLKQNPKNLFAINEKNGTISLLGPL-DVHAGSYQIEILASDMGVPQLSSSVILTVYVHD 988          

HSP 17 Score: 73.9442 bits (180), Expect = 6.891e-12
Identity = 80/309 (25.89%), Postives = 129/309 (41.75%), Query Frame = 2
Query:  125 SIKENVPIGEVVGQI-----ESPGFSPPFEMHDF---QEKKFIISKTT----GVIKVSGLIDREKQNLYSFLI-------------ISMNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGG-HPPLQASLLVKIIVQNANDNVPKFDISR-YIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD-NSPP 967
            S+ EN  +G VV  +     +SP  +    +      +++ F +  +      +IKV+  +DRE+   Y+  +             +       ++ I + D+ND+ P F+   +  ++ E  P GS V   +  D D G N+     IVSG+    F I  H        V       LD E+ SQ  L I A D G HP +  + LV + + + ND  P F     Y  S+ E+       L +RATD D G +G + + L         F +D  +G +    SLD E+   + + +   D  SPP
Sbjct:  366 SVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQSSKVPNLSLIKVASALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFSQQVYRVNLSEEAPPGSYVSGISATDGDSGLNANLRYSIVSGNGLGWFHISEHSG-----LVTTGSSGGLDRELASQIVLNISARDQGVHPKVSYAQLV-VTLLDVNDEKPVFSQPEGYDVSVVENAPTGTELLMLRATDGDLGDNGTVRFSLQEAETDRRSFRLDPVSGRLSTISSLDREEQAFYSLLVLATDLGSPP 668          

HSP 18 Score: 65.4698 bits (158), Expect = 2.527e-9
Identity = 77/294 (26.19%), Postives = 122/294 (41.50%), Query Frame = 2
Query:  125 SIKENVPIGEVVGQIESPGFSPPFEMHDF----------QEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDT----------KNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLD---NTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHI 937
            SI EN+PIG  V  I      P  +++            +   F I +  G I  +  IDRE  NL+  L +  N             KNV I + D+NDN P F + N   + P    IGS +      DPDEG N      I++GD++  F +D +   +G   V   L  S   ++I  +NL++ A D G    +++  + II+Q  +   P F   +YI  +KE + I    + + A       +   +Y +            FT+   TG +     LD E+    ++
Sbjct: 1428 SIVENIPIGTSV--ISVTAHDPDADINGQLSYTIIQQMPRGNHFTIDEVKGTIYTNAEIDREFANLFE-LTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFISQNALAADPSAV-IGSVLTTIMAADPDEGANGEIEYEIINGDTD-TFIVDRY---SGDLRVASALVPS---QLI--YNLIVSATDLGPERRKSTTELTIILQGLDG--PVFTQPKYITILKEGEPIGTNVISIEAASPRGSEAPVEYYIVSVRCEEKTVGRLFTIGRHTGIIQTAAILDREQGACLYL 1706          
BLAST of Dachsous vs. Ensembl Human
Match: FAT4 (FAT atypical cadherin 4 [Source:HGNC Symbol;Acc:HGNC:23109])

HSP 1 Score: 233.417 bits (594), Expect = 3.981e-60
Identity = 402/1742 (23.08%), Postives = 720/1742 (41.33%), Query Frame = 2
Query: 3458 SKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVKIRIFV-SDLGFPKMTSSVDTLLKPL--YEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYG--AKCLFISNTTTSVDGFLHLR-----FDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLK---NLEVVYSIKQPEKY--FVINPVTGQLVTFRMFDRETENQIQFYVEVIATH----VSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQI-NPSSDGIFMINGDSGEIHLVSS---PRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAI--TNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCS-PLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPVNSEIFYVLNPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGG-SEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLID-ANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWF------------------GLRGFDN-NTAALFLIDEPQEKGHPYFLG-IQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKAIFYKIDNFHPISNNL---YLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYDPPSFQIDSS-NILWWINGDLFE-SRIWNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHD------IQYFLTPHENFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIVENP-SENFGINNETGAIYIKNQFIIEKKDKQRV 8503
            + + V  + I   + N NPP  V P     +     +  GS+I  + A+D D+G N++  Y+I    D  D   ID  +G +     L   +  K  + V +D G       ++  +  +  + PK    +     +F IP+ + PG +V  +    ++ G   +  +I N     DG   L      F+  +L+    +  V+  +Y L V          +  +Y N++   V  + P+FS +S     + ENLP GS V  FN+       N ++ YSI   +    F ++   G L   +  DRE+++   FY  V+  H    +   +  +   + + + D NDN P  LSP  + +  + P   +  +F+  ATD DSGPNS + Y + NP  +  F I    GE+ L        VS Y L V   D G+   S S    +    I   + I   + +L        + +G  I Q+  +      N  +RY ++ G   Q F +D +TG++     + RE+     +        S        +  + ++I   N+  P F  S + V +PE+        L VVA D D G   ++ Y L G   D   F   ++G+L  +  L+   K  + L I ATDS   S        + + V +   +   F +  +   + E++P GT +  +N      +      +  G+S   IN +TG++ T+  L  E  +   L +        +    ++S  + V + D+NDN P    +P    IP+   P   +  ++ TD+D   N    +  S   ++  +    +D   G +     +  + ++     V V D G   K  +  + +       + ++  ++  F   EN    + +  I   +  +     + I  G       + + TG++ ++    +D EKI K ++W +   GG      Y+K+ I V DV+DN P+F ++ F++ + E   P+  ++ ++  D D G N Q++Y I   + +  F I+ A G++++  PL+    S Y L IK+S K SP      ++ + I++ ND  P+ S    +  +  N P+G  +T++T  D D   GI+   R+  + + +L   +   +G+I +SR L   D  ++   +   D+ ++ +  + I V D N++ P        ++     + GSK+  + A D D   NG+V + + S S +F                   + GF N N      I    ++G P  +    +T N +D                    YF        T +T  +++K G+K+ +    D D D  +  +++ F    N+L    LD ++G + +  SL   +   F + VT    G+P   +   + + + +EN         +  +S  +PE     +I+  +   D+++        S++    E I     F I+SS  IL       +E  +   +TI  +           +   GY  V + V +  + +             + EN P  TTV+ L     D      I Y +   ++       +      I ++  LDFET ++Y L +         R CS    V I +   +EY P FV + +   +    PK G I+   +ASD+D G  G V Y I  N   + F IN +TG IY+    I++++ ++RV
Sbjct:   17 AAAEVFIVEITLQDINDNPP--VFPTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYTIISGAD--DSFRIDPESGDLIATRRLDRERRSKYSLLVRADDGLQSSDMRINITVSDVNDHTPKFSRPV----YSFDIPEDTIPGSLVAAILATDDDSGVNGEITYIVNEDDE-DGIFFLNPITGVFNLTRLL----DYEVQQ-YYILTVRAEDGGGQFTTIRVYFNIL--DVNDNPPIFSLNS-YSTSLMENLPVGSTVLVFNVTDADDGINSQLTYSIASGDSLGQFTVDK-NGVLKVLKALDRESQS---FYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLTYIPENTPI--DTVVFKAQATDPDSGPNSYIEYTLLNPLGNK-FSIGTIDGEVRLTGELDREEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPI--FAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGAITVAKPLDREKTPTYHLTVQATDRGSTPRTDTSTVSIVLLDI---NDFVPVFELSPYSVNVPENLGTLPRTILQVVARDDDRGSNSKLSYVLFGGNEDNA-FTLSASGELGVTQSLDRETKERFVLMITATDSG--SPALTGTGTINVIVDDVNDNVPTFASKAYFTTIPEDAPTGTDVLLVNASDADASKNAVIRIIGGNSQFTINPSTGQIITSALLDRETKDNYTLVV--VCSDAGSPEPLSSSTSVLVTVTDVNDNPPRFQHHPYVTHIPSPTLPGSFVFAVTVTDADIGPNSELHYSLSGRNSEKFH----IDPLRGAIMAAGPLNGASEVT--FSVHVKDGGSFPKTDSTTVTVRFVNKADFPKVRAKEQTFMFPENQPVSSLVTTITGSSL-RGEPMSYYIASGNLGNTFQIDQLTGQVSISQ--PLDFEKIQKYVVWIEARDGGFPPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLSPRK-ILTVSAMDKDSGPNGQLDYEIVNGNMENSFSINHATGEIRSVRPLDREKVSHYVLTIKSSDKGSPSQSTSVKVMINILDENDNAPRFS-QIFSAHVPENSPLGYTVTRVTTSDED--IGINAISRY-SIMDASLPFTINPSTGDIVISRPLNREDTDRYRIRVSAHDSGWTVSTDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFATDPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLK--------SKYF--------TPVT--KNVKVGTKLIRVTAID-DKDFGLNSEVEYFISNDNHLGKFKLDNDTGWISVASSLISDLNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSH--MSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGI-----FAINSSTGILTLAKALDYELCQKHEMTISAIDGGW-------VARTGYCSVTVNVID--VNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYTVQSSDSDLFVIDPNTGV---ITTQGFLDFETKQSYHLTVKAFNVPDEER-CSFA-TVNIQLKGTNEYVPRFVSKLYYFEISEAAPK-GTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSG--ILDREKEERV 1667          

HSP 2 Score: 196.052 bits (497), Expect = 7.161e-49
Identity = 449/1944 (23.10%), Postives = 802/1944 (41.26%), Query Frame = 2
Query: 2183 LIVKSVIRKPFNVSPLNIVAINFQKLFFARSLY---QFILTKSEIKGNLVKIGQVSM---DSSCTESVSYDLFGVKNDHSHFTIDVATG-VIYGKDLGSISNKTLMFQVSAKAPKSQTSFAQVIIYIED-GIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSDEYQIIQSQYSDWLSIHSKTGQIFLN---------KQFDREQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKP--YCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSD--NGPFKPLETEVEISVRIIDANNHSPILISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVKIRIFV--SDLG-FPKM-TSSVDTLL------KPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRL-KNLEVVYSIKQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPK-IFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEIHLVSSPRVSAYEL--NVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLD-IRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKL-SCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPV--NSEIFYVLNPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSN--ITY------QFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPS--KCTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSI---IDGVNHELVF-LHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDANGDVKT-NIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVD-----DARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQK----------------RLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKAIFYKIDNFHPISNN----LYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKEN-KGPNLIDNKYITLSLQVPEMIQ--KPAIISNLLQ-----MDKNSFRYSYYLISVAP 7747
            + V   + +P   + + IV I  Q +     ++      LT  E  G+  KI Q++    D      V+Y +    +D   F ID  +G +I  + L           V A     Q+S  ++ I + D   H P F       +I E+T  G  +  +       +D+   +  + +  ++   + G  FLN         +  D E   Y ++TV+ ++  G  T       +   ++ P  +  NS +    E+L  +G        +DAD   N  L+Y +     +G    F ++   G L ++ +L+  + +     NL+V V D    P     +  ++S+ ++D N++ P  +S  + YI +     T V      D D G N  IE +L  P   + F I  +     +      E +++Y     + ++ATD+G PS SS   +V+  ++ N N P  +  +   ++      L+G++I  V A D D+G N    Y I     N+ +  IDS TG IT    L   +     + V  +D G  P+  TS+V  +L       P++E       + +NL  +     Q   V  D +    +  +  LF  N     D    L    +  +    +   K   + L +        +++    INVIV+ V  + P F+  +  F  I E+ P+G+ V   N      +   V  I      F INP TGQ++T  + DRET++   + + V+ +   +P+ + +   ++V + D NDN P        +  I +PT   + +F +  TDAD GPNS+L Y ++  +   F I+   G I + + P   A E+  +V V+D G  PK+ S   ++ F +     K+R    +     + P       +  L  + T SS   + + YY+ +G     F +D +TG V     +  E+I    +V I          S Y  +++ I +   N+N P F    F  ++ E+ +    LTV A D D G  G++ Y +     +    I+ +TG++ S  PL+  + + Y L I ++D    S  +    KV+I + +   +   F+   FS  V ENSP G  + R+      +  N+   Y +        IN +TG++  + PL+ E  +   + + A        S  T S  + + + DINDN P  +     +  P   +    +T++ ATD D+ SN  + Y      ++ R + TT  ++   +L  ++   F   ++      RH   V  SD G PS    TTV I+I ++ +    Q +  K    V +N   GT + ++  ++  KD      +   I   NH   F L   TG I VA++   D  + +  I  T    G   +     V I V + + + P FSQ+   A + E     + V  ++  D D   N  ++Y I   + +  F I+++  + T    L++     +++ I A           C +TV ++++ND  P     +    +  N P G+ +  + A D+D G +  I+Y ++    ++  LF+    D     ++ +  +    K  + + V      D    S A + I ++  N +VP          +S +  +G+ +  + A D+DL  +G+V + +           F N+    F I+  ++ G  Y  GI      +D +K                R   I  +TV +    +  P +   +   + I E +  G+ +T FV    DSD    +   ++   S N      ++ ++G + +T  L+    P + L V     G+P    S +L V +E  N  GP         L++   E+++  +P  +   LQ     +  N   ++YYL+S  P
Sbjct:    6 VAVGDTLAQPLAAAEVFIVEITLQDINDNPPVFPTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYTIISGADDS--FRIDPESGDLIATRRLDRERRSKYSLLVRADD-GLQSSDMRINITVSDVNDHTPKFSRPVYSFDIPEDTIPGSLVAAIL-----ATDDDSGVNGEITYIVNEDDEDGIFFLNPITGVFNLTRLLDYEVQQYYILTVRAEDGGGQFTTIRVYFNILDVNDNPPIFSLNSYSTSLMENLP-VGSTVLVFNVTDADDGINSQLTYSIASGDSLGQ---FTVD-KNGVLKVLKALDRESQS---FYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPLGNK-FSIGTIDGEVRLTGELDREEVSNY----TLTVVATDKGQPSLSSSTEVVVMVLDINDNNP--IFAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQ-EFRIDSVTGAITVAKPLDREKTPTYHLTVQATDRGSTPRTDTSTVSIVLLDINDFVPVFELSPYSVNVPENLGTLPRTILQ--VVARDDDRGSNSKLSYVLFGGNE----DNAFTLSASGELGVTQSLDRETKE-RFVLMITATDSGSPALTGTGTINVIVDDVNDNVPTFASKA-YFTTIPEDAPTGTDVLLVNASDADASKNAVIRIIGGNSQFTINPSTGQIITSALLDRETKDN--YTLVVVCSDAGSPEPLSSSTSVLVTVTDVNDNPPR-FQHHPYVTHIPSPTLPGSFVFAVTVTDADIGPNSELHYSLSGRNSEKFHIDPLRGAI-MAAGPLNGASEVTFSVHVKDGGSFPKTDSTTVTVRFVNKADFPKVRAKEQTFMFPENQP-------VSSLVTTITGSSLRGEPMSYYIASGNLGNTFQIDQLTGQVSISQPLDFEKI-QKYVVWIEARDGGFPPFSSY--EKLDITVLDVNDNAPIFKEDPFISEILENLSPRKILTVSAMDKDSGPNGQLDYEIVNGNMENSFSINHATGEIRSVRPLDREKVSHYVLTIKSSDKG--SPSQSTSVKVMINILDENDNAPRFSQI-FSAHVPENSPLGYTVTRVTTSDEDIGINAISRYSIMDASLPFTINPSTGDIVISRPLNREDTDRYRIRVSAH------DSGWTVSTDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFATDPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQILKYQNVTGFSNVNIN-----RHSFIVTSSDRGKPSLISETTVTINI-VDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDD-KDFGLNSEVEYFISNDNHLGKFKLDNDTGWISVASSLISDLNQ-NFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYTVQS---SDSDLFV---IDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLI-----------FGNSRKKGFQIN--KKTGQIYVSGI------LDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDPPIFTLNIYSVQISEGVPIGTHVT-FVSA-FDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTAELDRETLPIYNLSVLAVDSGTPSATGSASLLVTLEDINDNGP--------MLTVSEGEVMENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGP 1851          

HSP 3 Score: 159.844 bits (403), Expect = 6.619e-38
Identity = 402/1864 (21.57%), Postives = 715/1864 (38.36%), Query Frame = 2
Query:  107 SNLLIFSIKENVPIGEVVGQI------ESPGFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNG---DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLI-----LKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSK-XXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDAISTSF-DLEILN--RSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEIDSTILNENQHVTFVKTTKRLPTKPIFIFKIF--VLNNLFKINETTGEILSKRSIDCGK---YFFNVSMLSLKTNSLIDQTKLEIVVKSGRKLPLYFDRGFRKILVTTGKS---QCFSEIAVRNRHCGMRIQYSYDLLLKT-DGILRINEHGALCTAENVKHNKLMSTRYLYQIKALDETNSSAVCVVLFAIQPSKVFDVLPTEINITLPIIDSPKFNFSLPIGKIIGTFSKLPPAQFIGFIQYHLVPEELSTGAITVDSQSGEILMKKF---PIHKNPIRLIVKSVIRKPFNVSP-----LNIVAINFQKLFFARSLYQFILTKSEIKGNLV-KIGQVSMDSSCTESVSYDLFGVKNDHSHFTIDVATGVIYGKDLGSISNKTLMFQVSAKAPKSQTSFAQVIIYIEDGIHQPGFDFSDLLVNIWENTTV----GIEIMQVFPKYPSVSD---------------EYQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFED-------------LSSLGEMECPLK-----CSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLS--GSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSL-----SCAQNVKIR-----IFVSDLGFPKMTSSVDTLLKPL-YEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKC---LFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIR---RLKNLEVVYSIKQ--PEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVI-ATHVSNPKIFTVLPLIVKIADENDNEPYILSPSS-SIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEI--------------HLV-------SSPRVSAYELNVTVRDSGE-VPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNEN-PPRFSRSIFKVKLPEDEAITNFLTVV-ANDPD-LGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCSP-LNFMEKNIYNLKIIATDS 5332
            +++L  +++EN+  G  + Q+      E       + +    +  F I   +G +  +  +DRE+++ YS L+ + +G       + I + DVND+ PKF+   +   IPE+   GS V      D D G N             ++  I   D  +GIF++  I     L + LDYE+   + L ++A DGG      ++ V   + + NDN P F ++ Y  S+ E+  +  T L    TD D G++ +L Y +  +  S   FTVD K G + + K+LD E    +++ + V D  P    S+        I + D   +     +  L+ I  +   +T+V   + TD D+   S+ +  +LN   + F +  I     E++L  ++   + ++  LT+ A D  +PSLS++  + + + +       F+ + ++VEI+   L     +          T     + I     N  F+I+  TG I   + +D  K   Y   V      +    D + + IV+         F+     + V        +   ++  R+   G   + SY L     D    ++  G L   +++  ++    R++  I A D  +         A+  +   +V+  ++N  +P   S  +  ++P     GT   L  A      +  ++         T++  +G+I+           N   ++V S    P  +S      + +  +N     F    Y   +    + G+ V  +     D      + Y L G  ++  H  ID   G I                  A  P +  S     ++++DG   P  D + + V              E   +FP+   VS                 Y I      +   I   TGQ+ +++  D E++   VV ++ ++                    P+    K + T  D             +S + E   P K       D DS PNG L Y    I    M N F IN  TG +  +  L+    +      +L I S +       T V++ + I+D N+++P        ++ + +  G  V  +   DEDIG N     S+        F I   + +  + R  + E  + Y     + + A D G    + V   V +    N N P              CP L+  GS++  V A DPD+G N    Y I+      +   I++ TG I  K  L     +   NV I      +  SD G P + S     +  +     + +FL +K  T +  +      ++    I  +++G       FISN      G   L  D+  + +    ++  N ++ + V    K    +SS   +++ V    +  P FS+ S     I E+   GS V + + R      N  + YSI     E  F IN  TG L   +  D E   + +  +  I    V+     +V    V + D NDN P  LS      V  +AP+    ++  + ATDADSG N+ + Y +  S   +F+I+ ++G I              HL           R S   +N+ ++ + E VP+ VS ++         K                     G I+G++  S      + ++ Y +      + F ++  TG +     + RE+    E V + V+ ++       D+  + +N+   + N PP F+ +I+ V++ E   I   +T V A D D +  + R  Y +     +    I+P TG+++ +  L+     IYNL ++A DS
Sbjct:   40 TDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYTIISGADDSFRIDPESGDLIATRRLDRERRSKYSLLVRADDGLQSSDMRINITVSDVNDHTPKFSRPVYSFDIPEDTIPGSLVAAILATDDDSGVNG------------EITYIVNEDDEDGIFFLNPITGVFNLTRLLDYEVQQYYILTVRAEDGGG--QFTTIRVYFNILDVNDNPPIFSLNSYSTSLMENLPVGSTVLVFNVTDADDGINSQLTYSI-ASGDSLGQFTVD-KNGVLKVLKALDRESQSFYNLVVQVHD-LPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPLGNKFSIGTI---DGEVRLTGELDREEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGAITVAKPLDREKTPTYHLTVQATDRGSTPRTDTSTVSIVLLDINDFVPVFELSPYSVNVPENLGTLPRTILQVVARDDDRGSNSKLSYVLFGGNEDNAFTLSASGELGVTQSL--DRETKERFVLMITATDSGSP--------ALTGTGTINVIVDDVNDNVPTFASKAYFTTIPEDAPTGTDVLLVNASDADASKNAVIRIIGGNSQFTINPSTGQIITSALLDRETKDNYTLVVVCSDAGSPEPLSSSTSVLVTVTDVNDNPPRFQHHPYVTHIPSPTLPGSFVFAVTVTDADIGPNSELHYSLSGRNSEKFH--IDPLRGAIM-----------------AAGPLNGASEVTFSVHVKDGGSFPKTDSTTVTVRFVNKADFPKVRAKEQTFMFPENQPVSSLVTTITGSSLRGEPMSYYIASGNLGNTFQIDQLTGQVSISQPLDFEKIQKYVVWIEARD----------------GGFPPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLSPRKILTVSAMDKDSGPNGQLDYE---IVNGNMENSFSINHATGEIRSVRPLDREKVSHY----VLTIKSSDKGSPSQSTSVKVMINILDENDNAPRFSQIFSAHVPENSPLGYTVTRVTTSDEDIGINAISRYSIMDASLP--FTINPSTGDIVISRPLNREDTDRY----RIRVSAHDSGWTVSTDVTIFVTDI---NDNAPRF----SRTSYYLDCPELTEIGSKVTQVFATDPDEGSNGQVFYFIK---SQSEYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISNDNHL--GKFKLDNDTGWISVASSLISDLNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQ-SHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSV---TVNVIDVNDNSPVFLSDDYFPTVLENAPS--GTTVIHLNATDADSGTNAVIAYTVQSSDSDLFVIDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLYYFEISEAAPK---------------------GTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGILDREK---EERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDPPIFTLNIYSVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTAELDRETLPIYNLSVLAVDS 1783          

HSP 4 Score: 98.2117 bits (243), Expect = 3.107e-19
Identity = 83/308 (26.95%), Postives = 144/308 (46.75%), Query Frame = 2
Query:  107 SNLLIFSIKENVPIGEVVGQI--ESPGFSPPFEMH-----DFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNG--------DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKN-SIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVS-GELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTS 979
            S L  F I E  P G +VG++           E+H     + ++K F I+K TG I VSG++DREK+   S  +++ N         D   V + +LD ND  P F    +   I E  PIG+ V   + FD D   + S  S  I SG+    F+I+           ++ +   LD E +  +NL + A+D G P    S  + + +++ NDN P   +S     + E++      + +++TD D   + G   Y+L +T P++ +F++    G +   + +D E+    ++S+  +D+  P  +S
Sbjct: 1598 SKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDAND-PPIFTLNIYSVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTG-------QITVTAELDRETLPIYNLSVLAVDSGTPSATGSASLLVTLEDINDNGPMLTVSE--GEVMENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGPATSYFSL-STAGVLSTTREIDREQIADFYLSVVTKDSGVPQMSS 1894          

HSP 5 Score: 94.3597 bits (233), Expect = 4.216e-18
Identity = 69/215 (32.09%), Postives = 110/215 (51.16%), Query Frame = 2
Query:  335 VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQAS-LLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHT 976
            V+I + D+NDN P F     + ++ EN   GSK+   T  D DEG N++ +  I+SG ++  F ID            LI  + LD E  S+++L+++A DG    LQ+S + + I V + ND+ PKF    Y   I ED         + ATD+D+GV+GE+ Y ++       FF ++  TG   L + LD+E  + + +++   D    F T
Sbjct:   24 VEITLQDINDNPPVFPTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYTIISG-ADDSFRIDPESGD-------LIATRRLDRERRSKYSLLVRADDG----LQSSDMRINITVSDVNDHTPKFSRPVYSFDIPEDTIPGSLVAAILATDDDSGVNGEITYIVNEDDEDGIFF-LNPITGVFNLTRLLDYEVQQYYILTVRAEDGGGQFTT 225          
BLAST of Dachsous vs. Ensembl Human
Match: DCHS2 (dachsous cadherin-related 2 [Source:HGNC Symbol;Acc:HGNC:23111])

HSP 1 Score: 231.491 bits (589), Expect = 1.521e-59
Identity = 399/1759 (22.68%), Postives = 769/1759 (43.72%), Query Frame = 2
Query: 3425 VMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEI----FTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLI--TTKVSLSCAQNVKIRIFVSDLGFPKMTSS--VDTLLKPLYEPKSEEFLINKNLT-FIIPDHSQPGYVVGDL---NIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVF--NKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIR----RLKNLEVVYSIKQ---PEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVI--ATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGI-FMINGDSGEIHLVSSPRVSAYE------LNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPP--VNSEIFYVL-NPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNL-FXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFR--VKENSVDGTFIGQIKMVNYCKD---HSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRG-------------FDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKA---IFYKI------DNFHPISNNLYLDF---ESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKG-PNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESRI-WNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEW------YHDIQY------FLTPHENFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVH-QSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIVENPSENFGINNETGAIYI 8461
            + ++ TDRGSP +++ + + ++  + N N P    P+          +L G  +     TV A DPD+G N+   YS+  + D+ D   ID+  G I  TT +S     + ++ +  +D G P +     V+  + PL + ++   ++++N+   IIP++ +P  ++  +   +   ++Y  K  F S      DG   +   +  L L K+       HY   V+   + KNL S+SS +++++ V       P F +D    + ++EN+P G+ V  FN +       N  + Y I+        F+I+P  G LVT    DRE+   +   V     A +V++ ++ ++   IV I D ND+ P  +S  ++ V+     T  + +  I A D D G N K+TY I   ++ + FM++  SG   L+++     YE      L V   D G    S S   ++    +  ++ + F  +    ++   Q+   F+  ++      S  N  +++ ++ G   ++F ++  TG V T   + RE     E+  + V+++     S+     I   ++  N++ P F  S + +++ E++      TV+A+D D G    + Y +     D+   I+  +G+LS +      + I N  ++   S+     R     + + V +   H+ +F   ++   V E++  GTV+  ++ V     +N +  Y L +       I+  +G L+T+  L  E     + T  A A+  S +  ++T+ II V + D+NDN P+  +NP  +F+   +   +    + A D D   N T  F  ++  TQ+   M+ +D  +G + F ++       I  +L++ V+D G+P++ TT L+ I +  + + V+I     +++  V EN   GT I  +K   +  D    S K+SI  G    ++ L   +G++ V     +D E  +++ L       G   R Y KV + + D +DN P F Q+ + A ++E Q     VI++   D D G N  +EY I   + +E F IDA +G + T   L++   S Y L+++A+ K  P +     + V + +IND  P   +P+  +++  +   G  +T ++  D D      +     K +N      +  ++G + L + L   ++ ++E  I + D+   +   + + V D N++ P+  ++   + +  S+  G  +L L A   DL  N  +++ ++S+S  F +                D  +   FL+ E  + G+P    + L +  I+        F +       +SY           +++ E    GS +  F   D D  +    + Y I      +NFH  +   + ++   + G L L  SL+        L++  +  G P   ++  +S+Q+   N   PN     Y T    V E     + I+ +   D+++  ++  + ++     +  +    +  +++ +L+ I    +E    + LT+    A+K   S + ++ +  L  N   P+ M  +   C        ++ EN P  +T+  +         Y ++ Y      FLT   +++           +I +K +LD+E    Y L +  K         + +++V + +  +DE+ P F   Q F    E    K  Q++    ASD D G  G++ Y +  + S  F +N   G IY+
Sbjct: 1262 MTVLVTDRGSPPRNATMAVYVSVTDINDNRP--FFPQCLPGKELHVKVLEGQPVNMLVTTVFAKDPDEGNNAEVTYSVS-SEDSSDHFKIDANNGEIRTTTILSYDYRPSYRMSVIATDQGVPPLQGQAVVNIQVIPLSKGRA---IMSQNIRHLIIPENLKPTKIMSLIKSSDHLQQHYNGKLHF-SIVADDKDGHFEIDSSTGDLFLSKELDYETTSHYLFRVITTDHSKNL-SLSSTVFLSIDVEDQNDHSPSF-QDELIVISVEENVPIGTLVYVFNAKDDDGSFLNSRIQYYIESHNPGTNPFLIHPSFGTLVTVSRLDRESIPTVILTVTASDQAVNVTDRRLRSLTAQIV-ILDVNDHNPTFISFPNAHVK--EDVTVGSLVHHITAHDPDEGRNGKVTYSILSGNENMTFMLDESSG---LLTTTCPLDYEMKTQHILTVLALDDGTPALSSSQTLTVTVLDVNDEAPV-FKQHLYEASVKENQNPGEFVT-RVEALDRDSGVNSKLQFEIMPGASFELFEINSDTGEVVTTTILDRE---IQEVFTLRVLVRDGGFPSLSSTTTILCTVEDENDHAPEFIVSSYDIEVLENQEPEVVYTVLASDMDAGNNRAVEYHIIDGNTDECFTINEMSGELSTT-RALDREQISNFTLVILCSDLGDPPRSSVIHLQVRVLDANDHSPSFPTLYYQSSVREDAEVGTVVLVLSAVDKDEGLNGQTEYFLTDEASGAFTIDPMSGTLKTSNTLDREARS--QHTFSAVARDCSIQGSRSTTVIIKVYVTDVNDNDPVLEQNPFDVFLSPESPTNQTTVIVRADDLDLGPNGTVVFSFAE--TQS---MFSIDKYTGEIQFQQNPSSEYFPI--WLQLKVTDQGIPARTTTGLLVIHM--EGEDVKISFSHHLYKGLVTENCEAGTSIVTVKA--FAPDSIQDSMKYSIFSGNEDGVLSLCSKSGQLTVKEPKFLDFEVRNEVQLIVLAESSGH--RAYCKVAVLIQDENDNSPCFEQSIYQASVSESQLYNAHVIQVFATDLDSGLNGLIEYSILSGNQEEAFQIDALSGVITTKAILDYELTSSYSLIVQATDKGMPRLSNTTVIKVQVTDINDNAPAF-LPSEAVEITEDSLPGVIVTHVSVHDVDLNSAFIFSF--AKESNPGTKFAIDQNTGVVVLVKTLDFEEMTEYELLIQISDSVHYTEGALVVRVLDVNDNPPVFSQDFYQVTVPESIPVGYSVLTLSA--TDLESNENISYRILSSSKEFSIDPKNGTIFTISPVLLLDTISTTQFLV-EASDGGNPDLRALTLVEIGIEDMNNYAPEFTV-------KSY----------NLSLSEDALVGSTLVTFSNIDHDWTRENTYVEYSIISGNSQNNFHVETKFFHSEYPYKQVGYLVLLHSLDREASASHELVILASDSGCPPLSSTAVISIQVLDVNDNPPNFSSLSYHT---HVKESTPLGSHITVVSANDRDTGSHAEIIYNIISGNEKGHF----YLEENTGVLYLIKPLDYEKMTKFTLTVQASDAEKKHFSFAVVFVS-VLDDNDHAPQFMFSSF-SC--------IVPENLPISSTICSINALDFDAGPYGELTYSIVSPCFLTHGMSYDHDLFLIDPLTGDIHAKQILDYENGNKYCLTVQAKDK----GDATASLVVWVDIEGIDEFEPIFTQDQYFFTLPEKN--KDRQLIGRVEASDADAGIDGVILYSLGTS-SPFFSVNKTNGNIYL 2937          

HSP 2 Score: 163.696 bits (413), Expect = 4.813e-39
Identity = 326/1452 (22.45%), Postives = 599/1452 (41.25%), Query Frame = 2
Query: 4328 FDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSP--SSSIVRISAPTTENASIFQIVATDAD----------------SGP------NSKL--TYQINPSSDGIFMINGDSGEIHLVSS---PRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAG----KFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLP-EDEAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCS-PLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLA---FNATHFSLKVLENSPGGTVLGRINIVKPPVNSE-IFYVLNPGH--SHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFRVK--ENSVDGTFIGQIKMVNYCKDHSA---KFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRP--KISIPNRNL--KLDTNRPVGSFITKITAKDSDGPDG--ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDAR---FSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRD--NGKVTFELVSTSPWFGLRGFDNNTAALFLIDE-PQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDS---DKAIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTC---AIVGSPEKITSFNLSVQI-EKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDL-FESRIWN-LTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHD------IQYFLTPHENFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNV-EGGIPKLGQILFTAYASDKDRGRFGIVSYQIVE-NPSENFGINNETGAI 8455
             DRE+ +  +  +  +AT   +P + T   L++++AD ND  P        +S+   +AP T    +  + A+DAD                S P       SK+  T +  PS    F I+ +SG I  + +       A EL V  +D GE P S + + SI    +     I +     +       +  G    Q++ S   S     I Y L  G    +  Q F +DP  G +     + RE     +     +++++     +     + ++++  N+N P F+ S +   +  E +  T  + V+A D D GI+G + Y L          ID +TG +  + PL+ +E    +L + A D  GL+        + IF     Q TLA   F    ++  V E+ P  + +G +   +P  +SE IFY ++ G       I+   G +RT  PL  E    + LT+   A+  S  +  +T    ++ ++D+NDN P       +I I  +  P   L    A D D   N   ++  + P       ++ +D   G LFL  S+ +  +    L +   D GV  +   +++ + + +         E  +++V+  E+    T + Q +        +A   ++S+   V+  +  +   TG I++      +  +     ++  +   G        VI+ V D +DN P F  +     + E   P+  + ++T  D D G N Q+ YF+   S  + F ++ N G++   + L+   +  +++ +  + + SP   A   + V + +IND RP     +P + L  K+   +PV   +T + AKD D  +   ++Y +     ++      +  ++GEI  +  L       +   ++  D         AV+ I V   +    I+ +N R + +  +LK  +KI+ L      L+   NGK+ F +V+     G    D++T  LFL  E   E    Y   +  TD++      L S   L++ ++    + P    +    I++ E++  G+ +  F  KD D    +  I Y I++ +P +N   +    G L     L+    P  +L VT    A+  +  ++ S    + I +  +  P  I       +  V E +   +++ ++   D +  R      S+     EN+    +F +D S+ L      L +E +  + LT++ +       S S       L VN E P           +       + EN+ P   V ++     D      +Q+ + P  +FEL   +  S    + + ++LD E  E + L++L++   F   S + TI+   +V D +++ PEF+  S+   V E   P   ++++T  ASD D G    V Y I++ N  E F IN  +G +
Sbjct:  497 LDRESRDLYELLL--VATDAGSPPLSTEETLLLRVADLNDQPPLFSQQHYKASVSEAAAPGT---VVMWVSASDADEAGSDHAWLRYTVVQLSAPCNLGSLQSKMVHTAECGPS----FAIDSESGAISTIRTLDREVQEAVELKVVAQDLGEPPLSATCLVSITVDDVNDNEPIFWRQVYNATIAE--HAPVGHCFLQVTASDADSGLYGFIEYSLYDGFLSYEAPQAFRIDPHDGQICVSQDIDRER----DPATYDLLVEAKDGGGLSAQAFVRVDLEDVNDNHPVFNPSTYVTSISDETQPGTEIINVLATDQDSGIYGTVAYELIPGNVSSLFTIDSTTGIIYLTLPLSHLESTTLSLMVSAQDGGGLTAVINADVTIHIF-----QTTLAPAEFERPKYTFLVYEDVPEDSPIGTVKAREPLNSSEPIFYRISSGDLGGKFSIHPRLGTIRTRKPLDHETQPVVVLTVQ--AQLGSAPACSSTEV--NITVMDVNDNHPAFLRTSDEIRISQTTPPGTALYLARAEDRDSGRNGLIRYSIASPQP----GVFAIDRALGVLFLNGSLGAGEQRELTLTLRAEDQGVHPQAALLVLTVVIEKREHSPSWTFEHLVYQVEVSESLSPMTQMLQTQAHPLGPQRAASPLRYSLEPSVDSAMFGIRPYTGWIYLRRQFDYESTQTYNFRVFAWIPEDGFLQNVSTTVIVRVWDENDNSPTFLHDVLFLKVEESPVPQGVIGKITAIDMDSGKNGQLLYFL--LSDGKFFKMNPNTGELINWVALDREHRGHHEMTVLVTDRGSPPRNATMAVYVSVTDINDNRPFFPQCLPGKELHVKVLEGQPVNMLVTTVFAKDPDEGNNAEVTYSVSSEDSSDH---FKIDANNGEIRTTTILSYDYRPSYRMSVIATDQGVPPLQGQAVVNIQVIPLSKGRAIMSQNIRHLIIPENLKP-TKIMSLIKSSDHLQQHYNGKLHFSIVADDK-DGHFEIDSSTGDLFLSKELDYETTSHYLFRVITTDHS--KNLSLSSTVFLSIDVEDQNDHSPSF-QDELIVISVEENVPIGTLVYVFNAKDDDGSFLNSRIQYYIESHNPGTNPFLIHPSFGTLVTVSRLDRESIPTVILTVTASDQAVNVTDRRLRSLTAQIVILDVNDHNPTFISFP----NAHVKEDVTVGSLVHHITAHDPDEGRNGKVTYSILSGN-ENM----TFMLDESSGLLTTTCPLDYEMKTQHILTVLALDDGTPALSSSQTLTVTVLDVNDEAP---------VFKQHLYEASVKENQNPGEFVTRVEALDRDSGVNSKLQFEIMPGASFELF--EINSDTGEVVTTTILDREIQEVFTLRVLVRDGGFPSLSSTTTILC--TVEDENDHAPEFIVSSYDIEVLENQEP---EVVYTVLASDMDAGNNRAVEYHIIDGNTDECFTINEMSGEL 1885          

HSP 3 Score: 133.65 bits (335), Expect = 6.525e-30
Identity = 302/1391 (21.71%), Postives = 548/1391 (39.40%), Query Frame = 2
Query: 3089 IINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNV-FYIHQTAVYGT-----------EVGT---LLXXXXXXXXXXXXXXSL--KQPHYYQC---FYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIE---LAIDNEDQINIDSWTGLITTKVSLSCAQN---VKIRIFVSDLGFPKMTSSVDTLLK------PLYEPKSEEFLINKNLTFI--IPDHSQPGYVVGDLNIFPEN-----YGA----------KCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLKNLE--VVYSIKQPE--KYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEIHLVSSPRVSA-YELNVTVR--DSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQR-IFINIDYGNENPPRFSRSIFKVKLPEDEAITNFL-TVVANDPDLGIFGRIIYSLEGDTFDKKIF-IDPSTGKL-SCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFN----ATHFSLKVLENSPGGTVLGRINIVKPPV--NSEIFYVLNPGHS--HIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDS-DKTSNITYQF----DRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVP-SKCTTVLIDISL-NQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKF----------SIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEI--RGYKKVIIHXXXXXXNKPVFSQNKFVAFLN----EGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLID-ANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFL-NVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARF---SSTAVIEIDVEDKNNHVP 6973
            +  LL++ +D G   PL TE  + +R+ D N+  P+    +    + + A  GT           E G+    L              SL  K  H  +C   F I+  S     IR    E      E + + ++A D G P  S+   + I   + N N P       +  +    P+  G     V A D D GL     YS+    L+ +      ID   G I     +   ++     + +   D G     + V   L+      P++ P           T++  I D +QPG  +  +N+   +     YG             LF  ++TT   G ++L      L         ++   SL V        +   N  + + + +   +   F +    FL + E++P  S + +   R   N    + Y I   +    F I+P  G + T +  D ET+  +   V+     + +    +   + + + D NDN P  L  S  I RIS  T    +++   A D DSG N  + Y I     G+F I+   G + L  S       EL +T+R  D G  P++  +V ++  +  +      F      + +S   S    ++   ++          +RY L     + +F + P TG +  +     E   +++     V      D  + ++   + + +   N+N P F   +  +K+ E       +  + A D D G  G+++Y L     D K F ++P+TG+L +   L+   +  + + ++ TD    S  R     V + V +   +   F          +KVLE  P   ++  +    P    N+E+ Y ++   S  H +I+   GE+RT   L  +      +++ A  + +     Q   A++++++I ++  + I ++N   + IP + +P K ++ + ++D   +  N    F    D  D         + +D  +G+LFL   +       +  +VI +D+    S  +TV + I + +Q+        E  +  V+EN   GT +     V   KD    F          S   G N  L+  H S G +     +++DRE I  +IL    S     +  R  + +   +  +D N        F++F N    E     + V  +T +DPD G N +V Y I   +    F++D ++G + T  PL++  K+ + L + A    +P + +   LTV ++++ND+ P          +  N+  G F+T++ A D D   G++ +++   +   +  L  +  D+GE+  +  L           ++V D  F   SST  I   VED+N+H P
Sbjct:  504 LYELLLVATDAGS-PPLSTEETLLLRVADLNDQPPLFSQQHYKASVSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQLSAPCNLGSLQSKMVHTAECGPSFAIDSESGAISTIRTLDREVQ----EAVELKVVAQDLGEPPLSATCLVSITVDDVNDNEPIFWRQVYNATIAEHAPV--GHCFLQVTASDADSGLYGFIEYSLYDGFLSYEAPQAFRIDPHDGQICVSQDIDRERDPATYDLLVEAKDGGGLSAQAFVRVDLEDVNDNHPVFNPS----------TYVTSISDETQPGTEI--INVLATDQDSGIYGTVAYELIPGNVSSLFTIDSTT---GIIYLTLPLSHL---------ESTTLSLMVSAQDGGGLTAVINADVTIHIFQTTLAPAEFERPKYTFL-VYEDVPEDSPIGTVKAREPLNSSEPIFYRISSGDLGGKFSIHPRLGTIRTRKPLDHETQPVVVLTVQA---QLGSAPACSSTEVNITVMDVNDNHPAFLRTSDEI-RISQTTPPGTALYLARAEDRDSGRNGLIRYSIASPQPGVFAIDRALGVLFLNGSLGAGEQRELTLTLRAEDQGVHPQAALLVLTVVIEKREHSPSWTFEHLVYQVEVSESLSPMTQMLQTQAHPLGPQRAASPLRYSLEPSVDSAMFGIRPYTGWIYLRRQFDYE---STQTYNFRVFAWIPEDGFLQNVSTTVIVRVWDENDNSPTFLHDVLFLKVEESPVPQGVIGKITAIDMDSGKNGQLLYFL---LSDGKFFKMNPNTGELINWVALDREHRGHHEMTVLVTDRG--SPPRNATMAVYVSVTDINDNRPFFPQCLPGKELHVKVLEGQPVNMLVTTVFAKDPDEGNNAEVTYSVSSEDSSDHFKIDANNGEIRTTTILSYDYRPSYRMSVIATDQGVPPLQGQ---AVVNIQVIPLSKGRAIMSQNIRHLIIPENLKPTKIMSLIKSSDHLQQHYNGKLHFSIVADDKD-------GHFEIDSSTGDLFLSKELDYETTSHYLFRVITTDHSKNLSLSSTVFLSIDVEDQNDHSPSFQDELIVISVEENVPIGTLV----YVFNAKDDDGSFLNSRIQYYIESHNPGTNPFLI--HPSFGTL--VTVSRLDRESIPTVILTVTASDQAVNVTDRRLRSLTAQIVILDVND---HNPTFISFPNAHVKEDVTVGSLVHHITAHDPDEGRNGKVTYSILSGNENMTFMLDESSGLLTTTCPLDYEMKTQHILTVLALDDGTPALSSSQTLTVTVLDVNDEAPVFKQHLYEASVKENQNPGEFVTRVEALDRDS--GVNSKLQFEIMPGASFELFEINSDTGEVVTTTILDREIQEVFTLRVLVRDGGFPSLSSTTTILCTVEDENDHAP 1827          

HSP 4 Score: 114.775 bits (286), Expect = 3.673e-24
Identity = 167/783 (21.33%), Postives = 299/783 (38.19%), Query Frame = 2
Query:  116 LIFSIKENVPIGEVVGQI----------ESPGF-SPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGD------SEKVFAIDYHDSSNGIFYVRLILKQSLD-----------YEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFL-----------DNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNS--PPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYD--------------------AISTSF-----DLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEIDSTILNENQHVTFVKTTKRLPTKPIFIFKIFVLNNLFKINETTGEILSK--RSIDCGKYFF------NVSMLSLKTNSLIDQTKLEIVVKSGRKLPL-------------------YFDRGFRKILVTTGK-SQCFSEIAVRNRHCGMR--IQYS-YDLLLKTDG--ILRINEH-GALCTAENVKHNKLMSTRYLYQIKALDETNSSAVCVVLFAIQPSKVFDVLPTEINITLPIIDSPKFNFSL-----PIGKIIGTFSKLPPAQFIGFIQYHLVPEELSTGAITVDSQSGEILM 2149
            L  S+ E +P   +VG I          E  GF              F +   TG+I+ +  +DRE+++ YSF+  ++ G    V+I++ DVND+ P+F   + +  + E  P G+   L    DPD G  S Q   +V         +   F + Y         +       L+            E  +   L I+A DGG P     L V++ V + NDN P F+   Y A+++ED +      RVRATD D G +G + Y +                 + +F V+  +G V + + LD E    H + +  RD    P   T +V + +  ++ N     +  L  GG++ ++    P   VA V ++D D                    +IS S      D  +L   P       P ++ L +   +     +   L L A D   P LST + L +++ +       FS   ++  + S        V +V  +          +  + +  L       G + SK   + +CG  F        +S +      + +  +L++V +   + PL                   ++ + +   +        CF ++   +   G+   I+YS YD  L  +     RI+ H G +C ++++   +  +T Y   ++A D    SA   V   ++          ++N   P+ +   +  S+     P  +II   +    +   G + Y L+P  +S+   T+DS +G I +
Sbjct:   69 LTLSVDEGLPPDTLVGDIRAGLPAAQQQEGSGFFLSEDSDDSPLLDDFHVHPDTGIIRTARRLDRERRDHYSFVAATLLGAVVQVEIRVNDVNDHSPRFPLDSLQLDVSELSPPGTAFRLPVAHDPDAGLFSTQGYTLVQPSDLPKDPAGPFFQLRYRTPGPLPSPLLPGSSSPLEPLDLVLLRRLDREEAAAHRLQIEAWDGGRPRRTGLLSVELRVLDENDNPPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGALGDAAYFAVEELSGVVRVWRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDNRPAIHVLFLTEGGVARVSEGARPGDYVARVSVSDADGDWEKEDEATGELGVGLGDGSISLSLEGGEGDFALLPGGP-------PGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLNDQPPLFSQQHYKASV-SEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQL-SAPCNLGSLQSKMVHTAECGPSFAIDSESGAISTIRTLDREVQEAVELKVVAQDLGEPPLSATCLVSITVDDVNDNEPIFWRQVYNATIAEHAPVGHCFLQVTASDADSGLYGFIEYSLYDGFLSYEAPQAFRIDPHDGQICVSQDIDRERDPAT-YDLLVEAKDGGGLSAQAFVRVDLE----------DVNDNHPVFNPSTYVTSISDETQPGTEIINVLATDQDSGIYGTVAYELIPGNVSS-LFTIDSTTGIIYL 830          

HSP 5 Score: 111.309 bits (277), Expect = 4.109e-23
Identity = 87/301 (28.90%), Postives = 140/301 (46.51%), Query Frame = 2
Query:  125 SIKENVPIGEVVGQIES----------------PGFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNG------DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNS 961
            S+KEN   GE V ++E+                PG S  FE+       F I+  TG +  + ++DRE Q +++  ++  +G       T  +   + D ND+ P+F  ++++  + EN      V      D D G N      I+ G++++ F I+            L   ++LD E IS F LVI   D G PP  + + +++ V +AND+ P F    Y +S++ED E+    L + A D D G++G+  YFL  T  +S  FT+D  +G +    +LD E    H  S   RD S
Sbjct: 1732 SVKENQNPGEFVTRVEALDRDSGVNSKLQFEIMPGAS--FEL-------FEINSDTGEVVTTTILDREIQEVFTLRVLVRDGGFPSLSSTTTILCTVEDENDHAPEFIVSSYDIEVLENQE-PEVVYTVLASDMDAGNNRAVEYHIIDGNTDECFTINEMSG-------ELSTTRALDREQISNFTLVILCSDLGDPPRSSVIHLQVRVLDANDHSPSFPTLYYQSSVREDAEVGTVVLVLSAVDKDEGLNGQTEYFL--TDEASGAFTIDPMSGTLKTSNTLDREARSQHTFSAVARDCS 2013          

HSP 6 Score: 109.768 bits (273), Expect = 1.060e-22
Identity = 94/305 (30.82%), Postives = 142/305 (46.56%), Query Frame = 2
Query:  113 LLIFSIKENVPIGEVV---------GQIESPGFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKNV----------QIKILDVNDNEPKFNATNFEKS-IPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            L++ S++ENVPIG +V         G   +       E H+     F+I  + G +     +DRE       L ++ +    NV          QI ILDVND+ P F   +F  + + E+  +GS V   T  DPDEG+N   +  I+SG+    F +D    S+G+    L     LDYE+ +Q  L + A+D G P L +S  + + V + ND  P F    Y AS+KE+Q       RV A D D+GV+ +L + +     S + F ++  TG V     LD E  +   + + VRD   P
Sbjct: 1514 LIVISVEENVPIGTLVYVFNAKDDDGSFLNSRIQYYIESHNPGTNPFLIHPSFGTLVTVSRLDRESIPTV-ILTVTASDQAVNVTDRRLRSLTAQIVILDVNDHNPTF--ISFPNAHVKEDVTVGSLVHHITAHDPDEGRNGKVTYSILSGNENMTFMLD---ESSGL----LTTTCPLDYEMKTQHILTVLALDDGTPALSSSQTLTVTVLDVNDEAPVFKQHLYEASVKENQNPGEFVTRVEALDRDSGVNSKLQFEI-MPGASFELFEINSDTGEVVTTTILDREIQEVFTLRVLVRDGGFP 1807          

HSP 7 Score: 101.293 bits (251), Expect = 3.627e-20
Identity = 75/264 (28.41%), Postives = 133/264 (50.38%), Query Frame = 2
Query:  215 EKKFIIS----KTTGVIKVSGLIDREKQNLYSFLIISMNG------DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFY------FLDN-TSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD 955
            E KF  S    K  G + +   +DRE    +  +I++ +        T  + I++LDVNDN P F++ ++   + E+ P+GS + + +  D D G ++     I+SG+ +  F   Y + + G+ Y    L + LDYE +++F L +QA D        ++ V + V + ND+ P+F  S +   + E+  I+ T   + A D DAG  GEL Y      FL +  S   D F +D  TG+++ ++ LD+E    + +++  +D
Sbjct: 2601 ETKFFHSEYPYKQVGYLVLLHSLDREASASHELVILASDSGCPPLSSTAVISIQVLDVNDNPPNFSSLSYHTHVKESTPLGSHITVVSANDRDTGSHAEIIYNIISGNEKGHF---YLEENTGVLY----LIKPLDYEKMTKFTLTVQASDAEKKHFSFAV-VFVSVLDDNDHAPQFMFSSFSCIVPENLPISSTICSINALDFDAGPYGELTYSIVSPCFLTHGMSYDHDLFLIDPLTGDIHAKQILDYENGNKYCLTVQAKD 2856          

HSP 8 Score: 99.7525 bits (247), Expect = 1.134e-19
Identity = 195/918 (21.24%), Postives = 362/918 (39.43%), Query Frame = 2
Query: 5945 HFLKVIVSDNGVPSKCTTV-----LIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNY-----------------CKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKI-ILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPD-------------------IGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYRIRHRKLTNQT-LFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVV---DDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEPQ-------EKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKD-LDSDKAIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPE-KITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQM-DKNSFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDL--FESRIWNLT---------------IMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHDIQYFLTPHENFELTCSQSQSSGCNIKSKSVLDFETHE--NYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQS-FTQNVEGGIPK--LGQILFTAYASDKDRGRFGIVSYQIVENPSENFGINNETGAI 8455
            H L V   D G   +  TV     ++D++ N+   +V  + E  + RV E +  G ++ ++ + +                    D S   S+  G     +      G  F+     +DRE  D   +L      G   +   + +++ V D++D  P+FSQ  + A ++E   P T V+ ++  D D                       S     +        F ID+ +G + T   L+   +   +L + A     P + A C +++ + ++ND  P       N  +  + PVG    ++TA D+D G  G I Y +    L+ +      +    G+I +S+ +   +     +D++V   D    S+ A + +D+ED N++ P+   +  V ++S   + G++I+ + A D+D    G V +EL+             N ++LF ID             H     + L  +A D       I A   +  +  +  P           + E +   S I     ++ L+S + IFY+I +   +     +    G +   K L++  QP  +L V   +  +P    T  N++V    +N    L  +  I +S   P     P     L +  D++S R      S+A  QP        F ID +  + ++NG L   E R   LT               ++ V  +K ++SPS  +E  +L   +EV E +            +T ++     P    L        ++Y L P  +  +   +  +    ++ +   D+E+ +  N+R+   I    F L++ S T++V   V D ++  P F+H   F +  E  +P+  +G+I     A D D G+ G + Y ++ +  + F +N  TG +
Sbjct:  379 HQLVVEARDGGAEPEVATVRVSIAVLDVNDNRPAIHVLFLTEGGVARVSEGARPGDYVARVSVSDADGDWEKEDEATGELGVGLGDGSISLSLEGGEGDFALLPGGPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLNDQPPLFSQQHYKASVSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQLSAPCNLGSLQSKMVHTAECGPSFAIDSESGAISTIRTLDREVQEAVELKVVAQDLGEPPLSATCLVSITVDDVNDNEPIFWRQVYNATIAEHAPVGHCFLQVTASDADSGLYGFIEYSLYDGFLSYEAPQAFRIDPHDGQICVSQDI-DRERDPATYDLLVEAKDGGGLSAQAFVRVDLEDVNDNHPVFNPSTYVTSISDETQPGTEIINVLATDQDSGIYGTVAYELIP-----------GNVSSLFTIDSTTGIIYLTLPLSHLESTTLSLMVSAQDGGGLTAVINADVTIHIFQTTLAPAEFERPKYTFLVYEDVPEDSPIGTVKAREPLNSSEPIFYRISSGD-LGGKFSIHPRLGTIRTRKPLDHETQPVVVLTVQAQLGSAPACSSTEVNITVMDVNDNHPAFLRTSDEIRISQTTP-----PGTALYLARAEDRDSGRNGLIRYSIASPQPG------VFAIDRALGVLFLNGSLGAGEQRELTLTLRAEDQGVHPQAALLVLTVVIEKREHSPSWTFE--HLVYQVEVSESL----------SPMTQMLQTQAHP----LGPQRAASPLRYSLEPSVDSAMFGIRPYTGWIYLRRQ--FDYESTQTYNFRVFAWIPEDGF-LQNVSTTVIVR--VWDENDNSPTFLHDVLFLKVEESPVPQGVIGKIT----AIDMDSGKNGQLLYFLLSD-GKFFKMNPNTGEL 1246          

HSP 9 Score: 98.2117 bits (243), Expect = 3.669e-19
Identity = 74/256 (28.91%), Postives = 121/256 (47.27%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLIISMN------GDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSG----DSEKVFAIDYHDSSNGIFYVRLILKQSLDYEI-ISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDN 958
            F I   +G I     +DRE Q      +++ +        T  V I + DVNDNEP F    +  +I E+ P+G      T  D D G        +  G    ++ + F ID HD        ++ + Q +D E   + ++L+++A DGG   L A   V++ +++ NDN P F+ S Y+ SI ++ +     + V ATD D+G+ G + Y L   + SS  FT+D  TG +YL   L   +S +  + +  +D 
Sbjct:  606 FAIDSESGAISTIRTLDREVQEAVELKVVAQDLGEPPLSATCLVSITVDDVNDNEPIFWRQVYNATIAEHAPVGHCFLQVTASDADSGLYGFIEYSLYDGFLSYEAPQAFRIDPHDG-------QICVSQDIDRERDPATYDLLVEAKDGGG--LSAQAFVRVDLEDVNDNHPVFNPSTYVTSISDETQPGTEIINVLATDQDSGIYGTVAYELIPGNVSS-LFTIDSTTGIIYLTLPLSHLESTTLSLMVSAQDG 851          

HSP 10 Score: 95.9005 bits (237), Expect = 1.565e-18
Identity = 71/239 (29.71%), Postives = 118/239 (49.37%), Query Frame = 2
Query:  251 IKVSGLIDREKQNLYSFLIISMNGDTK---NVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDN 958
            +K    +D E +N    ++++ +   +    V + I D NDN P F  + ++ S+ E+    + V      D D G N +    I+SG+ E+ F ID   + +G+   + IL    DYE+ S ++L++QA D G P L  + ++K+ V + NDN P F  S  +  I ED    +    V   D D   S  +F F   ++P +  F +D  TG V L K+LDFE+   + + I + D+
Sbjct: 2197 VKEPKFLDFEVRNEVQLIVLAESSGHRAYCKVAVLIQDENDNSPCFEQSIYQASVSESQLYNAHVIQVFATDLDSGLNGLIEYSILSGNQEEAFQID---ALSGVITTKAIL----DYELTSSYSLIVQATDKGMPRLSNTTVIKVQVTDINDNAPAFLPSEAV-EITEDSLPGVIVTHVSVHDVDLN-SAFIFSFAKESNPGTK-FAIDQNTGVVVLVKTLDFEEMTEYELLIQISDS 2425          

HSP 11 Score: 93.2041 bits (230), Expect = 1.049e-17
Identity = 71/248 (28.63%), Postives = 122/248 (49.19%), Query Frame = 2
Query:  212 QEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKN-----VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLI-----LKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSK 925
            ++  F + + TGV+ +   +D EK   ++  + + + + K+     V + +LD ND+ P+F  ++F   +PEN PI S +      D D G     +  IVS      F        + +F +  +      KQ LDYE  +++ L +QA D G     ASL+V + ++  ++  P F   +Y  ++ E  +      RV A+D DAG+ G + Y L  +SP   FF+V+   GN+YL ++L   KS+
Sbjct: 2709 EKGHFYLEENTGVLYLIKPLDYEKMTKFTLTVQASDAEKKHFSFAVVFVSVLDDNDHAPQFMFSSFSCIVPENLPISSTICSINALDFDAGPYGELTYSIVS----PCFLTHGMSYDHDLFLIDPLTGDIHAKQILDYENGNKYCLTVQAKDKGD--ATASLVVWVDIEGIDEFEPIFTQDQYFFTLPEKNKDRQLIGRVEASDADAGIDGVILYSLGTSSP---FFSVNKTNGNIYLIRALPLIKSQ 2947          

HSP 12 Score: 91.2781 bits (225), Expect = 3.881e-17
Identity = 318/1606 (19.80%), Postives = 639/1606 (39.79%), Query Frame = 2
Query:  206 DFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKNVQ--------IKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVR-----LILKQSLDYEIISQFNLVIQAIDGGHPPLQA---------SLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISI-GVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDA-ISTSFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEIDSTILNENQHVTFVKTTKRLPTKPIFIFKIFVLNN----LFKINETTGEILSKRSIDCGKYFFNVSMLSLKTNSLIDQTKLEIVVKSGRKL----------PLYFDRGFRKILVTTGKSQCFSEIAVRNRHCGMRIQYSYDLLLKTDGILRINE-HGALCTAENVKHNKLMSTRYLYQIKALDETNSSAVCVVLFAIQPSKVFDVLPTEINITLPIIDSPKFNFSL---------------------PIGKIIGTFSKLPPAQFIGFIQYHLVPEELSTGAITVDSQSGEILMKKFPIHKN-PIRLIVKSVIRKPFNVSPLNIVAINFQ----KLFFARSLYQFILTKSEIKGNLVKIGQVSMDSSCTESVSYDLFGVKNDHSHFTIDVATGVIYGKDLGSISNKTLMFQVSAKA-------PKSQTSFAQVIIYIED-GIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSD---------EYQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKN----LIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIR-VKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPD-KGLNSIFNYSIELAIDNEDQINIDS----------WTGLITTKVSL--SCAQNVKIRIFVSDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVD-GFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFN--KKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLKN---LEVVYSIKQP----------EKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEIHLVSSPRVSAYELN 4675
            D ++  F I  +TG + +S  +D E  + Y F +I+ +  +KN+         I + D ND+ P F       S+ EN PIG+   L  VF+  +   S  + RI        + I+ H+     F +      L+    LD E I    L + A D      QA         SL  +I++ + ND+ P F IS   A +KED  +      + A D D G +G++ Y + + + +  F  +D  +G +     LD+E    H +++  + D +P   +S+   +  +   ++ P   Q L+   + E   + +P   V  V+  D D+ +++    EI+  + F+L +I     E+     +         L +   D   PSLS+T  +   + +       F  S + +E+   + N+   V +      +        +  +++      F INE +GE+ + R++D  +   N +++ L ++ L D  +  ++    R L           LY+    R+           S +   ++  G+  Q  Y L  +  G   I+   G L T+  +  ++   +++ +   A D       C +  +   + +  V  T++N   P+++   F+  L                     P G ++ +F++                   +    ++D  +GEI  ++ P  +  PI L +K   +     +   ++ I+ +    K+ F+  LY+ ++T++   G  +   +     S  +S+ Y +F   N+    ++   +G +  K+      K L F+V  +             ++ +V + I+D   + P F+ S    ++ E+      ++QVF      +D         EY I+     +   I + +G I      D E  S   + VQ  +     + + T+         ++   +  +     T + L   G +   +   D D     N ++     K       F I+  TG ++++ +L+           LL+ +SD+  +    TE  + VR++D N++ P+   +  FY   T      VG  ++            IS +     + F I+  +   F I  V  L+TI++       ++ A+D G+P   ++  + I   + N   PE  +  +   +      L GS + T + +D D    N+   YSI ++ ++++  ++++            G +    SL    + + ++ I  SD G P ++S+    ++ L    +     + +    + + +  G  +  ++    + G+    I N  +  + G  +L  ++  L L+K     K   ++L V  +  +K  FS +  ++++V+ +       +FS  S     + ENLP  S + S N          E+ YSI  P             F+I+P+TG +   ++ D E  N  ++ + V A    +     V+ + ++  DE   EP I +       +     +   I ++ A+DAD+G +  + Y +  SS   F +N  +G I+L+ +  +   +LN
Sbjct: 1446 DDKDGHFEIDSSTGDLFLSKELDYETTSHYLFRVITTD-HSKNLSLSSTVFLSIDVEDQNDHSPSFQDELIVISVEENVPIGT---LVYVFNAKDDDGSFLNSRI-------QYYIESHNPGTNPFLIHPSFGTLVTVSRLDRESIPTVILTVTASD------QAVNVTDRRLRSLTAQIVILDVNDHNPTF-ISFPNAHVKEDVTVGSLVHHITAHDPDEGRNGKVTYSILSGNENMTFM-LDESSGLLTTTCPLDYEMKTQHILTVLALDDGTPALSSSQTLTVTVLDVNDEAPVFKQHLYEASVKE---NQNPGEFVTRVEALDRDSGVNSKLQFEIMPGASFELFEINSDTGEVVTTTILDREIQEVFTLRVLVRDGGFPSLSSTTTILCTVEDENDHAPEFIVSSYDIEV---LENQEPEVVYTVLASDMDAGNNRAVEYHIIDGNTDECFTINEMSGELSTTRALD-REQISNFTLVILCSD-LGDPPRSSVIHLQVRVLDANDHSPSFPTLYYQSSVREDAEVGTVVLVLSAV---DKDEGLNGQTEYFLTDEASGAFTIDPMSGTLKTSNTL--DREARSQHTFSAVARD-------CSIQGSRSTTVIIKVYVTDVNDNDPVLEQNPFDVFLSPESPTNQTTVIVRADDLDLGPNGTVVFSFAE-------------------TQSMFSIDKYTGEIQFQQNPSSEYFPIWLQLKVTDQGIPARTTTGLLVIHMEGEDVKISFSHHLYKGLVTENCEAGTSIVTVKAFAPDSIQDSMKYSIFS-GNEDGVLSLCSKSGQLTVKE-----PKFLDFEVRNEVQLIVLAESSGHRAYCKVAVLIQDENDNSPCFEQSIYQASVSESQLYNAHVIQVF-----ATDLDSGLNGLIEYSILSGNQEEAFQIDALSGVITTKAILDYELTSSYSLIVQATDKGMPRLSNTTVIKVQVTDINDNAPAFLPSEAVEITEDSLP--GVIVTHVSVHDVDL----NSAFIFSFAKESNPGTKFAIDQNTGVVVLVKTLDFEEMTE---YELLIQISDSVHY----TEGALVVRVLDVNDNPPVF--SQDFY-QVTVPESIPVGYSVLTLSATDLESNENISYRILSSSKEFSIDPKNGTIFTISPVLLLDTIST----TQFLVEASDGGNPDLRALTLVEIGIEDMNNYAPEFTV--KSYNLSLSEDALVGSTLVTFSNIDHDWTRENTYVEYSI-ISGNSQNNFHVETKFFHSEYPYKQVGYLVLLHSLDREASASHELVILASDSGCPPLSSTAVISIQVLDVNDNPPNFSSLSYHTHVKESTPLGSHITVVSANDRDTGSHAEIIYNIISGNEKGHFYLEENTGVLYLIKPLDYEKMTKFTLTVQASDAEKKHFSFAV-VFVSVLDDNDHAPQFMFSSFS---CIVPENLPISSTICSINALDFDAGPYGELTYSIVSPCFLTHGMSYDHDLFLIDPLTGDIHAKQILDYENGN--KYCLTVQAKDKGDATASLVVWVDIEGIDE--FEP-IFTQDQYFFTLPEKNKDRQLIGRVEASDADAGIDGVILYSLGTSSP-FFSVNKTNGNIYLIRALPLIKSQLN 2949          

HSP 13 Score: 70.8626 bits (172), Expect = 6.466e-11
Identity = 67/250 (26.80%), Postives = 112/250 (44.80%), Query Frame = 2
Query:  221 KFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGD-----TKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGG-HPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAG---VSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISI 943
            KF I    G I+    +D E Q +    + +  G      +  V I ++DVNDN P F  T+ E  I +  P G+ + L    D D G+N +    I S     VFAI   D + G+    L L  SL      +  L ++A D G HP  QA+LLV  +V    ++ P +     +  ++  + ++     ++   +  G    +  L Y L+  S  S  F +   TG +YLR+  D+E +++++  +
Sbjct:  922 KFSIHPRLGTIRTRKPLDHETQPVVVLTVQAQLGSAPACSSTEVNITVMDVNDNHPAFLRTSDEIRISQTTPPGTALYLARAEDRDSGRNGLIRYSIAS-PQPGVFAI---DRALGV----LFLNGSLGAGEQRELTLTLRAEDQGVHP--QAALLVLTVVIEKREHSPSWTFEHLVYQVEVSESLSPMTQMLQTQAHPLGPQRAASPLRYSLE-PSVDSAMFGIRPYTGWIYLRRQFDYESTQTYNFRV 1160          

HSP 14 Score: 67.781 bits (164), Expect = 5.041e-10
Identity = 103/389 (26.48%), Postives = 174/389 (44.73%), Query Frame = 2
Query: 2666 YQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVSY----LVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDAD-SFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSD---NGPFKPLETEVEISVRIIDANNHSPILISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFT-VNAVDPDKGLNSIFNYSIELAIDNED-QINIDSWTGLITTKVSLSCAQNVKIRIFVSDLGFPKMTSSVDTL 3802
            + I+         I S TG +FL+K+ D E  S+    ++ T   KNL  S+T+ L +++ D ND+ P  ++     + E+   +G +       D D SF N  + Y ++   P    NPF I+P+ G L+ +S L+   S P+ I  L V  SD   N   + L + +   + I+D N+H+P  IS    ++ +    G+ V  +   D D G NG++  S+   +    F +++ S           E    +     + ++A D G+P+ SS   L +  ++ N   P     KQH          +  E  T V A+D D G+NS   + I      E  +IN D+   + TT +     +   +R+ V D GFP ++S+   L
Sbjct: 1441 FSIVADDKDGHFEIDSSTGDLFLSKELDYETTSHYLFRVITTDHSKNLSLSSTVFLSIDVEDQNDHSPSFQDELIVISVEENVPIGTLVYVFNAKDDDGSFLNSRIQYYIESHNP--GTNPFLIHPSFGTLVTVSRLD-RESIPTVI--LTVTASDQAVNVTDRRLRS-LTAQIVILDVNDHNPTFISFPNAHVKEDVTVGSLVHHITAHDPDEGRNGKVTYSILSGNENMTFMLDESSGLLTTTCPLDYEMKTQHI----LTVLALDDGTPALSSSQTLTVTVLDVNDEAPVF---KQHLYEASVKENQNPGEFVTRVEALDRDSGVNSKLQFEIMPGASFELFEINSDTGEVVTTTILDREIQEVFTLRVLVRDGGFPSLSSTTTIL 1816          

HSP 15 Score: 61.2326 bits (147), Expect = 5.151e-8
Identity = 68/259 (26.25%), Postives = 106/259 (40.93%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLI---ISMNGDTKNVQ----IKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDIS----RYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            F I   TG I +    D E    Y+F +   I  +G  +NV     +++ D NDN P F        + E+      +   T  D D GKN  Q +  +  D  K F ++ +          LI   +LD E      + +   D G PP  A++ V + V + NDN P F            + E Q +N+    V A D D G + E+ Y + ++  SSD F +D   G +     L ++   S+ +S+   D   P
Sbjct: 1133 FGIRPYTGWIYLRRQFDYESTQTYNFRVFAWIPEDGFLQNVSTTVIVRVWDENDNSPTFLHDVLFLKVEESPVPQGVIGKITAIDMDSGKNG-QLLYFLLSDG-KFFKMNPNTG-------ELINWVALDREHRGHHEMTVLVTDRGSPPRNATMAVYVSVTDINDNRPFFPQCLPGKELHVKVLEGQPVNMLVTTVFAKDPDEGNNAEVTYSV-SSEDSSDHFKIDANNGEIRTTTILSYDYRPSYRMSVIATDQGVP 1381          

HSP 16 Score: 60.4622 bits (145), Expect = 8.881e-8
Identity = 73/331 (22.05%), Postives = 127/331 (38.37%), Query Frame = 2
Query: 6218 AAAAKIDREKIDKIILWTQVSCGGSEIR-GYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIE-----------------FYSSQEEFLIDANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISI----PNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVG------------------------KHEFDIVVDDAR---FSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKD 7063
            AAA ++  E  D          GG   R G   V + V D +DN PVF Q+++ A + E   P   V R+   D D+G N  V Y +                   Y + EE     +G V+   PL+   ++ + LV++A    +    A  R+++ ++++ND RP I +         ++      G ++ +++  D+DG           K    T  L V    G I LS +    D                           +E  +V  DA     S+   + + V D N+  P+  +     ++S +   G+ ++++ A D D
Sbjct:  259 AAAHRLQIEAWD----------GGRPRRTGLLSVELRVLDENDNPPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGALGDAAYFAVEEL----SGVVRVWRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDNRPAIHVLFLTEGGVARVSEGARPGDYVARVSVSDADG--------DWEKEDEATGELGVGLGDGSISLSLEGGEGDFALLPGGPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLNDQPPLFSQQHYKASVSEAAAPGTVVMWVSASDAD 567          
BLAST of Dachsous vs. Ensembl Human
Match: DCHS2 (dachsous cadherin-related 2 [Source:HGNC Symbol;Acc:HGNC:23111])

HSP 1 Score: 231.491 bits (589), Expect = 1.521e-59
Identity = 399/1759 (22.68%), Postives = 769/1759 (43.72%), Query Frame = 2
Query: 3425 VMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEI----FTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLI--TTKVSLSCAQNVKIRIFVSDLGFPKMTSS--VDTLLKPLYEPKSEEFLINKNLT-FIIPDHSQPGYVVGDL---NIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVF--NKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIR----RLKNLEVVYSIKQ---PEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVI--ATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGI-FMINGDSGEIHLVSSPRVSAYE------LNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPP--VNSEIFYVL-NPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNL-FXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFR--VKENSVDGTFIGQIKMVNYCKD---HSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRG-------------FDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKA---IFYKI------DNFHPISNNLYLDF---ESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKG-PNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESRI-WNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEW------YHDIQY------FLTPHENFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVH-QSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIVENPSENFGINNETGAIYI 8461
            + ++ TDRGSP +++ + + ++  + N N P    P+          +L G  +     TV A DPD+G N+   YS+  + D+ D   ID+  G I  TT +S     + ++ +  +D G P +     V+  + PL + ++   ++++N+   IIP++ +P  ++  +   +   ++Y  K  F S      DG   +   +  L L K+       HY   V+   + KNL S+SS +++++ V       P F +D    + ++EN+P G+ V  FN +       N  + Y I+        F+I+P  G LVT    DRE+   +   V     A +V++ ++ ++   IV I D ND+ P  +S  ++ V+     T  + +  I A D D G N K+TY I   ++ + FM++  SG   L+++     YE      L V   D G    S S   ++    +  ++ + F  +    ++   Q+   F+  ++      S  N  +++ ++ G   ++F ++  TG V T   + RE     E+  + V+++     S+     I   ++  N++ P F  S + +++ E++      TV+A+D D G    + Y +     D+   I+  +G+LS +      + I N  ++   S+     R     + + V +   H+ +F   ++   V E++  GTV+  ++ V     +N +  Y L +       I+  +G L+T+  L  E     + T  A A+  S +  ++T+ II V + D+NDN P+  +NP  +F+   +   +    + A D D   N T  F  ++  TQ+   M+ +D  +G + F ++       I  +L++ V+D G+P++ TT L+ I +  + + V+I     +++  V EN   GT I  +K   +  D    S K+SI  G    ++ L   +G++ V     +D E  +++ L       G   R Y KV + + D +DN P F Q+ + A ++E Q     VI++   D D G N  +EY I   + +E F IDA +G + T   L++   S Y L+++A+ K  P +     + V + +IND  P   +P+  +++  +   G  +T ++  D D      +     K +N      +  ++G + L + L   ++ ++E  I + D+   +   + + V D N++ P+  ++   + +  S+  G  +L L A   DL  N  +++ ++S+S  F +                D  +   FL+ E  + G+P    + L +  I+        F +       +SY           +++ E    GS +  F   D D  +    + Y I      +NFH  +   + ++   + G L L  SL+        L++  +  G P   ++  +S+Q+   N   PN     Y T    V E     + I+ +   D+++  ++  + ++     +  +    +  +++ +L+ I    +E    + LT+    A+K   S + ++ +  L  N   P+ M  +   C        ++ EN P  +T+  +         Y ++ Y      FLT   +++           +I +K +LD+E    Y L +  K         + +++V + +  +DE+ P F   Q F    E    K  Q++    ASD D G  G++ Y +  + S  F +N   G IY+
Sbjct: 1262 MTVLVTDRGSPPRNATMAVYVSVTDINDNRP--FFPQCLPGKELHVKVLEGQPVNMLVTTVFAKDPDEGNNAEVTYSVS-SEDSSDHFKIDANNGEIRTTTILSYDYRPSYRMSVIATDQGVPPLQGQAVVNIQVIPLSKGRA---IMSQNIRHLIIPENLKPTKIMSLIKSSDHLQQHYNGKLHF-SIVADDKDGHFEIDSSTGDLFLSKELDYETTSHYLFRVITTDHSKNL-SLSSTVFLSIDVEDQNDHSPSF-QDELIVISVEENVPIGTLVYVFNAKDDDGSFLNSRIQYYIESHNPGTNPFLIHPSFGTLVTVSRLDRESIPTVILTVTASDQAVNVTDRRLRSLTAQIV-ILDVNDHNPTFISFPNAHVK--EDVTVGSLVHHITAHDPDEGRNGKVTYSILSGNENMTFMLDESSG---LLTTTCPLDYEMKTQHILTVLALDDGTPALSSSQTLTVTVLDVNDEAPV-FKQHLYEASVKENQNPGEFVT-RVEALDRDSGVNSKLQFEIMPGASFELFEINSDTGEVVTTTILDRE---IQEVFTLRVLVRDGGFPSLSSTTTILCTVEDENDHAPEFIVSSYDIEVLENQEPEVVYTVLASDMDAGNNRAVEYHIIDGNTDECFTINEMSGELSTT-RALDREQISNFTLVILCSDLGDPPRSSVIHLQVRVLDANDHSPSFPTLYYQSSVREDAEVGTVVLVLSAVDKDEGLNGQTEYFLTDEASGAFTIDPMSGTLKTSNTLDREARS--QHTFSAVARDCSIQGSRSTTVIIKVYVTDVNDNDPVLEQNPFDVFLSPESPTNQTTVIVRADDLDLGPNGTVVFSFAE--TQS---MFSIDKYTGEIQFQQNPSSEYFPI--WLQLKVTDQGIPARTTTGLLVIHM--EGEDVKISFSHHLYKGLVTENCEAGTSIVTVKA--FAPDSIQDSMKYSIFSGNEDGVLSLCSKSGQLTVKEPKFLDFEVRNEVQLIVLAESSGH--RAYCKVAVLIQDENDNSPCFEQSIYQASVSESQLYNAHVIQVFATDLDSGLNGLIEYSILSGNQEEAFQIDALSGVITTKAILDYELTSSYSLIVQATDKGMPRLSNTTVIKVQVTDINDNAPAF-LPSEAVEITEDSLPGVIVTHVSVHDVDLNSAFIFSF--AKESNPGTKFAIDQNTGVVVLVKTLDFEEMTEYELLIQISDSVHYTEGALVVRVLDVNDNPPVFSQDFYQVTVPESIPVGYSVLTLSA--TDLESNENISYRILSSSKEFSIDPKNGTIFTISPVLLLDTISTTQFLV-EASDGGNPDLRALTLVEIGIEDMNNYAPEFTV-------KSY----------NLSLSEDALVGSTLVTFSNIDHDWTRENTYVEYSIISGNSQNNFHVETKFFHSEYPYKQVGYLVLLHSLDREASASHELVILASDSGCPPLSSTAVISIQVLDVNDNPPNFSSLSYHT---HVKESTPLGSHITVVSANDRDTGSHAEIIYNIISGNEKGHF----YLEENTGVLYLIKPLDYEKMTKFTLTVQASDAEKKHFSFAVVFVS-VLDDNDHAPQFMFSSF-SC--------IVPENLPISSTICSINALDFDAGPYGELTYSIVSPCFLTHGMSYDHDLFLIDPLTGDIHAKQILDYENGNKYCLTVQAKDK----GDATASLVVWVDIEGIDEFEPIFTQDQYFFTLPEKN--KDRQLIGRVEASDADAGIDGVILYSLGTS-SPFFSVNKTNGNIYL 2937          

HSP 2 Score: 163.696 bits (413), Expect = 4.813e-39
Identity = 326/1452 (22.45%), Postives = 599/1452 (41.25%), Query Frame = 2
Query: 4328 FDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSP--SSSIVRISAPTTENASIFQIVATDAD----------------SGP------NSKL--TYQINPSSDGIFMINGDSGEIHLVSS---PRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAG----KFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLP-EDEAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCS-PLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLA---FNATHFSLKVLENSPGGTVLGRINIVKPPVNSE-IFYVLNPGH--SHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFRVK--ENSVDGTFIGQIKMVNYCKDHSA---KFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRP--KISIPNRNL--KLDTNRPVGSFITKITAKDSDGPDG--ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDAR---FSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRD--NGKVTFELVSTSPWFGLRGFDNNTAALFLIDE-PQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDS---DKAIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTC---AIVGSPEKITSFNLSVQI-EKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDL-FESRIWN-LTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHD------IQYFLTPHENFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNV-EGGIPKLGQILFTAYASDKDRGRFGIVSYQIVE-NPSENFGINNETGAI 8455
             DRE+ +  +  +  +AT   +P + T   L++++AD ND  P        +S+   +AP T    +  + A+DAD                S P       SK+  T +  PS    F I+ +SG I  + +       A EL V  +D GE P S + + SI    +     I +     +       +  G    Q++ S   S     I Y L  G    +  Q F +DP  G +     + RE     +     +++++     +     + ++++  N+N P F+ S +   +  E +  T  + V+A D D GI+G + Y L          ID +TG +  + PL+ +E    +L + A D  GL+        + IF     Q TLA   F    ++  V E+ P  + +G +   +P  +SE IFY ++ G       I+   G +RT  PL  E    + LT+   A+  S  +  +T    ++ ++D+NDN P       +I I  +  P   L    A D D   N   ++  + P       ++ +D   G LFL  S+ +  +    L +   D GV  +   +++ + + +         E  +++V+  E+    T + Q +        +A   ++S+   V+  +  +   TG I++      +  +     ++  +   G        VI+ V D +DN P F  +     + E   P+  + ++T  D D G N Q+ YF+   S  + F ++ N G++   + L+   +  +++ +  + + SP   A   + V + +IND RP     +P + L  K+   +PV   +T + AKD D  +   ++Y +     ++      +  ++GEI  +  L       +   ++  D         AV+ I V   +    I+ +N R + +  +LK  +KI+ L      L+   NGK+ F +V+     G    D++T  LFL  E   E    Y   +  TD++      L S   L++ ++    + P    +    I++ E++  G+ +  F  KD D    +  I Y I++ +P +N   +    G L     L+    P  +L VT    A+  +  ++ S    + I +  +  P  I       +  V E +   +++ ++   D +  R      S+     EN+    +F +D S+ L      L +E +  + LT++ +       S S       L VN E P           +       + EN+ P   V ++     D      +Q+ + P  +FEL   +  S    + + ++LD E  E + L++L++   F   S + TI+   +V D +++ PEF+  S+   V E   P   ++++T  ASD D G    V Y I++ N  E F IN  +G +
Sbjct:  497 LDRESRDLYELLL--VATDAGSPPLSTEETLLLRVADLNDQPPLFSQQHYKASVSEAAAPGT---VVMWVSASDADEAGSDHAWLRYTVVQLSAPCNLGSLQSKMVHTAECGPS----FAIDSESGAISTIRTLDREVQEAVELKVVAQDLGEPPLSATCLVSITVDDVNDNEPIFWRQVYNATIAE--HAPVGHCFLQVTASDADSGLYGFIEYSLYDGFLSYEAPQAFRIDPHDGQICVSQDIDRER----DPATYDLLVEAKDGGGLSAQAFVRVDLEDVNDNHPVFNPSTYVTSISDETQPGTEIINVLATDQDSGIYGTVAYELIPGNVSSLFTIDSTTGIIYLTLPLSHLESTTLSLMVSAQDGGGLTAVINADVTIHIF-----QTTLAPAEFERPKYTFLVYEDVPEDSPIGTVKAREPLNSSEPIFYRISSGDLGGKFSIHPRLGTIRTRKPLDHETQPVVVLTVQ--AQLGSAPACSSTEV--NITVMDVNDNHPAFLRTSDEIRISQTTPPGTALYLARAEDRDSGRNGLIRYSIASPQP----GVFAIDRALGVLFLNGSLGAGEQRELTLTLRAEDQGVHPQAALLVLTVVIEKREHSPSWTFEHLVYQVEVSESLSPMTQMLQTQAHPLGPQRAASPLRYSLEPSVDSAMFGIRPYTGWIYLRRQFDYESTQTYNFRVFAWIPEDGFLQNVSTTVIVRVWDENDNSPTFLHDVLFLKVEESPVPQGVIGKITAIDMDSGKNGQLLYFL--LSDGKFFKMNPNTGELINWVALDREHRGHHEMTVLVTDRGSPPRNATMAVYVSVTDINDNRPFFPQCLPGKELHVKVLEGQPVNMLVTTVFAKDPDEGNNAEVTYSVSSEDSSDH---FKIDANNGEIRTTTILSYDYRPSYRMSVIATDQGVPPLQGQAVVNIQVIPLSKGRAIMSQNIRHLIIPENLKP-TKIMSLIKSSDHLQQHYNGKLHFSIVADDK-DGHFEIDSSTGDLFLSKELDYETTSHYLFRVITTDHS--KNLSLSSTVFLSIDVEDQNDHSPSF-QDELIVISVEENVPIGTLVYVFNAKDDDGSFLNSRIQYYIESHNPGTNPFLIHPSFGTLVTVSRLDRESIPTVILTVTASDQAVNVTDRRLRSLTAQIVILDVNDHNPTFISFP----NAHVKEDVTVGSLVHHITAHDPDEGRNGKVTYSILSGN-ENM----TFMLDESSGLLTTTCPLDYEMKTQHILTVLALDDGTPALSSSQTLTVTVLDVNDEAP---------VFKQHLYEASVKENQNPGEFVTRVEALDRDSGVNSKLQFEIMPGASFELF--EINSDTGEVVTTTILDREIQEVFTLRVLVRDGGFPSLSSTTTILC--TVEDENDHAPEFIVSSYDIEVLENQEP---EVVYTVLASDMDAGNNRAVEYHIIDGNTDECFTINEMSGEL 1885          

HSP 3 Score: 133.65 bits (335), Expect = 6.525e-30
Identity = 302/1391 (21.71%), Postives = 548/1391 (39.40%), Query Frame = 2
Query: 3089 IINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNV-FYIHQTAVYGT-----------EVGT---LLXXXXXXXXXXXXXXSL--KQPHYYQC---FYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIE---LAIDNEDQINIDSWTGLITTKVSLSCAQN---VKIRIFVSDLGFPKMTSSVDTLLK------PLYEPKSEEFLINKNLTFI--IPDHSQPGYVVGDLNIFPEN-----YGA----------KCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLKNLE--VVYSIKQPE--KYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEIHLVSSPRVSA-YELNVTVR--DSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQR-IFINIDYGNENPPRFSRSIFKVKLPEDEAITNFL-TVVANDPDLGIFGRIIYSLEGDTFDKKIF-IDPSTGKL-SCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFN----ATHFSLKVLENSPGGTVLGRINIVKPPV--NSEIFYVLNPGHS--HIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDS-DKTSNITYQF----DRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVP-SKCTTVLIDISL-NQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKF----------SIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEI--RGYKKVIIHXXXXXXNKPVFSQNKFVAFLN----EGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLID-ANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFL-NVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARF---SSTAVIEIDVEDKNNHVP 6973
            +  LL++ +D G   PL TE  + +R+ D N+  P+    +    + + A  GT           E G+    L              SL  K  H  +C   F I+  S     IR    E      E + + ++A D G P  S+   + I   + N N P       +  +    P+  G     V A D D GL     YS+    L+ +      ID   G I     +   ++     + +   D G     + V   L+      P++ P           T++  I D +QPG  +  +N+   +     YG             LF  ++TT   G ++L      L         ++   SL V        +   N  + + + +   +   F +    FL + E++P  S + +   R   N    + Y I   +    F I+P  G + T +  D ET+  +   V+     + +    +   + + + D NDN P  L  S  I RIS  T    +++   A D DSG N  + Y I     G+F I+   G + L  S       EL +T+R  D G  P++  +V ++  +  +      F      + +S   S    ++   ++          +RY L     + +F + P TG +  +     E   +++     V      D  + ++   + + +   N+N P F   +  +K+ E       +  + A D D G  G+++Y L     D K F ++P+TG+L +   L+   +  + + ++ TD    S  R     V + V +   +   F          +KVLE  P   ++  +    P    N+E+ Y ++   S  H +I+   GE+RT   L  +      +++ A  + +     Q   A++++++I ++  + I ++N   + IP + +P K ++ + ++D   +  N    F    D  D         + +D  +G+LFL   +       +  +VI +D+    S  +TV + I + +Q+        E  +  V+EN   GT +     V   KD    F          S   G N  L+  H S G +     +++DRE I  +IL    S     +  R  + +   +  +D N        F++F N    E     + V  +T +DPD G N +V Y I   +    F++D ++G + T  PL++  K+ + L + A    +P + +   LTV ++++ND+ P          +  N+  G F+T++ A D D   G++ +++   +   +  L  +  D+GE+  +  L           ++V D  F   SST  I   VED+N+H P
Sbjct:  504 LYELLLVATDAGS-PPLSTEETLLLRVADLNDQPPLFSQQHYKASVSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQLSAPCNLGSLQSKMVHTAECGPSFAIDSESGAISTIRTLDREVQ----EAVELKVVAQDLGEPPLSATCLVSITVDDVNDNEPIFWRQVYNATIAEHAPV--GHCFLQVTASDADSGLYGFIEYSLYDGFLSYEAPQAFRIDPHDGQICVSQDIDRERDPATYDLLVEAKDGGGLSAQAFVRVDLEDVNDNHPVFNPS----------TYVTSISDETQPGTEI--INVLATDQDSGIYGTVAYELIPGNVSSLFTIDSTT---GIIYLTLPLSHL---------ESTTLSLMVSAQDGGGLTAVINADVTIHIFQTTLAPAEFERPKYTFL-VYEDVPEDSPIGTVKAREPLNSSEPIFYRISSGDLGGKFSIHPRLGTIRTRKPLDHETQPVVVLTVQA---QLGSAPACSSTEVNITVMDVNDNHPAFLRTSDEI-RISQTTPPGTALYLARAEDRDSGRNGLIRYSIASPQPGVFAIDRALGVLFLNGSLGAGEQRELTLTLRAEDQGVHPQAALLVLTVVIEKREHSPSWTFEHLVYQVEVSESLSPMTQMLQTQAHPLGPQRAASPLRYSLEPSVDSAMFGIRPYTGWIYLRRQFDYE---STQTYNFRVFAWIPEDGFLQNVSTTVIVRVWDENDNSPTFLHDVLFLKVEESPVPQGVIGKITAIDMDSGKNGQLLYFL---LSDGKFFKMNPNTGELINWVALDREHRGHHEMTVLVTDRG--SPPRNATMAVYVSVTDINDNRPFFPQCLPGKELHVKVLEGQPVNMLVTTVFAKDPDEGNNAEVTYSVSSEDSSDHFKIDANNGEIRTTTILSYDYRPSYRMSVIATDQGVPPLQGQ---AVVNIQVIPLSKGRAIMSQNIRHLIIPENLKPTKIMSLIKSSDHLQQHYNGKLHFSIVADDKD-------GHFEIDSSTGDLFLSKELDYETTSHYLFRVITTDHSKNLSLSSTVFLSIDVEDQNDHSPSFQDELIVISVEENVPIGTLV----YVFNAKDDDGSFLNSRIQYYIESHNPGTNPFLI--HPSFGTL--VTVSRLDRESIPTVILTVTASDQAVNVTDRRLRSLTAQIVILDVND---HNPTFISFPNAHVKEDVTVGSLVHHITAHDPDEGRNGKVTYSILSGNENMTFMLDESSGLLTTTCPLDYEMKTQHILTVLALDDGTPALSSSQTLTVTVLDVNDEAPVFKQHLYEASVKENQNPGEFVTRVEALDRDS--GVNSKLQFEIMPGASFELFEINSDTGEVVTTTILDREIQEVFTLRVLVRDGGFPSLSSTTTILCTVEDENDHAP 1827          

HSP 4 Score: 114.775 bits (286), Expect = 3.673e-24
Identity = 167/783 (21.33%), Postives = 299/783 (38.19%), Query Frame = 2
Query:  116 LIFSIKENVPIGEVVGQI----------ESPGF-SPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGD------SEKVFAIDYHDSSNGIFYVRLILKQSLD-----------YEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFL-----------DNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNS--PPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYD--------------------AISTSF-----DLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEIDSTILNENQHVTFVKTTKRLPTKPIFIFKIFVLNNLFKINETTGEILSK--RSIDCGKYFF------NVSMLSLKTNSLIDQTKLEIVVKSGRKLPL-------------------YFDRGFRKILVTTGK-SQCFSEIAVRNRHCGMR--IQYS-YDLLLKTDG--ILRINEH-GALCTAENVKHNKLMSTRYLYQIKALDETNSSAVCVVLFAIQPSKVFDVLPTEINITLPIIDSPKFNFSL-----PIGKIIGTFSKLPPAQFIGFIQYHLVPEELSTGAITVDSQSGEILM 2149
            L  S+ E +P   +VG I          E  GF              F +   TG+I+ +  +DRE+++ YSF+  ++ G    V+I++ DVND+ P+F   + +  + E  P G+   L    DPD G  S Q   +V         +   F + Y         +       L+            E  +   L I+A DGG P     L V++ V + NDN P F+   Y A+++ED +      RVRATD D G +G + Y +                 + +F V+  +G V + + LD E    H + +  RD    P   T +V + +  ++ N     +  L  GG++ ++    P   VA V ++D D                    +IS S      D  +L   P       P ++ L +   +     +   L L A D   P LST + L +++ +       FS   ++  + S        V +V  +          +  + +  L       G + SK   + +CG  F        +S +      + +  +L++V +   + PL                   ++ + +   +        CF ++   +   G+   I+YS YD  L  +     RI+ H G +C ++++   +  +T Y   ++A D    SA   V   ++          ++N   P+ +   +  S+     P  +II   +    +   G + Y L+P  +S+   T+DS +G I +
Sbjct:   69 LTLSVDEGLPPDTLVGDIRAGLPAAQQQEGSGFFLSEDSDDSPLLDDFHVHPDTGIIRTARRLDRERRDHYSFVAATLLGAVVQVEIRVNDVNDHSPRFPLDSLQLDVSELSPPGTAFRLPVAHDPDAGLFSTQGYTLVQPSDLPKDPAGPFFQLRYRTPGPLPSPLLPGSSSPLEPLDLVLLRRLDREEAAAHRLQIEAWDGGRPRRTGLLSVELRVLDENDNPPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGALGDAAYFAVEELSGVVRVWRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDNRPAIHVLFLTEGGVARVSEGARPGDYVARVSVSDADGDWEKEDEATGELGVGLGDGSISLSLEGGEGDFALLPGGP-------PGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLNDQPPLFSQQHYKASV-SEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQL-SAPCNLGSLQSKMVHTAECGPSFAIDSESGAISTIRTLDREVQEAVELKVVAQDLGEPPLSATCLVSITVDDVNDNEPIFWRQVYNATIAEHAPVGHCFLQVTASDADSGLYGFIEYSLYDGFLSYEAPQAFRIDPHDGQICVSQDIDRERDPAT-YDLLVEAKDGGGLSAQAFVRVDLE----------DVNDNHPVFNPSTYVTSISDETQPGTEIINVLATDQDSGIYGTVAYELIPGNVSS-LFTIDSTTGIIYL 830          

HSP 5 Score: 111.309 bits (277), Expect = 4.109e-23
Identity = 87/301 (28.90%), Postives = 140/301 (46.51%), Query Frame = 2
Query:  125 SIKENVPIGEVVGQIES----------------PGFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNG------DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNS 961
            S+KEN   GE V ++E+                PG S  FE+       F I+  TG +  + ++DRE Q +++  ++  +G       T  +   + D ND+ P+F  ++++  + EN      V      D D G N      I+ G++++ F I+            L   ++LD E IS F LVI   D G PP  + + +++ V +AND+ P F    Y +S++ED E+    L + A D D G++G+  YFL  T  +S  FT+D  +G +    +LD E    H  S   RD S
Sbjct: 1732 SVKENQNPGEFVTRVEALDRDSGVNSKLQFEIMPGAS--FEL-------FEINSDTGEVVTTTILDREIQEVFTLRVLVRDGGFPSLSSTTTILCTVEDENDHAPEFIVSSYDIEVLENQE-PEVVYTVLASDMDAGNNRAVEYHIIDGNTDECFTINEMSG-------ELSTTRALDREQISNFTLVILCSDLGDPPRSSVIHLQVRVLDANDHSPSFPTLYYQSSVREDAEVGTVVLVLSAVDKDEGLNGQTEYFL--TDEASGAFTIDPMSGTLKTSNTLDREARSQHTFSAVARDCS 2013          

HSP 6 Score: 109.768 bits (273), Expect = 1.060e-22
Identity = 94/305 (30.82%), Postives = 142/305 (46.56%), Query Frame = 2
Query:  113 LLIFSIKENVPIGEVV---------GQIESPGFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKNV----------QIKILDVNDNEPKFNATNFEKS-IPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            L++ S++ENVPIG +V         G   +       E H+     F+I  + G +     +DRE       L ++ +    NV          QI ILDVND+ P F   +F  + + E+  +GS V   T  DPDEG+N   +  I+SG+    F +D    S+G+    L     LDYE+ +Q  L + A+D G P L +S  + + V + ND  P F    Y AS+KE+Q       RV A D D+GV+ +L + +     S + F ++  TG V     LD E  +   + + VRD   P
Sbjct: 1514 LIVISVEENVPIGTLVYVFNAKDDDGSFLNSRIQYYIESHNPGTNPFLIHPSFGTLVTVSRLDRESIPTV-ILTVTASDQAVNVTDRRLRSLTAQIVILDVNDHNPTF--ISFPNAHVKEDVTVGSLVHHITAHDPDEGRNGKVTYSILSGNENMTFMLD---ESSGL----LTTTCPLDYEMKTQHILTVLALDDGTPALSSSQTLTVTVLDVNDEAPVFKQHLYEASVKENQNPGEFVTRVEALDRDSGVNSKLQFEI-MPGASFELFEINSDTGEVVTTTILDREIQEVFTLRVLVRDGGFP 1807          

HSP 7 Score: 101.293 bits (251), Expect = 3.627e-20
Identity = 75/264 (28.41%), Postives = 133/264 (50.38%), Query Frame = 2
Query:  215 EKKFIIS----KTTGVIKVSGLIDREKQNLYSFLIISMNG------DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFY------FLDN-TSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD 955
            E KF  S    K  G + +   +DRE    +  +I++ +        T  + I++LDVNDN P F++ ++   + E+ P+GS + + +  D D G ++     I+SG+ +  F   Y + + G+ Y    L + LDYE +++F L +QA D        ++ V + V + ND+ P+F  S +   + E+  I+ T   + A D DAG  GEL Y      FL +  S   D F +D  TG+++ ++ LD+E    + +++  +D
Sbjct: 2601 ETKFFHSEYPYKQVGYLVLLHSLDREASASHELVILASDSGCPPLSSTAVISIQVLDVNDNPPNFSSLSYHTHVKESTPLGSHITVVSANDRDTGSHAEIIYNIISGNEKGHF---YLEENTGVLY----LIKPLDYEKMTKFTLTVQASDAEKKHFSFAV-VFVSVLDDNDHAPQFMFSSFSCIVPENLPISSTICSINALDFDAGPYGELTYSIVSPCFLTHGMSYDHDLFLIDPLTGDIHAKQILDYENGNKYCLTVQAKD 2856          

HSP 8 Score: 99.7525 bits (247), Expect = 1.134e-19
Identity = 195/918 (21.24%), Postives = 362/918 (39.43%), Query Frame = 2
Query: 5945 HFLKVIVSDNGVPSKCTTV-----LIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNY-----------------CKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKI-ILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPD-------------------IGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYRIRHRKLTNQT-LFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVV---DDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEPQ-------EKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKD-LDSDKAIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPE-KITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQM-DKNSFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDL--FESRIWNLT---------------IMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHDIQYFLTPHENFELTCSQSQSSGCNIKSKSVLDFETHE--NYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQS-FTQNVEGGIPK--LGQILFTAYASDKDRGRFGIVSYQIVENPSENFGINNETGAI 8455
            H L V   D G   +  TV     ++D++ N+   +V  + E  + RV E +  G ++ ++ + +                    D S   S+  G     +      G  F+     +DRE  D   +L      G   +   + +++ V D++D  P+FSQ  + A ++E   P T V+ ++  D D                       S     +        F ID+ +G + T   L+   +   +L + A     P + A C +++ + ++ND  P       N  +  + PVG    ++TA D+D G  G I Y +    L+ +      +    G+I +S+ +   +     +D++V   D    S+ A + +D+ED N++ P+   +  V ++S   + G++I+ + A D+D    G V +EL+             N ++LF ID             H     + L  +A D       I A   +  +  +  P           + E +   S I     ++ L+S + IFY+I +   +     +    G +   K L++  QP  +L V   +  +P    T  N++V    +N    L  +  I +S   P     P     L +  D++S R      S+A  QP        F ID +  + ++NG L   E R   LT               ++ V  +K ++SPS  +E  +L   +EV E +            +T ++     P    L        ++Y L P  +  +   +  +    ++ +   D+E+ +  N+R+   I    F L++ S T++V   V D ++  P F+H   F +  E  +P+  +G+I     A D D G+ G + Y ++ +  + F +N  TG +
Sbjct:  379 HQLVVEARDGGAEPEVATVRVSIAVLDVNDNRPAIHVLFLTEGGVARVSEGARPGDYVARVSVSDADGDWEKEDEATGELGVGLGDGSISLSLEGGEGDFALLPGGPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLNDQPPLFSQQHYKASVSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQLSAPCNLGSLQSKMVHTAECGPSFAIDSESGAISTIRTLDREVQEAVELKVVAQDLGEPPLSATCLVSITVDDVNDNEPIFWRQVYNATIAEHAPVGHCFLQVTASDADSGLYGFIEYSLYDGFLSYEAPQAFRIDPHDGQICVSQDI-DRERDPATYDLLVEAKDGGGLSAQAFVRVDLEDVNDNHPVFNPSTYVTSISDETQPGTEIINVLATDQDSGIYGTVAYELIP-----------GNVSSLFTIDSTTGIIYLTLPLSHLESTTLSLMVSAQDGGGLTAVINADVTIHIFQTTLAPAEFERPKYTFLVYEDVPEDSPIGTVKAREPLNSSEPIFYRISSGD-LGGKFSIHPRLGTIRTRKPLDHETQPVVVLTVQAQLGSAPACSSTEVNITVMDVNDNHPAFLRTSDEIRISQTTP-----PGTALYLARAEDRDSGRNGLIRYSIASPQPG------VFAIDRALGVLFLNGSLGAGEQRELTLTLRAEDQGVHPQAALLVLTVVIEKREHSPSWTFE--HLVYQVEVSESL----------SPMTQMLQTQAHP----LGPQRAASPLRYSLEPSVDSAMFGIRPYTGWIYLRRQ--FDYESTQTYNFRVFAWIPEDGF-LQNVSTTVIVR--VWDENDNSPTFLHDVLFLKVEESPVPQGVIGKIT----AIDMDSGKNGQLLYFLLSD-GKFFKMNPNTGEL 1246          

HSP 9 Score: 98.2117 bits (243), Expect = 3.669e-19
Identity = 74/256 (28.91%), Postives = 121/256 (47.27%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLIISMN------GDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSG----DSEKVFAIDYHDSSNGIFYVRLILKQSLDYEI-ISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDN 958
            F I   +G I     +DRE Q      +++ +        T  V I + DVNDNEP F    +  +I E+ P+G      T  D D G        +  G    ++ + F ID HD        ++ + Q +D E   + ++L+++A DGG   L A   V++ +++ NDN P F+ S Y+ SI ++ +     + V ATD D+G+ G + Y L   + SS  FT+D  TG +YL   L   +S +  + +  +D 
Sbjct:  606 FAIDSESGAISTIRTLDREVQEAVELKVVAQDLGEPPLSATCLVSITVDDVNDNEPIFWRQVYNATIAEHAPVGHCFLQVTASDADSGLYGFIEYSLYDGFLSYEAPQAFRIDPHDG-------QICVSQDIDRERDPATYDLLVEAKDGGG--LSAQAFVRVDLEDVNDNHPVFNPSTYVTSISDETQPGTEIINVLATDQDSGIYGTVAYELIPGNVSS-LFTIDSTTGIIYLTLPLSHLESTTLSLMVSAQDG 851          

HSP 10 Score: 95.9005 bits (237), Expect = 1.565e-18
Identity = 71/239 (29.71%), Postives = 118/239 (49.37%), Query Frame = 2
Query:  251 IKVSGLIDREKQNLYSFLIISMNGDTK---NVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDN 958
            +K    +D E +N    ++++ +   +    V + I D NDN P F  + ++ S+ E+    + V      D D G N +    I+SG+ E+ F ID   + +G+   + IL    DYE+ S ++L++QA D G P L  + ++K+ V + NDN P F  S  +  I ED    +    V   D D   S  +F F   ++P +  F +D  TG V L K+LDFE+   + + I + D+
Sbjct: 2197 VKEPKFLDFEVRNEVQLIVLAESSGHRAYCKVAVLIQDENDNSPCFEQSIYQASVSESQLYNAHVIQVFATDLDSGLNGLIEYSILSGNQEEAFQID---ALSGVITTKAIL----DYELTSSYSLIVQATDKGMPRLSNTTVIKVQVTDINDNAPAFLPSEAV-EITEDSLPGVIVTHVSVHDVDLN-SAFIFSFAKESNPGTK-FAIDQNTGVVVLVKTLDFEEMTEYELLIQISDS 2425          

HSP 11 Score: 93.2041 bits (230), Expect = 1.049e-17
Identity = 71/248 (28.63%), Postives = 122/248 (49.19%), Query Frame = 2
Query:  212 QEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKN-----VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLI-----LKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSK 925
            ++  F + + TGV+ +   +D EK   ++  + + + + K+     V + +LD ND+ P+F  ++F   +PEN PI S +      D D G     +  IVS      F        + +F +  +      KQ LDYE  +++ L +QA D G     ASL+V + ++  ++  P F   +Y  ++ E  +      RV A+D DAG+ G + Y L  +SP   FF+V+   GN+YL ++L   KS+
Sbjct: 2709 EKGHFYLEENTGVLYLIKPLDYEKMTKFTLTVQASDAEKKHFSFAVVFVSVLDDNDHAPQFMFSSFSCIVPENLPISSTICSINALDFDAGPYGELTYSIVS----PCFLTHGMSYDHDLFLIDPLTGDIHAKQILDYENGNKYCLTVQAKDKGD--ATASLVVWVDIEGIDEFEPIFTQDQYFFTLPEKNKDRQLIGRVEASDADAGIDGVILYSLGTSSP---FFSVNKTNGNIYLIRALPLIKSQ 2947          

HSP 12 Score: 91.2781 bits (225), Expect = 3.881e-17
Identity = 318/1606 (19.80%), Postives = 639/1606 (39.79%), Query Frame = 2
Query:  206 DFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKNVQ--------IKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVR-----LILKQSLDYEIISQFNLVIQAIDGGHPPLQA---------SLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISI-GVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDA-ISTSFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEIDSTILNENQHVTFVKTTKRLPTKPIFIFKIFVLNN----LFKINETTGEILSKRSIDCGKYFFNVSMLSLKTNSLIDQTKLEIVVKSGRKL----------PLYFDRGFRKILVTTGKSQCFSEIAVRNRHCGMRIQYSYDLLLKTDGILRINE-HGALCTAENVKHNKLMSTRYLYQIKALDETNSSAVCVVLFAIQPSKVFDVLPTEINITLPIIDSPKFNFSL---------------------PIGKIIGTFSKLPPAQFIGFIQYHLVPEELSTGAITVDSQSGEILMKKFPIHKN-PIRLIVKSVIRKPFNVSPLNIVAINFQ----KLFFARSLYQFILTKSEIKGNLVKIGQVSMDSSCTESVSYDLFGVKNDHSHFTIDVATGVIYGKDLGSISNKTLMFQVSAKA-------PKSQTSFAQVIIYIED-GIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSD---------EYQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKN----LIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIR-VKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPD-KGLNSIFNYSIELAIDNEDQINIDS----------WTGLITTKVSL--SCAQNVKIRIFVSDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVD-GFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFN--KKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLKN---LEVVYSIKQP----------EKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEIHLVSSPRVSAYELN 4675
            D ++  F I  +TG + +S  +D E  + Y F +I+ +  +KN+         I + D ND+ P F       S+ EN PIG+   L  VF+  +   S  + RI        + I+ H+     F +      L+    LD E I    L + A D      QA         SL  +I++ + ND+ P F IS   A +KED  +      + A D D G +G++ Y + + + +  F  +D  +G +     LD+E    H +++  + D +P   +S+   +  +   ++ P   Q L+   + E   + +P   V  V+  D D+ +++    EI+  + F+L +I     E+     +         L +   D   PSLS+T  +   + +       F  S + +E+   + N+   V +      +        +  +++      F INE +GE+ + R++D  +   N +++ L ++ L D  +  ++    R L           LY+    R+           S +   ++  G+  Q  Y L  +  G   I+   G L T+  +  ++   +++ +   A D       C +  +   + +  V  T++N   P+++   F+  L                     P G ++ +F++                   +    ++D  +GEI  ++ P  +  PI L +K   +     +   ++ I+ +    K+ F+  LY+ ++T++   G  +   +     S  +S+ Y +F   N+    ++   +G +  K+      K L F+V  +             ++ +V + I+D   + P F+ S    ++ E+      ++QVF      +D         EY I+     +   I + +G I      D E  S   + VQ  +     + + T+         ++   +  +     T + L   G +   +   D D     N ++     K       F I+  TG ++++ +L+           LL+ +SD+  +    TE  + VR++D N++ P+   +  FY   T      VG  ++            IS +     + F I+  +   F I  V  L+TI++       ++ A+D G+P   ++  + I   + N   PE  +  +   +      L GS + T + +D D    N+   YSI ++ ++++  ++++            G +    SL    + + ++ I  SD G P ++S+    ++ L    +     + +    + + +  G  +  ++    + G+    I N  +  + G  +L  ++  L L+K     K   ++L V  +  +K  FS +  ++++V+ +       +FS  S     + ENLP  S + S N          E+ YSI  P             F+I+P+TG +   ++ D E  N  ++ + V A    +     V+ + ++  DE   EP I +       +     +   I ++ A+DAD+G +  + Y +  SS   F +N  +G I+L+ +  +   +LN
Sbjct: 1446 DDKDGHFEIDSSTGDLFLSKELDYETTSHYLFRVITTD-HSKNLSLSSTVFLSIDVEDQNDHSPSFQDELIVISVEENVPIGT---LVYVFNAKDDDGSFLNSRI-------QYYIESHNPGTNPFLIHPSFGTLVTVSRLDRESIPTVILTVTASD------QAVNVTDRRLRSLTAQIVILDVNDHNPTF-ISFPNAHVKEDVTVGSLVHHITAHDPDEGRNGKVTYSILSGNENMTFM-LDESSGLLTTTCPLDYEMKTQHILTVLALDDGTPALSSSQTLTVTVLDVNDEAPVFKQHLYEASVKE---NQNPGEFVTRVEALDRDSGVNSKLQFEIMPGASFELFEINSDTGEVVTTTILDREIQEVFTLRVLVRDGGFPSLSSTTTILCTVEDENDHAPEFIVSSYDIEV---LENQEPEVVYTVLASDMDAGNNRAVEYHIIDGNTDECFTINEMSGELSTTRALD-REQISNFTLVILCSD-LGDPPRSSVIHLQVRVLDANDHSPSFPTLYYQSSVREDAEVGTVVLVLSAV---DKDEGLNGQTEYFLTDEASGAFTIDPMSGTLKTSNTL--DREARSQHTFSAVARD-------CSIQGSRSTTVIIKVYVTDVNDNDPVLEQNPFDVFLSPESPTNQTTVIVRADDLDLGPNGTVVFSFAE-------------------TQSMFSIDKYTGEIQFQQNPSSEYFPIWLQLKVTDQGIPARTTTGLLVIHMEGEDVKISFSHHLYKGLVTENCEAGTSIVTVKAFAPDSIQDSMKYSIFS-GNEDGVLSLCSKSGQLTVKE-----PKFLDFEVRNEVQLIVLAESSGHRAYCKVAVLIQDENDNSPCFEQSIYQASVSESQLYNAHVIQVF-----ATDLDSGLNGLIEYSILSGNQEEAFQIDALSGVITTKAILDYELTSSYSLIVQATDKGMPRLSNTTVIKVQVTDINDNAPAFLPSEAVEITEDSLP--GVIVTHVSVHDVDL----NSAFIFSFAKESNPGTKFAIDQNTGVVVLVKTLDFEEMTE---YELLIQISDSVHY----TEGALVVRVLDVNDNPPVF--SQDFY-QVTVPESIPVGYSVLTLSATDLESNENISYRILSSSKEFSIDPKNGTIFTISPVLLLDTIST----TQFLVEASDGGNPDLRALTLVEIGIEDMNNYAPEFTV--KSYNLSLSEDALVGSTLVTFSNIDHDWTRENTYVEYSI-ISGNSQNNFHVETKFFHSEYPYKQVGYLVLLHSLDREASASHELVILASDSGCPPLSSTAVISIQVLDVNDNPPNFSSLSYHTHVKESTPLGSHITVVSANDRDTGSHAEIIYNIISGNEKGHFYLEENTGVLYLIKPLDYEKMTKFTLTVQASDAEKKHFSFAV-VFVSVLDDNDHAPQFMFSSFS---CIVPENLPISSTICSINALDFDAGPYGELTYSIVSPCFLTHGMSYDHDLFLIDPLTGDIHAKQILDYENGN--KYCLTVQAKDKGDATASLVVWVDIEGIDE--FEP-IFTQDQYFFTLPEKNKDRQLIGRVEASDADAGIDGVILYSLGTSSP-FFSVNKTNGNIYLIRALPLIKSQLN 2949          

HSP 13 Score: 70.8626 bits (172), Expect = 6.466e-11
Identity = 67/250 (26.80%), Postives = 112/250 (44.80%), Query Frame = 2
Query:  221 KFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGD-----TKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGG-HPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAG---VSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISI 943
            KF I    G I+    +D E Q +    + +  G      +  V I ++DVNDN P F  T+ E  I +  P G+ + L    D D G+N +    I S     VFAI   D + G+    L L  SL      +  L ++A D G HP  QA+LLV  +V    ++ P +     +  ++  + ++     ++   +  G    +  L Y L+  S  S  F +   TG +YLR+  D+E +++++  +
Sbjct:  922 KFSIHPRLGTIRTRKPLDHETQPVVVLTVQAQLGSAPACSSTEVNITVMDVNDNHPAFLRTSDEIRISQTTPPGTALYLARAEDRDSGRNGLIRYSIAS-PQPGVFAI---DRALGV----LFLNGSLGAGEQRELTLTLRAEDQGVHP--QAALLVLTVVIEKREHSPSWTFEHLVYQVEVSESLSPMTQMLQTQAHPLGPQRAASPLRYSLE-PSVDSAMFGIRPYTGWIYLRRQFDYESTQTYNFRV 1160          

HSP 14 Score: 67.781 bits (164), Expect = 5.041e-10
Identity = 103/389 (26.48%), Postives = 174/389 (44.73%), Query Frame = 2
Query: 2666 YQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVSY----LVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDAD-SFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSD---NGPFKPLETEVEISVRIIDANNHSPILISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFT-VNAVDPDKGLNSIFNYSIELAIDNED-QINIDSWTGLITTKVSLSCAQNVKIRIFVSDLGFPKMTSSVDTL 3802
            + I+         I S TG +FL+K+ D E  S+    ++ T   KNL  S+T+ L +++ D ND+ P  ++     + E+   +G +       D D SF N  + Y ++   P    NPF I+P+ G L+ +S L+   S P+ I  L V  SD   N   + L + +   + I+D N+H+P  IS    ++ +    G+ V  +   D D G NG++  S+   +    F +++ S           E    +     + ++A D G+P+ SS   L +  ++ N   P     KQH          +  E  T V A+D D G+NS   + I      E  +IN D+   + TT +     +   +R+ V D GFP ++S+   L
Sbjct: 1441 FSIVADDKDGHFEIDSSTGDLFLSKELDYETTSHYLFRVITTDHSKNLSLSSTVFLSIDVEDQNDHSPSFQDELIVISVEENVPIGTLVYVFNAKDDDGSFLNSRIQYYIESHNP--GTNPFLIHPSFGTLVTVSRLD-RESIPTVI--LTVTASDQAVNVTDRRLRS-LTAQIVILDVNDHNPTFISFPNAHVKEDVTVGSLVHHITAHDPDEGRNGKVTYSILSGNENMTFMLDESSGLLTTTCPLDYEMKTQHI----LTVLALDDGTPALSSSQTLTVTVLDVNDEAPVF---KQHLYEASVKENQNPGEFVTRVEALDRDSGVNSKLQFEIMPGASFELFEINSDTGEVVTTTILDREIQEVFTLRVLVRDGGFPSLSSTTTIL 1816          

HSP 15 Score: 61.2326 bits (147), Expect = 5.151e-8
Identity = 68/259 (26.25%), Postives = 106/259 (40.93%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLI---ISMNGDTKNVQ----IKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDIS----RYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            F I   TG I +    D E    Y+F +   I  +G  +NV     +++ D NDN P F        + E+      +   T  D D GKN  Q +  +  D  K F ++ +          LI   +LD E      + +   D G PP  A++ V + V + NDN P F            + E Q +N+    V A D D G + E+ Y + ++  SSD F +D   G +     L ++   S+ +S+   D   P
Sbjct: 1133 FGIRPYTGWIYLRRQFDYESTQTYNFRVFAWIPEDGFLQNVSTTVIVRVWDENDNSPTFLHDVLFLKVEESPVPQGVIGKITAIDMDSGKNG-QLLYFLLSDG-KFFKMNPNTG-------ELINWVALDREHRGHHEMTVLVTDRGSPPRNATMAVYVSVTDINDNRPFFPQCLPGKELHVKVLEGQPVNMLVTTVFAKDPDEGNNAEVTYSV-SSEDSSDHFKIDANNGEIRTTTILSYDYRPSYRMSVIATDQGVP 1381          

HSP 16 Score: 60.4622 bits (145), Expect = 8.881e-8
Identity = 73/331 (22.05%), Postives = 127/331 (38.37%), Query Frame = 2
Query: 6218 AAAAKIDREKIDKIILWTQVSCGGSEIR-GYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIE-----------------FYSSQEEFLIDANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISI----PNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVG------------------------KHEFDIVVDDAR---FSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKD 7063
            AAA ++  E  D          GG   R G   V + V D +DN PVF Q+++ A + E   P   V R+   D D+G N  V Y +                   Y + EE     +G V+   PL+   ++ + LV++A    +    A  R+++ ++++ND RP I +         ++      G ++ +++  D+DG           K    T  L V    G I LS +    D                           +E  +V  DA     S+   + + V D N+  P+  +     ++S +   G+ ++++ A D D
Sbjct:  259 AAAHRLQIEAWD----------GGRPRRTGLLSVELRVLDENDNPPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGALGDAAYFAVEEL----SGVVRVWRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDNRPAIHVLFLTEGGVARVSEGARPGDYVARVSVSDADG--------DWEKEDEATGELGVGLGDGSISLSLEGGEGDFALLPGGPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLNDQPPLFSQQHYKASVSEAAAPGTVVMWVSASDAD 567          
BLAST of Dachsous vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 113.235 bits (282), Expect = 3.273e-24
Identity = 223/1027 (21.71%), Postives = 423/1027 (41.19%), Query Frame = 2
Query: 3098 LLVIVSDNGPFKPLE-TEVEISVRIIDANNHSPILISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPL---NVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCA-QNVKIRIFVSDLGFPKMTSSVDTLLKPL-----YEPKSE---EFLINKNLTFIIPDHSQPGYVVGDLNIFPENY--------------GAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLF----------SISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGS---HVASFNIRRLKNLEVVYSIKQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEIHLVSSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITN-FLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSC-SPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPV--NSEIFYVLNPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQI 6046
            LL+   D G  KP +  ++  S+ IIDAN+++P+  S + +    +A     +G+ LI  +    +      +     Y        S + F I    + T  +   P    +V+++A+D GSPS SS   + I  + S  + P + +                                      I L   N   +  +S  G I  +VS++   ++ K+R+  S    P+ T      L  L      E  SE   +FL+ K+   II +H Q    +GD+N     +              G++ L   +     +G++       +L+ +        V  +++     +  F          ++S++L +   +       P F K   + +EI E+ P G+    V + N +   +  + YS++  +++  ++ ++G +   + FD   E Q  +   VIAT+ +N +  T L + +++ D NDN P I  P+   + +         +  + A+D DSG   +++Y I   S   F IN  +GE+          + L V+ +D G   +S     +IH   I   +K    S S     +      G  IG +            ++Y + +G     FS+D  TG +     +   ++ ++ ++ I   + S       +  ++ I I+  N+NPP+FS S+ ++ + ED  +   F  V A+D D    G + YS+        I ID  TG+LS  S L++     Y L++ ATD  G+     + T + I V +   +   F  + ++++VLENSP  T++G++         N +I Y +  G  +  I+   G + T   +  E++  ++++I A  K +  RS    S       +   ++ P    +   I +P  +     +  + A D DK  N +  +       Q    ++++   +G+++L+  + +S +    L VIVSD GVP K     + + +++    +QI
Sbjct:  201 LLIEAQDGG--KPAKIGQLRCSIEIIDANDNAPVF-SRSRYTASVSA--NISIGSHLITVQATDADIGENSRIS----YDIKKTSAPSNSNFAISQSGVITTTASLLPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDI--------------------------------------IWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDGQIII-EHPQL-LTIGDINDNAPQWHSSQIHISLNRTQGGSRTLTAKDPDLGQNGWIRYSVLDTELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQ-VEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQKTFD--FEKQKSYQTTVIATN-ANSETSTSL-ISIRLKDVNDNWP-IFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSS-FSINPVTGEVFAQKPLARGRFHLVVSAKDGGG--QSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSK-------VKYSIYSGDQDHNFSIDEDTGKIYVTRYLD-ADVHDTVLLNIQATLPSGES----NQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDL-GIPPRSSNMT-LFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRS----STASARISVLDVNDNPPSCLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLY-----RAQLQSSLFVVK-SNGDVYLRRQLNASDERHQRLSVIVSDQGVPRKSVVCHVPVRISKGSADIQI 1145          

HSP 2 Score: 97.8265 bits (242), Expect = 1.770e-19
Identity = 89/320 (27.81%), Postives = 150/320 (46.88%), Query Frame = 2
Query:  113 LLIFSIKENVPIGEVVGQI---ESPGFSPPF--EMHDFQEKKFI-ISKTTGVIKVSGLIDREKQNLYSFLIISM--NGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTS-PSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQILW 1045
            L  F++ E+  IG  +G I        +P +     D Q  KF+ + + +G I     +D EK++ +  + + +  +G+T ++ +++ D NDN P F     +  I E   +G+   L TV D D  K  +    I+ G+   VF +      N      L++   LD E   ++ L+I+A DGG P     L   I + +ANDN P F  SRY AS+  +  I    + V+ATD D G +  + Y +  TS PS+  F +  ++G +    SL    + +H + +   D+  P  +S   V I V+    + P + I+W
Sbjct:   26 LTKFTVPESAQIGTRIGWISGKREESAAPKYFVVFPDEQTSKFLKVDERSGEISTIAHLDYEKRSKFDIVAVKVEESGETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASR-KVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAIS-QSGVITTTASL--LPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIW 341          

HSP 3 Score: 97.4413 bits (241), Expect = 2.334e-19
Identity = 166/694 (23.92%), Postives = 298/694 (42.94%), Query Frame = 2
Query: 5078 NENPPRFSRSIFKVKLPEDEAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIF-IDPSTGKLSCSPLNFMEKNIYN-LKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRI--NIVKPPVNSEIFYVLNPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTS--NITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDIS-LNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDG--ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARF---SSTAVIEIDVEDKNNHVP-ILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWF 7117
            N+N P++  S   + L   +  +  LT  A DPDLG  G I YS+     D ++  ID  TG++     N ++ NI + +K      +G S       +V+  + +T+     F    + +++ E++P GT L ++  N  +   +  I Y L     H+ ++T +G +        E  +  + T+ A     +  + +T++++I +R+ D+NDN PI   N   + +    +P++PL  +SA+D D  +   ++Y       +       + ++  +G +F +  +      R  L V   D G  S   +  I I+ +++D +  Q    K   R  E+ + G  IG +  ++       K+SI  G       + E TGKI+V     +D +  D ++L  Q +    E     +V+I ++D +DN P FS +     + E      P   +   D D   N +V Y I          ID   G + T   L++     Y L +KA+    P   +   L ++++++ND  P+       +++  N P  + + K+ A+D D  +   I YRI     TN + +  +    G ++  R +    +   +  IV +D      SSTA   I V D N++ P  L     V+   S L   + I  + A+D D   NG V +     S  F
Sbjct:  435 NDNAPQWHSSQIHISLNRTQGGSRTLT--AKDPDLGQNGWIRYSV----LDTELVSIDKETGRIFVP--NTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIA-----TNANSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSS-------FSINPVTGEVFAQKPLARG---RFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMS-----KVKYSIYSGDQDHNFSIDEDTGKIYVTRY--LDADVHDTVLLNIQATLPSGE-SNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRI-----TNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLS--TAIGTIVAMDPDKGLNGSVLYRAQLQSSLF 1090          

HSP 4 Score: 94.7449 bits (234), Expect = 1.429e-18
Identity = 76/260 (29.23%), Postives = 122/260 (46.92%), Query Frame = 2
Query:  212 QEKKFIISKTTGVIKVSGLIDREKQN--LYSFLIISMNGDTKNVQIKIL--DVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTS 979
            Q+  F I + TG I V+  +D +  +  L +      +G++   Q+ I   D NDN P+F+++  E SI E+  +     +    D D+ KN      I+S        ID        F  +L     LDYE    + L ++A D G PP  +++ + I V + NDN P+F+ S Y   + E+        +V A D D+  +G++ Y + N    S++F +D K GNVY ++S+D E      ISI   D   P  +S
Sbjct:  778 QDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQ-------FTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITN---GSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSS 1027          

HSP 5 Score: 91.6633 bits (226), Expect = 1.214e-17
Identity = 244/1106 (22.06%), Postives = 450/1106 (40.69%), Query Frame = 2
Query: 1484 LFKINETTGEILSKRSIDC---GKYFFNVSMLSLKTNSLIDQTKLEIVVK--SGRKLPLYFDRGFRKILV--TTGKSQCFSEIAVRNRHCG--MRIQYSYDLLLKTDGILRINE-HGALCTAENVKHNKLMSTRYLYQIKALDETNSSAVCVVLFAIQPSKVFD----VLPTEINITLPIIDSPKFNFSLPIGKIIGTFSKLPPAQFIGFIQYHLVPEELSTGAITVDSQSGEILMKKFPIHKNPIRLIVKSVI---RKPFNVSPLNIVAIN--FQKLFFARSLYQFILTKSEIKGNLVKIGQVSMDSSCTESVSYDLFGVKNDHSHFTIDVATGVIY-GKDLGSISNKTLMFQVSAKAPKSQTSFAQVIIYIED-GIHQPGFDFSDLLVNIWENTTVG--IEIMQVFPKYPSVSDE--YQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNL-IGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDL--SSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMP-KQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDN------EDQINIDSWTGLITTKVSLSCAQNVKIRIFVSDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQ-----------LILLKDNLNVKNVHYSLNVVFNKKNLFSISS-NLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLKNLEVVYSIKQPE--KYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSK--LTYQINPSSDGIFMINGDSGEIHLVSS 4648
            L  I++ TG I    +IDC    +  F V      + +L   T L++V         P  F++   ++ +   T    C  ++   N  CG   RI+YS   L   D  L ++   G +C  +     K  S    YQ   +    +S     L +I+   V D      P E ++T  + + PK    L    ++ + S +    F G + YH++ E   + + +++  +GE+  +K P+ +    L+V +     +   N + ++I  I+   +   F+RS Y+   T+  + G  + IG V   S     V Y ++    DH +F+ID  TG IY  + L +  + T++  + A  P  +++  QV+I+IED   + P F  S + ++I E+  +     ++Q   K    + E  Y II S     + I   TGQ+      D E      + V+  +L I   + ++ L I  ++ N    +  K+ +T E L  S    +   +   D DS  NG + YR+        +  F I+   G +    S+   +      +++ ++  D G   P  +     + ++D N++ P  +S     +   +   T +GT++  D D G NG +   L +       ++ K + + ++ R   L   +   + L+V  I +D+G P KS V ++ +   + + +  +I  P +++ ++   CP  +G  + T+NA      L      S   AI           I+   ++ +I         +++++R+  S                            NK  T  I D +  G  +G L       G K         S DG    RF S++           L+ L D L   + H + +  F K N    S+  + +++ ++R     P F     + + I+E+ P+GS + + N     +     S + P     F I+  TG +    + D    +    Y  ++    S P   T L + V + D ND+ P+I+S  +  V + +   +   + ++VA D D  P  +  L Y  +  +   F I+  SGEI +V S
Sbjct:  482 LVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPAL--STDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYS---LQNQDEHLTVDTMSGTVCIQKTFDFEKQKS----YQTTVIATNANSETSTSLISIRLKDVNDNWPIFYPNEYHLT--VREGPKPEEPL----LVVSASDMDSGTF-GEVSYHILSE---SSSFSINPVTGEVFAQK-PLARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPG--IAIGSVGAMSK----VKYSIYSGDQDH-NFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRI-----TNGSEYFGIDEKLGNVYTKRSI---DREVISHVDISIVAEDKG-VPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSV---LYRAQLQSSLFVVKSNGDVYLRR--QLNASDERHQRLSV--IVSDQGVPRKSVVCHVPVRISKGSAD-IQIQEPFQKYIEIPKSCP--TGCRLTTLNATGVSSWLIQSSEISNHFAIREGVLFMISHPIHRPPYSLVIVLSDKNDRQKSIQLRVLASGEA------------------------ANKEETIRISDSNSIGTKIGRL-------GEK---------SADGSFFYRFSSEESCPLELDQTGGLLYLADGLRRGDTH-NFSCFFEKFNTTDGSAEEMRVDLEISRTKSDKPRFDTGHLR-VNIREDTPTGSIITTVNATVSDDSASPISYRFPLLIDNFSIDQFTGDIT---LIDTLHWHVTPTYNLIVEAFTSGPG--TTLLVTVNVDDVNDHTPFIVSQPT--VLLPSSYRKGGMVHRVVAIDLDKDPEIRYSLKYAGSEVAKEFFKIDEKSGEIFVVES 1492          

HSP 6 Score: 87.4261 bits (215), Expect = 2.364e-16
Identity = 179/756 (23.68%), Postives = 302/756 (39.95%), Query Frame = 2
Query: 3425 VMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVKIRIFVSDLGFPKMTSSVDTLLK---PLYEPKSE-EFLINKNLTFIIPDHSQP-GYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNV---HYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLKNLEVVYSIKQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLP------------------LIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEIHL-VSSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRI-----FINIDYGNENPPRFSRSIFKVKLPEDEAITNFL-TVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCSPLNFMEKNIY---NLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLA--FNATHFSLKVLENSPGGTVLGRINIVK--PPVNSEIFYVLNPGHSHIQINTTTGEL 5572
            +++I TD GS + S  + + +   + N N P++      +  I     + G  +    A D D G N  F++  EL  D+   +++   TG +  +  LS  Q+ KI++ V D G P +    +  +    P  E K+  EFL    L+ I  D   P G  +  L   PE  G        T + V+G +   F      +++ NL +       YSL V+              ++V VN +  + P F    P+   + ENL  GS+VA+   + + NL        P +YF+++  +GQ  T    D       QF   +   H++ P  F VLP                  L + ++D NDN P    P        A  +      +I A D D+     LTY +   S  IF +  +SG + + V  P    Y + VT  D+G    S SV  S+     +   K  F        +    SK G  IG LS  ++      +  Y +   + ++IFS+D   G +     + RE+    E  Q+ +      D  +   Q++      I +D  N+N P F+   + + L +  A    +  ++A+D D G  GR+ Y +        + ++P TG +  +  N  + + +     +I+    +     R    KV + ++ +     A  F    + + VLE++  GTVL +I         N  + Y L      + I+  TGEL
Sbjct: 1697 LIIILTDGGSRNDSCTVRVTV--ADQNDNKPQLDASTPSELEIAESSRV-GDVLHRFRASDMDIGQNGKFSF--ELLEDSSGSLDLVPETGDLVLR-RLSSLQSWKIKLRVVDHGVPGLYVEKNLEISNRNPQTEAKAPLEFLKQTYLSTI--DEGLPRGQFIAKLQ--PELAGL-------TYSIVEGNIDSAFSVDSEGVIRTNLELDREILERYSLKVIGTGSGQ---QIGTRVDVRVNNLNDNVPSFPMSKPR--RVPENLRVGSYVATVGAKDVDNL-------APLRYFLVSDSSGQTPTHFNID-------QFTGTI---HLTAPLDFEVLPEHTLTIKATDGSFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDA--RGALTYSLGQGSSSIFRVAPESGALFMKVLPPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVME-NSKIGLQIGNLSGEESR-----EFHYRIQDPEASKIFSIDKF-GRLFVAGPIDREQRATHEF-QVEI------DNEMMTSQKVQCKCHVIVLDE-NDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEHQGKLGIDVKTGEL 2396          

HSP 7 Score: 76.6406 bits (187), Expect = 4.340e-13
Identity = 65/233 (27.90%), Postives = 113/233 (48.50%), Query Frame = 2
Query:  257 VSGLIDREKQNLYSF-LIISMNGDT--KNVQI-KILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISI 943
            + G++DRE  + +    ++  +G    ++ Q+  I D+NDN P+++++    S+  N   G    LT   DPD G+N    +R    D+E V +ID           R+ +  ++D  I S+    ++A DGG P L   L V   + +     P+F+ + +   I ED  I    ++V A ++  G S  + Y L N     +  TVD  +G V ++K+ DFEK KS+  ++
Sbjct:  397 LCGILDRETASEHHLKFLLEKDGQIIIEHPQLLTIGDINDNAPQWHSSQIHISL--NRTQGGSRTLTAK-DPDLGQNGW--IRYSVLDTELV-SIDKETG-------RIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQN---QDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTV 613          

HSP 8 Score: 75.8702 bits (185), Expect = 6.769e-13
Identity = 71/252 (28.17%), Postives = 107/252 (42.46%), Query Frame = 2
Query:  230 ISKTTGVIKVSGLIDREKQNLYSF------LIISMNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            I + TG +    L+D E    Y        L I        + I +LDVNDN P+F  + +   + EN P  + V      D D  +N     RI +G   + F ID      G  Y     K+S+D E+IS  ++ I A D G PP  ++   +I V + NDN P   +S     +     ++     + A D D G++G + Y        S  F V    G+VYLR+ L+    +   +S+ V D   P
Sbjct:  887 IDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNG--SEYFGID---EKLGNVYT----KRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSC-LSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLY---RAQLQSSLFVV-KSNGDVYLRRQLNASDERHQRLSVIVSDQGVP 1124          

HSP 9 Score: 72.7886 bits (177), Expect = 6.682e-12
Identity = 120/520 (23.08%), Postives = 219/520 (42.12%), Query Frame = 2
Query: 2243 INFQKLFFARSLYQFILTKSEIKGN--LVKIGQVSMDSSCTESVSYDLFGVKNDHSHFTIDVATGVIYGKDLGSISNKTLMFQVSAK--APKSQTSF-AQVIIYIEDGIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSDEYQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXK---PYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSN-----PSGIINLLVIVSDNG-PFKPLETEVEISVRIIDANNHSPILISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLE-TINSYF----EPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVKI 3745
            IN     F++ LYQ  ++ +         KI    +D+    +++Y L   +   S F +   +G ++ K L     + L+   +     P   TS    VII   +   +PGF+ ++    + EN+ +G++I  +  +  S    Y+I   + S   SI  K G++F+    DREQ +     V++ N + ++        + + D     P   +     + +D  + G+    +  SD DS  NG +SYR+     +   N   +NP TG +     LN WN       P+    +LV   D+G P +    +V++S+++   +  +P  +   V+ +H   +  T VGT+L K       G     L         Y  K  +    I VK+ E T+ ++     EP+  M ++   G+  +S+V+ L I     +   P         Q+    P  +G  +  + A+D D G++ +  YSI    D +  + I+  TG+I  +  L   +N+ I
Sbjct: 2022 INDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDARG--ALTYSLG--QGSSSIFRVAPESGALFMKVLPPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGEE-SREFHYRIQDPEASKIFSI-DKFGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDL---NIVTLNPDTGSI----QLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFV-LPVYEVH--VLEDTSVGTVLQKIRASNRLGMRNDGL--------LYSLKEHQGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSDGN-GRSAVVPLKIVVEPVDEFAPVFTKSSYTLQIPISTP--AGESVGQMQAIDEDGGVHGVVKYSIS---DRQSTVKIEEHTGIIRLQKPLVSRRNLTI 2511          

HSP 10 Score: 71.633 bits (174), Expect = 1.182e-11
Identity = 70/276 (25.36%), Postives = 122/276 (44.20%), Query Frame = 2
Query:  122 FSIKENVPIGEVVGQI---ESPGFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNG--DTKNVQIK----ILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQA--SLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFE 916
            F + EN  IG  +G +   ES  F   + + D +  K       G + V+G IDRE++  + F +   N    ++ VQ K    +LD NDN P F +  +  S+ ++   G K+      D D G+N   S RI+SG+   +  +   +   G   +       LD    + + ++++A D GHP   A   + V + + + + + P F +  Y   + ED  +     ++RA++     +  L Y L           +D KTG + L+  LD+E
Sbjct: 2138 FEVMENSKIGLQIGNLSGEESREFH--YRIQDPEASKIFSIDKFGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTL---NPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEHQGK---LGIDVKTGELTLKTHLDWE 2405          

HSP 11 Score: 68.5514 bits (166), Expect = 1.217e-10
Identity = 144/628 (22.93%), Postives = 256/628 (40.76%), Query Frame = 2
Query: 5303 YNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPVNSEIFYVLNPGHS-----HIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFR--VKENSVDGTFIGQIKMVNYCKDHSAKFSI-IDGVNHELVFLHESTGKIFVAAAAKIDREK---------IDKIILWTQ-VSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDANGDVKT-------NIPLNFHTKSVYDLVIKASSKASPFVFA--ECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDG--PDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFSSTAV-IEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFEL 7096
            Y+LK+I T S     G++  T+V + V N   +  +F  +    +V EN   G+ +  +        + + Y L    S     H  I+  TG +    PL  E++    LTI A      T +   T  + D+       ++P+          P +  P +P  K+ A D D    +TY         Q    ++ +  +SG LF+K    +    R+ + V  +DNGVPS  T+V + + + +     +   EKA FR  V ENS  G  IG     N   + S +F   I       +F  +  G++FVA    IDRE+         ID  ++ +Q V C         K  + V D +DN PVF+   +   L +       + ++   D D G N +V Y I   S  +  ++  N D  +       +  L+    + + ++++A     P   A  + ++++ + + +   P   +P   + +  +  VG+ + KI A +  G   DG+ Y ++  +       L +   +GE+ L   L           + V D    S  V ++I VE  +   P+  ++   + +  S   G  +  + AID+D   +G V + +
Sbjct: 1896 YSLKVIGTGS-----GQQIGTRVDVRVNNLNDNVPSFPMSK-PRRVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFDTFT-NLTIFVSDINDNAPTFSKPLYQTT----VSPATFSPGQPFAKIEAHDLDARGALTYSLG------QGSSSIFRVAPESGALFMKVLPPAGE--RYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIG-----NLSGEESREFHYRIQDPEASKIFSIDKFGRLFVAGP--IDREQRATHEFQVEIDNEMMTSQKVQC---------KCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRI--LSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEHQGK-----LGIDVKTGELTLKTHLDWESEPIISMYLSVSDGNGRSAVVPLKIVVEPVDEFAPVFTKSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSI 2481          

HSP 12 Score: 62.3882 bits (150), Expect = 9.061e-9
Identity = 146/604 (24.17%), Postives = 237/604 (39.24%), Query Frame = 2
Query: 2900 SSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLI--ISSLNIWNSNPSGIINLLVIVSDNG-PFKPLETEVEISVRIIDANNHSPI--LISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCP--LLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLI--TTKVSLSCAQNVKIRIFVSDLGFPKMTS----------SVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFP-ENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVG-FSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLKNLEVVYSIKQPE--KYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSD-GIFMINGDSGEIHL 4639
            S +G++    + SD D   NG  S+ +        +   ++ P TG L++  +SSL  W       I L V+  D+G P   +E  +EIS R       +P+  L  T +  I +    G  +  L        E   +  S+ + +    F ++    +  VIR  +LE      E  ++ +I T  G    + V   V N    N N P   M K  +      P  L  GS + TV A D D      +    + +       NID +TG I  T  +         + I  +D  F   T+          +  T  KPLY+            T + P    PG     +     +  GA    +   ++S+      R   +   L    L      Y + V      + S S+++ ++VI+        P F K   +F E+ EN   G  +   N+   ++ E  Y I+ PE  K F I+   G+L      DRE     +F VE+    +++ K+     +IV   DENDN P + +  +  + +         I QI+A+D DSG N +++Y+I   +D  I  +N D+G I L
Sbjct: 1741 SRVGDVLHRFRASDMDIGQNGKFSFELL----EDSSGSLDLVPETGDLVLRRLSSLQSWK------IKLRVV--DHGVPGLYVEKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKL------QPELAGLTYSIVEGNIDSAFSVD----SEGVIRT-NLELDREILERYSLKVIGTGSGQQIGTRVDVRVNNL---NDNVPSFPMSKPRR-----VPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFDTFTNLTIFVSDINDNAPTFSKPLYQ------------TTVSPATFSPGQPFAKIEAHDLDARGALTYSLGQGSSSI-----FRVAPESGALFMKVLPPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRF-EVMENSKIGLQIG--NLSGEESREFHYRIQDPEASKIFSIDKF-GRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIV--LDENDNLP-VFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQL 2289          

HSP 13 Score: 57.3806 bits (137), Expect = 2.751e-7
Identity = 45/156 (28.85%), Postives = 69/156 (44.23%), Query Frame = 2
Query:  494 IVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNS 961
            IV G+ +  F++D    S G+    L     LD EI+ +++L +     G    Q    V + V N NDNVP F +S+    + E+  +      V A D D       F   D++  +   F +D  TG ++L   LDFE    H ++I   D S
Sbjct: 1865 IVEGNIDSAFSVD----SEGVIRTNL----ELDREILERYSLKVIGTGSGQ---QIGTRVDVRVNNLNDNVPSFPMSKP-RRVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGS 2008          

HSP 14 Score: 55.0694 bits (131), Expect = 1.561e-6
Identity = 55/232 (23.71%), Postives = 107/232 (46.12%), Query Frame = 2
Query:  230 ISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTK------NVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSL 907
            I K TG I V   ID    +   F + + +G +        V   +LD     P+F    ++  IPE+ PIG+ + +  V +  +  NS + +R    + ++   +D    +       + ++++ D+E    +   + A +       ++ L+ I +++ NDN P F  + Y  +++E  +     L V A+D D+G  GE+ Y + + S S   F+++  TG V+ +K L
Sbjct:  485 IDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCL-VKVVANNSQCGNS-KRIRYSLQNQDEHLTVDTMSGT-------VCIQKTFDFEKQKSYQTTVIATNANSE--TSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSS---FSINPVTGEVFAQKPL 702          

HSP 15 Score: 53.5286 bits (127), Expect = 3.925e-6
Identity = 56/239 (23.43%), Postives = 102/239 (42.68%), Query Frame = 2
Query:  212 QEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKN----VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFE 916
            Q++   +   +G + +    D EKQ  Y   +I+ N +++     + I++ DVNDN P F    +  ++ E       + + +  D D G     S  I+S  S   F+I+      G  + +  L +        +F+LV+ A DGG    + S  + I V + +   P+F  S+Y     ED    I    V       G   ++ Y + +     + F++D  TG +Y+ + LD +
Sbjct:  582 QDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSS--FSIN---PVTGEVFAQKPLARG-------RFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSV-------GAMSKVKYSIYSGDQDHN-FSIDEDTGKIYVTRYLDAD 800          

HSP 16 Score: 53.1434 bits (126), Expect = 5.725e-6
Identity = 90/433 (20.79%), Postives = 176/433 (40.65%), Query Frame = 2
Query: 5945 HFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFS--IIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPV-FSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPK--ISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLS-SSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAI 7225
            H L +I++D G  +   TV + ++   D++        +   + E+S  G  + + +  +     + KFS  +++  +  L  + E TG + +   + +   KI   ++   V   G  +    ++       +   P+ F +  +++ ++EG P    + +L    P++   + + Y I   +    F +D+ G ++TN+ L+      Y L +  +           R+ V + N+ND  P   +S P R   +  N  VGS++  + AKD D    + Y +            N+   +G I L+  L    + +H   I   D  F +   + I V D N++ P   +      +S ++   G     + A D D R  G +T+ L   S    +      + ALF+   P   G  Y + +  TDN +
Sbjct: 1695 HLLIIILTDGGSRNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLEDSSGSLDLVPE-TGDLVLRRLSSLQSWKIKLRVVDHGVP--GLYVEKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKL---QPEL---AGLTYSIVEGNIDSAFSVDSEGVIRTNLELDREILERYSLKVIGTGSGQQI---GTRVDVRVNNLNDNVPSFPMSKPRR---VPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDAR--GALTYSLGQGSS--SIFRVAPESGALFMKVLP-PAGERYLVTVTATDNGV 2107          
BLAST of Dachsous vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 110.538 bits (275), Expect = 2.042e-23
Identity = 184/772 (23.83%), Postives = 326/772 (42.23%), Query Frame = 2
Query: 2681 SQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTV----QLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILIST--NVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVK--IRIFVSDLGFPKMTSS--VDTLLKPLYE--PKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLF-ISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIR---RLKNLEVVYSIKQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDG----IFMINGDSGEIHLVSS---PRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVD 4927
            S+  +  ++ + +G+I L K  DRE +   ++ V    ++   I ++T  +   +   +++  + K+S      ED + +G     +   D DS  NG + Y +         N   IN  +G   +I +    +     +I L VI SD G  K  E+   + + ++D N+++P+  S   NV  +    +    + T+   DED G NG++  S+          I+  S     +R    E I++   P+  ++ A D   P+ SS + L IN I+ N + P ++  +  K +     +  G E+  V A+D D G N I  YS+E    +ED I ID  +GLI T   L      +  +++   D+G P + +S  +  +LK + +  P  ++   N  ++  +P  SQ    +  L     +   K  + I      V   L +     Q  +L  +  +K   + + V  +  +   +     +NV ++ V  S P F+ D P  ++I E+ P G  V +       R  N  +VYSI    ++F I+P +G +      DRE  ++  F V V A+  ++P + T   + V + D NDN P   S SS    IS       S  Q+ A DAD GPN  + Y +N SS      +F ++  SG + + S     + +   L +  RD G    S +   ++    +   +                 S  G  +G +         N DI + +  G  A++F ++
Sbjct:  207 SRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIRED-APIGTTVLSVFARDLDSGENGEIEYSLG---EGNGKNLLAINAKSG---VIQTAAPLDRETLSLIRLDVIASDKGTPK-RESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAV-IATVKATDEDFGTNGKVHYSMASSSGIGGLTID-YSTGEVTLR----ERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQ--KMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME---GSEDFI-IDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQ----IITLKAVDNDEDQKITYRIEEADREVFSILDI---GDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFN-DHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS-SQFFRIDPSSGDISVSSDLDRE--DRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTS-SSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPT--FEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIE 943          

HSP 2 Score: 107.071 bits (266), Expect = 2.684e-22
Identity = 175/813 (21.53%), Postives = 340/813 (41.82%), Query Frame = 2
Query: 4826 IIGQLSYSQTSSSGNLDIRYYLIA---GKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAI-TNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKL-SCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVI-IFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPP--VNSEIFYVL--NPGHSHIQINTTTGELRTNGPLHLE---LVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQP-IPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSN--ITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAI-FRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLID-ANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDGI-SYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVV--------DDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEPQEK 7180
            II  +  S  SS     + Y ++A    +   +F++D ++G ++   S+ RE + +  I+++    +   D +I     + +++    +N P F +  +  ++ ED  I T  L+V A D D G  G I YSL        + I+  +G + + +PL+    ++  L +IA+D     T +++ T ++ I V +   +   F +  +++ +LEN     V+  +         N ++ Y +  + G   + I+ +TGE+     +  +   +   I     A     ST  +      I+     +   Q  I  E  V I         + + ++ A D D   N  I Y  + S+         +++D  SG +     +      R+ LKV   D G PS  T+  I + L   +       +K     + E    G+ I  +K V+  +D    + I +        L        ++ + ++ R+     +  +    GG + R    V I   +   + P F+ + F   + E  P   PVI L   D D G N+++ Y I+   S + F ID ++GD+  +  L+   ++ + +++ AS  ASP +    ++ V + +IND  P+ +  +    +  + PVG+   +++A D+D GP+GI  Y +     +       +   SG + +S KL      + +F ++V             S+ + I + + D N++ P  ++    + ++ +   GS +  + A D D  DN  ++F           R F    A LF I+E  E+
Sbjct:  183 IIASVKASHASSQ---PLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDRE-VLDKHILKVTAYERV--DPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDK---GTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAI--------GEEVGRVYAIDEDSGPNGIIKYSMEGSED--------FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVN---SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSID---SSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKL-----DREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISF-----------RIFGGADAKLFDIEEDAEQ 948          

HSP 3 Score: 105.916 bits (263), Expect = 5.342e-22
Identity = 147/610 (24.10%), Postives = 275/610 (45.08%), Query Frame = 2
Query: 5873 MYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVP--SKCTTVLIDISLNQDHQYVQIVPEKAIF-RVKENSVDGTFIGQI--KMVNYCKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVI-IHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLID-ANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDA---RFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTS-PWFGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLD-SDKA-IFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKEN-KGPNLIDNKY-ITLSLQVP 7654
            ++ LD  SG + L  SM   +  +H LKV   +   P  S  TTV++ +   QD+    I  + + F  ++E++  GT +  +  + ++  ++   ++S+ +G    L+ ++  +G   +  AA +DRE +  I L    S  G+  R    ++ I V DV+DN PVF+ + +   + E       +  +   D D G N +V Y +   S      ID + G+V     ++     +   VI+A   A P + +   LT+ +++IND  P +    + + L+ N  +G  + ++ A D D GP+GI   I++    ++   ++   DSG I  ++ L      ++   +   D      +++  I + ++D N++ P   +    + +S  + RGS+I+ L A+D D  ++ K+T+ +       F +    +  A L +  E + + H   + I  TD      + ++++F   V       YF     +H   + IPE    G  +     +D D  D A I Y ID+    S    +D  SGD+ ++  L+   +  F +IVT +   SP   TS  + V ++  N   P    + Y  T+S  +P
Sbjct:  212 LFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNS--PIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSG--VIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPIT-AVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGI---IKYSMEGSEDFIIDE--DSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDV---NSAPYF----NDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS----SQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIP 798          

HSP 4 Score: 105.531 bits (262), Expect = 8.059e-22
Identity = 84/252 (33.33%), Postives = 124/252 (49.21%), Query Frame = 2
Query:  230 ISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKN---VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIV-SGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLD--NTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            I     ++ VSG + R+   +   +  +  G  +    V + I DVN + P FN   F   IPE+ PIG  V      D D G N+    RIV S DS + F ID    S+G   V       LD E  + F++++ A D   PPL  S  +++I+ + NDN P+F  S Y A+I ED  +  +FL+V A D D G +G + YFL+  ++SPS   F +D  +G + +   LD E+     + I  RD   P
Sbjct:  631 IGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNA----RIVYSIDSSQFFRID---PSSGDISV----SSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTP 870          

HSP 5 Score: 104.76 bits (260), Expect = 1.109e-21
Identity = 200/877 (22.81%), Postives = 370/877 (42.19%), Query Frame = 2
Query: 4520 IFQIVATDADSGPNSKLTYQI----NPSSDGIFMINGDSGEIHLVSS---PRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFL-TVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPV--NSEIFYVLNPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSD-NGVPSKCTT-VLIDISLNQ-----DHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVF-LHESTGKIFVAAAAKIDRE-KIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQ---EEFLID-ANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSD------VGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKD 7063
            I  + A+ A S P   L Y +    +  S  +F ++  SGEI L  S     +  + L VT  +  +   S S    +H   ++  S I               +  G  +  +      S  N +I Y L  G    + +++  +G +QT   + RE +    ++++ V+              + I +   N+N P F+   + V + E+  I   + TV A D D G  G++ YS+   +    + ID STG+++       + +     I A D  G          + I V +   H     A    + + EN   G  +GR+  +      N  I Y +  G     I+  +G ++T   L  E      L +   A+ + T S+  TS  I V + DINDN P   +    + I         +  L A D+D+   ITY+ + +D    ++  +    G  G +   S  L     +  +++  +D  G+  +C   V ID  +N      DH +   +P        E+S  G  +  +K  ++ +  +A+  I+  ++    F +  S+G I V  ++ +DRE +    ++ T        +    ++ + +DD++DN P F+ + + A ++E  P  T  ++++  D DIG N  V+YF+   SS    + F +D  +G ++ +  L+    +V  L I A  + +P + A   +T+ + ++ND  P     + +L +  N PVGS +  I A+D+D  D      R     +  LF ++  D+ +  + R L  ++        K  F++     + SST  + I V D N++ P LK+   ++N   +++   +I ++ A D D
Sbjct:  184 IASVKASHASSQP---LYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPI--FEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLS---LIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAVIRAKD--GAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME-GSEDFIIDEDSGLIKTTKLLDRETTARYSLKVT--ARDMGTPSLN-TSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDI----GDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFID-DVNSAPYFNDHPFSVKIP--------EHSPIGYPVITLKAEDHDRGDNAR--IVYSIDSSQFFRIDPSSGDISV--SSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLF-DIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPD 1028          

HSP 6 Score: 102.064 bits (253), Expect = 8.100e-21
Identity = 119/481 (24.74%), Postives = 218/481 (45.32%), Query Frame = 2
Query: 6020 NQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSII---DGVNHELVFLHESTGKIFVAAAAKIDREKIDKIIL-WTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTL-FLNVAFDSGEIFLSRKLLVSDVGKHEFDIVV---DDAR--FSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAAL---FLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKAIFYKID 7420
            N D   V    EK +  + E++   T I  +K  ++       +S++   D  +  L  L   +G+I +A +  +DRE +DK IL  T        I     V++HV DV DN P+F ++ +   + E  P  T V+ +   D D G N ++EY +   + +    I+A +G ++T  PL+  T S+  L + AS K +P   +   + + +V++ND  P  +  + N+ +  N  + + I  + A D D   G + ++ +   ++  +  L + + +GE+ L  ++   D        V+   D A+   SST  + I+V D N+H P L    ++I L  ++  G ++  ++AID+D   NG + + +  +  +      D ++  +    L+D  +E    Y L +   D        L +   + V+LK      P         +TI E +  GS+I      D D D+ I Y+I+
Sbjct:  157 NPDANAVHFQQEKYVKELPEDTPIETIIASVK-ASHASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKS--MDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDF--GTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERI---DAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFI----IDEDSGLIKTTKLLD--RETTARYSLKVTARDMGT---PSLNTSTTIAVVLKDINDNAPTF-DKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIE 619          

HSP 7 Score: 98.2117 bits (243), Expect = 1.047e-19
Identity = 111/418 (26.56%), Postives = 187/418 (44.74%), Query Frame = 2
Query:  119 IFSIKENVPIGEVVGQI----ESPGFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKN------VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDN-SPPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDAISTSFDLEILNRS----PFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHE 1327
            + +++ENV IGE VG++    E  G +   +      + FII + +G+IK + L+DRE    YS  + + +  T +      + + + D+NDN P F+   +  +I E  P GS++      D DE +    + RI   D E VF+I        I  V   LK+  D+++     + I A D G   LQ   +V + + + N + P F+   +   I E   I    + ++A D+D G +  + Y +D    SS FF +D  +G++ +   LD E   +  + +   D+ SPP +TS     I+VI  + N  S Q   +   + I+ DI   T    V   D D          LN S      QL ++      L++ + +   +   I L + A D   PSLS    +T+ + +
Sbjct:  485 MITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKI--TYRIEEADRE-VFSILDIGDQGAILSVSGELKRQ-DHKV----RVEISATDQGG--LQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSID----SSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTS---TQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSD 884          

HSP 8 Score: 94.7449 bits (234), Expect = 1.460e-18
Identity = 82/298 (27.52%), Postives = 142/298 (47.65%), Query Frame = 2
Query:  128 IKENVPIGEVVGQIE-SPGFSPP--FEMHDFQEKK----FIISKTTGVIKVSGLIDRE-------KQNLYSFLIISMNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTS 979
            + E+ PI  ++  ++ S   S P  + M   Q+ +    F +   +G I+++  +DRE       K   Y  +  +++  T  V + +LDV DN P F   ++   I E+ PIG+ V      D D G+N      +  G+ + + AI+   + +G+          LD E +S   L + A D G P  +++ +V+I V + NDN P F    Y  +I E+  I      V+ATD D G +G++ Y + ++S      T+D+ TG V LR+ +D + S    + I  +D + P  +S
Sbjct:  174 LPEDTPIETIIASVKASHASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISAST-TVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAIN---AKSGVIQT----AAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGG-LTIDYSTGEVTLRERIDAKNSPITAV-IRAKDGAQPALSS 461          

HSP 9 Score: 90.1225 bits (222), Expect = 3.095e-17
Identity = 179/801 (22.35%), Postives = 343/801 (42.82%), Query Frame = 2
Query: 2327 IGQVSMDSSCTESVSYDLFGVKNDHSH--FTIDVATGVIY---GKDLGSISNKTLMFQVSAKAPKSQTSFAQVIIYIED-GIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSD----EYQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVSYL---VVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTN-VFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELA-------IDNEDQINIDSWTGLITTKVSLSCAQNVKIRIFVSDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFD-SQQLILLKDNLNVKN-VHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGS---HVASFNIRRLKNLEVVYSIKQPE-----KYFVINPVTGQLVTFRMFDRETENQIQFYVEVI---ATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDG-IFMINGDS 4624
            I  V    + ++ + Y +   ++  S   FT+D  +G I      D   +    L      +   + ++   V++++ D   + P F+       I E+  +G  ++ VF +     +    EY + +    + L+I++K+G I      DRE +S +   V+          +T  + + ++D+NDN P   +   N T  +  ++  +   +K +D D   NG + Y M     +G      I+ +TG + +   ++  NS  + +I      + +G    L + V +++ +ID N+H+P LI+   +  + +    G EVG +   DED G NG I+ S++     + F I++ S      ++   ET   Y    ++ + A D G+PS ++   + +   + N N P     K+   +     +  GS+I T+ AVD D+  +    Y IE A       +D  DQ  I S +G +  +        V++ I  +D G  +    V+  +  +    S  +  +   +  IP+HS  GY V  L     + G     +     S+D     R D S   I +  +L+ ++   +S+ V  +      ++++  I VI++ +  + P F+  S     I E++P G+    V++ +     N  V Y + +       + F ++  +G L      DRE     QF V V+   A     P +     + + ++D NDN P     S  +  I+  +   +++  IVA DAD G N+ ++++I   +D  +F I  D+
Sbjct:  184 IASVKASHASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIG---GLTIDYSTGEVTLRERIDAKNSPITAVIR-----AKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGS---EDFIIDEDSGLIKTTKLLDRETTARY----SLKVTARDMGTPSLNTSTTIAVVLKDINDNAP--TFDKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQ-----DHKVRVEISATDQGGLQGRCVVNVFIDDV---NSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIV----YSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSS-YAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDRE-----QFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLY-IAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDA 946          

HSP 10 Score: 89.7373 bits (221), Expect = 4.329e-17
Identity = 81/305 (26.56%), Postives = 141/305 (46.23%), Query Frame = 2
Query:  128 IKENVPIGEVV-------------GQIESPGFSPPFEMHDFQEKKFI-ISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKN------VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD-NSPPFHTS 979
            I+E+ PIG  V             G+IE       + + +   K  + I+  +GVI+ +  +DRE  +L    +I+ +  T        V+I ++DVNDN P F + ++  +I EN  I + +      D D G N      + S        IDY   S G     + L++ +D +  S    VI+A DG  P L +++ + I V + ND+ P    ++ + +++E+  I     RV A D D+G +G + Y ++     S+ F +D  +G +   K LD E +  + + +  RD  +P  +TS
Sbjct:  279 IREDAPIGTTVLSVFARDLDSGENGEIE-------YSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDY---STG----EVTLRERIDAKN-SPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEG----SEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTS 564          

HSP 11 Score: 89.3521 bits (220), Expect = 5.955e-17
Identity = 109/451 (24.17%), Postives = 198/451 (43.90%), Query Frame = 2
Query: 6356 FSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFI----EFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDA---RFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDS--DKAIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKY--ITLSLQVPEMIQ 7666
            F Q K+V  L E  P +T +  +         +SQ  Y+     +   SQ  F +D  +G+++    ++      + L + A  +  P + A   + V+++++ D  P     +   ++  + P+G+ +  + A+D D G +G I Y +      N    L +   SG I  +  L    +     D++  D    +  STA++EI V D N++ P+   +   + +  ++   + I  + A D+D   NGKV + + S+S   GL   D +T  + L +    K  P    I+  D A   Q  L S   LT+ +     + P LI      IT+ E++  G ++ +    D DS  +  I Y ++     S +  +D +SG +  TK L+     R+ L VT   +G+P   TS  ++V ++  N      D K   +T+S ++P   Q
Sbjct:  165 FQQEKYVKELPEDTPIETIIASVKASHA----SSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKN---LLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLT-IDYSTGEVTLRERIDAKNSPITAVIRAKDGA---QPALSSTVPLTINVIDINDHAPTLIAAQKM-ITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEG----SEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQ 599          

HSP 12 Score: 84.7297 bits (208), Expect = 1.420e-15
Identity = 55/171 (32.16%), Postives = 87/171 (50.88%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDT------KNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEI-ISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKF 715
            F + +T+G ++VS  +DRE+  +    I + +  T        + + + DVNDN P F   +++  I EN P+GS V      D DEG N+  S RI  G   K+F I+     NG+  VR++ +   DYE   ++F   +QA  G    L +++ V+I V + NDN P  
Sbjct:  835 FRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGV--VRILTRAEFDYEAKANKFFFELQASSG---QLSSTVPVRIHVSDVNDNKPAL 1000          

HSP 13 Score: 67.781 bits (164), Expect = 2.135e-10
Identity = 46/155 (29.68%), Postives = 74/155 (47.74%), Query Frame = 2
Query:  335 VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDND 799
            + I ++D+ND+ P   A     ++ EN  IG +V      D D G N I      S +  + F ID  + S  I   +L     LD E  ++++L + A D G P L  S  + +++++ NDN P FD   Y  +I E+       + ++A DND
Sbjct:  465 LTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKY---SMEGSEDFIID--EDSGLIKTTKL-----LDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND 609          

HSP 14 Score: 63.1586 bits (152), Expect = 4.300e-9
Identity = 125/540 (23.15%), Postives = 213/540 (39.44%), Query Frame = 2
Query:  371 PKFNATNFE-----KSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSKXXXXXXXXXX-------XXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYD-AISTSFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKI-----HESILFENSFSHSRFQVEIDSTILNENQHVTFVKTTKRLPTKPIFIFKIFVLNNL-FKINETTGEILSKRSID---CGKYFFNVSMLSLKTNSLIDQTKLEIVVKSGRKLPLYFDRGFRKILVTT---GKSQCFSEIAVRNRHCGMRIQYSYDLLLKTD-GILRINEHGALCTAENVKHNKLMSTRYLYQIKALDETNSSAVCVV 1912
            P  NA +F+     K +PE+ PI + +                 V      S+ +F +D            + L +S+D E++ +  L + A +   P + AS  V + V +  DN P F+   Y   I+ED  I  T L V A D D+G +GE+ Y L   +   +   ++ K+G +     LD E      + +   D   P   S   V I V+D+         +  ++ IL          +I+   ++A VK TD D   +      + + S    + I     E+ L   I + K++ I   ++A D  +P+LS+T  LTI +     H   L     +     +E +  I  E   V  +       + P  I K  +  +  F I+E +G I + + +D     +Y   V+   + T SL   T + +V+K        FD+    + ++      SQ  +  AV N     +I Y  +   +    IL I + GA+ +       K    +   +I A D+      CVV
Sbjct:  158 PDANAVHFQQEKYVKELPEDTPIETIIASVKASHASSQPLYYSMVAPQDSRSQNLFTLDTMSG-------EIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGN-GKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTIL---------ENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERI-DAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIA---AQKMITLEENVAIGEEVGRVYAIDED----SGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE-DQKITYRIEEADREVFSILDIGDQGAILSVSG--ELKRQDHKVRVEISATDQGGLQGRCVV 669          
BLAST of Dachsous vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 105.531 bits (262), Expect = 6.685e-22
Identity = 84/252 (33.33%), Postives = 124/252 (49.21%), Query Frame = 2
Query:  230 ISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKN---VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIV-SGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLD--NTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            I     ++ VSG + R+   +   +  +  G  +    V + I DVN + P FN   F   IPE+ PIG  V      D D G N+    RIV S DS + F ID    S+G   V       LD E  + F++++ A D   PPL  S  +++I+ + NDN P+F  S Y A+I ED  +  +FL+V A D D G +G + YFL+  ++SPS   F +D  +G + +   LD E+     + I  RD   P
Sbjct:  272 IGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNA----RIVYSIDSSQFFRID---PSSGDISV----SSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTP 511          

HSP 2 Score: 102.064 bits (253), Expect = 8.878e-21
Identity = 131/529 (24.76%), Postives = 224/529 (42.34%), Query Frame = 2
Query: 3392 ETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVK--IRIFVSDLGFPKMTSS--VDTLLKPLYE--PKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLF-ISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIR---RLKNLEVVYSIKQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDG----IFMINGDSGEIHLVSS---PRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVD 4927
            E I++   P+  ++ A D   P+ SS + L IN I+ N + P ++  +  K +     +  G E+  V A+D D G N I  YS+E    +ED I ID  +GLI T   L      +  +++   D+G P + +S  +  +LK + +  P  ++   N  ++  +P  SQ    +  L     +   K  + I      V   L +     Q  +L  +  +K   + + V  +  +   +     +NV ++ V  S P F+ D P  ++I E+ P G  V +       R  N  +VYSI    ++F I+P +G +      DRE  ++  F V V A+  ++P + T   + V + D NDN P   S SS    IS       S  Q+ A DAD GPN  + Y +N SS      +F ++  SG + + S     + +   L +  RD G    S +   ++    +   +                 S  G  +G +         N DI + +  G  A++F ++
Sbjct:   77 ERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQ--KMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME---GSEDFI-IDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQ----IITLKAVDNDEDQKITYRIEEADREVFSILDI---GDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFN-DHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS-SQFFRIDPSSGDISVSSDLDRE--DRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTS-SSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPT--FEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIE 584          

HSP 3 Score: 98.5969 bits (244), Expect = 8.012e-20
Identity = 111/418 (26.56%), Postives = 186/418 (44.50%), Query Frame = 2
Query:  119 IFSIKENVPIGEVVGQI----ESPGFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDT------KNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDN-SPPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDAISTSFDLEILNRS----PFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHE 1327
            + +++ENV IGE VG++    E  G +   +      + FII + +G+IK + L+DRE    YS  + + +  T        + + + D+NDN P F+   +  +I E  P GS++      D DE +    + RI   D E VF+I        I  V   LK+  D+++     + I A D G   LQ   +V + + + N + P F+   +   I E   I    + ++A D+D G +  + Y +D    SS FF +D  +G++ +   LD E   +  + +   D+ SPP +TS     I+VI  + N  S Q   +   + I+ DI   T    V   D D          LN S      QL ++      L++ + +   +   I L + A D   PSLS    +T+ + +
Sbjct:  126 MITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKI--TYRIEEADRE-VFSILDIGDQGAILSVSGELKRQ-DHKV----RVEISATDQGG--LQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSID----SSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTS---TQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSD 525          

HSP 4 Score: 94.3597 bits (233), Expect = 1.867e-18
Identity = 163/684 (23.83%), Postives = 300/684 (43.86%), Query Frame = 2
Query: 5078 NENPPRFSRSIFKVKLPEDEAITNFL-TVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPV--NSEIFYVLNPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSD-NGVPSKCTT-VLIDISLNQ-----DHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVF-LHESTGKIFVAAAAKIDRE-KIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQ---EEFLID-ANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSD------VGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKD 7063
            N+N P F+   + V + E+  I   + TV A D D G  G++ YS+   +    + ID STG+++       + +     I A D  G          + I V +   H     A    + + EN   G  +GR+  +      N  I Y +  G     I+  +G ++T   L  E      L +   A+ + T S+  TS  I V + DINDN P   +    + I         +  L A D+D+   ITY+ + +D    ++  +    G  G +   S  L     +  +++  +D  G+  +C   V ID  +N      DH +   +P        E+S  G  +  +K  ++ +  +A+  I+  ++    F +  S+G I V  ++ +DRE +    ++ T        +    ++ + +DD++DN P F+ + + A ++E  P  T  ++++  D DIG N  V+YF+   SS    + F +D  +G ++ +  L+    +V  L I A  + +P + A   +T+ + ++ND  P     + +L +  N PVGS +  I A+D+D  D      R     +  LF ++  D+ +  + R L  ++        K  F++     + SST  + I V D N++ P LK+   ++N   +++   +I ++ A D D
Sbjct:   10 NDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAVIRAKD--GAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME-GSEDFIIDEDSGLIKTTKLLDRETTARYSLKVT--ARDMGTPSLN-TSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDI----GDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFID-DVNSAPYFNDHPFSVKIP--------EHSPIGYPVITLKAEDHDRGDNAR--IVYSIDSSQFFRIDPSSGDISV--SSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLF-DIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPD 669          

HSP 5 Score: 91.2781 bits (225), Expect = 1.448e-17
Identity = 105/447 (23.49%), Postives = 196/447 (43.85%), Query Frame = 2
Query: 6344 NKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLID-ANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDA---RFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFEL-VSTSPWFGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLD-SDKA-IFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKEN-KGPNLIDNKY-ITLSLQVP 7654
            N PVF+ + +   + E       +  +   D D G N +V Y +   S      ID + G+V     ++     +   VI+A   A P + +   LT+ +++IND  P +    + + L+ N  +G  + ++ A D D GP+GI   I++    ++   ++   DSG I  ++ L      ++   +   D      +++  I + ++D N++ P   +    + +S  + RGS+I+ L A+D D  ++ K+T+ +  +    F +    +  A L +  E + + H   + I  TD      + ++++F   V       YF     +H   + IPE    G  +     +D D  D A I Y ID+    S    +D  SGD+ ++  L+   +  F +IVT +   SP   TS  + V ++  N   P    + Y  T+S  +P
Sbjct:   12 NAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPIT-AVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGI---IKYSMEGSEDFIIDE--DSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDV---NSAPYF----NDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS----SQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIP 439          

HSP 6 Score: 86.2705 bits (212), Expect = 4.564e-16
Identity = 100/447 (22.37%), Postives = 190/447 (42.51%), Query Frame = 2
Query: 5876 YLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAI-FRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLID-ANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDGI-SYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVV--------DDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEPQEK 7180
            +++D  SG +     +      R+ LKV   D G PS  T+  I + L   +       +K     + E    G+ I  +K V+  +D    + I +        L        ++ + ++ R+     +  +    GG + R    V I   +   + P F+ + F   + E  P   PVI L   D D G N+++ Y I+   S + F ID ++GD+  +  L+   ++ + +++ AS  ASP +    ++ V + +IND  P+ +  +    +  + PVG+   +++A D+D GP+GI  Y +     +       +   SG + +S KL      + +F ++V             S+ + I + + D N++ P  ++    + ++ +   GS +  + A D D  DN  ++F           R F    A LF I+E  E+
Sbjct:  165 FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVN---SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSID---SSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKL-----DREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISF-----------RIFGGADAKLFDIEEDAEQ 589          

HSP 7 Score: 85.1149 bits (209), Expect = 1.102e-15
Identity = 55/171 (32.16%), Postives = 87/171 (50.88%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDT------KNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEI-ISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKF 715
            F + +T+G ++VS  +DRE+  +    I + +  T        + + + DVNDN P F   +++  I EN P+GS V      D DEG N+  S RI  G   K+F I+     NG+  VR++ +   DYE   ++F   +QA  G    L +++ V+I V + NDN P  
Sbjct:  476 FRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGV--VRILTRAEFDYEAKANKFFFELQASSG---QLSSTVPVRIHVSDVNDNKPAL 641          

HSP 8 Score: 78.9518 bits (193), Expect = 8.312e-14
Identity = 139/588 (23.64%), Postives = 255/588 (43.37%), Query Frame = 2
Query: 2927 LKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTN-VFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELA-------IDNEDQINIDSWTGLITTKVSLSCAQNVKIRIFVSDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFD-SQQLILLKDNLNVKN-VHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGS---HVASFNIRRLKNLEVVYSIKQPE-----KYFVINPVTGQLVTFRMFDRETENQIQFYVEVI---ATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDG-IFMINGDS 4624
            +K +D D   NG + Y M     +G      I+ +TG + +   ++  NS  + +I      + +G    L + V +++ +ID N+H+P LI+   +  + +    G EVG +   DED G NG I+ S++       F I++ S      ++   ET   Y    ++ + A D G+PS ++   + +   + N N P     K+   +     +  GS+I T+ AVD D+  +    Y IE A       +D  DQ  I S +G +  +        V++ I  +D G  +    V+  +  +    S  +  +   +  IP+HS  GY V  L     + G     +     S+D     R D S   I +  +L+ ++   +S+ V  +      ++++  I VI++ +  + P F+  S     I E++P G+    V++ +     N  V Y + +       + F ++  +G L      DRE     QF V V+   A     P +     + + ++D NDN P     S  +  I+  +   +++  IVA DAD G N+ ++++I   +D  +F I  D+
Sbjct:   38 VKATDEDFGTNGKVHYSMASSSGIG---GLTIDYSTGEVTLRERIDAKNSPITAVIR-----AKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED---FIIDEDSGLIKTTKLLDRETTARY----SLKVTARDMGTPSLNTSTTIAVVLKDINDNAP--TFDKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQ-----DHKVRVEISATDQGGLQGRCVVNVFIDDV---NSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIV----YSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYA-ATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDRE-----QFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLY-IAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDA 587          

HSP 9 Score: 77.7962 bits (190), Expect = 1.908e-13
Identity = 61/216 (28.24%), Postives = 105/216 (48.61%), Query Frame = 2
Query:  335 VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD-NSPPFHTS 979
            V+I ++DVNDN P F + ++  +I EN  I + +      D D G N      + S        IDY   S G     + L++ +D +  S    VI+A DG  P L +++ + I V + ND+ P    ++ + +++E+  I     RV A D D+G +G + Y ++     S+ F +D  +G +   K LD E +  + + +  RD  +P  +TS
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDY---STG----EVTLRERIDAKN-SPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEG----SEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTS 205          

HSP 10 Score: 75.485 bits (184), Expect = 7.949e-13
Identity = 105/451 (23.28%), Postives = 194/451 (43.02%), Query Frame = 2
Query: 4169 KFLEIKENLPSGSHVA---SFNIRRLKNLEVVYSIKQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMIN--GDSGEIHLVSSP-RVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQ-RIFINIDYGNENPPRFSRSIFKVKLPEDEAI-TNFLTVVANDPDLGIFGRIIYSLEGDTFDKKI---FIDPSTGKLSCSP-LNFMEKNIYNLKIIATD--SEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRI 5479
            K + ++EN+  G  V    + +     N  + YS++  E  F+I+  +G + T ++ DRET    ++ ++V A  +  P + T   + V + D NDN P         V IS      + I  + A D D   + K+TY+I  +   +F I   GD G I  VS   +   +++ V +  + +       V ++    + +     + ++          S  G+ +  L         N  I Y + + +F   F +DP +G +     + RE+     +    +V  S H +   +   +I + +D  N+N P+F+ S +   + ED  + T+FL V A D D+G  G + Y L   +    I    +D ++G L  S  L+  +  +  L I A D  +  LS      +++ + + +   +   F    + L + ENSP G+ +G I
Sbjct:  125 KMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED-FIIDEDSGLIKTTKLLDRET--TARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAP-TFDKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNSAP---YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQF---FRIDPSSGDISVSSDLDREDRATFSV----IVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAA----SEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTI 555          

HSP 11 Score: 67.781 bits (164), Expect = 1.740e-10
Identity = 46/153 (30.07%), Postives = 73/153 (47.71%), Query Frame = 2
Query:  341 IKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDND 799
            I ++D+ND+ P   A     ++ EN  IG +V      D D G N I      S +  + F ID  + S  I   +L     LD E  ++++L + A D G P L  S  + +++++ NDN P FD   Y  +I E+       + ++A DND
Sbjct:  108 INVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKY---SMEGSEDFIID--EDSGLIKTTKL-----LDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND 250          

HSP 12 Score: 65.0846 bits (157), Expect = 1.219e-9
Identity = 74/284 (26.06%), Postives = 127/284 (44.72%), Query Frame = 2
Query: 6932 VIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDS--DKAIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKY--ITLSLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYD 7771
            ++EI V D N++ P+   +   + +  ++   + I  + A D+D   NGKV + + S+S   GL   D +T  + L +    K  P    I+  D A   Q  L S   LT+ +     + P LI      IT+ E++  G ++ +    D DS  +  I Y ++     S +  +D +SG +  TK L+     R+ L VT   +G+P   TS  ++V ++  N      D K   +T+S ++P   Q    I  L  +D +  +   Y I  A  +  +I D
Sbjct:    1 MVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLT-IDYSTGEVTLRERIDAKNSPITAVIRAKDGA---QPALSSTVPLTINVIDINDHAPTLIAAQKM-ITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEG----SEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQ----IITLKAVDNDEDQKITYRIEEADREVFSILD 271          

HSP 13 Score: 52.373 bits (124), Expect = 7.784e-6
Identity = 62/272 (22.79%), Postives = 120/272 (44.12%), Query Frame = 2
Query: 6632 VYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLF-LNVAFDSGEIFLSRKLLVSDVGKHEFDIVV---DDAR--FSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAAL---FLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKAIFYKID 7420
            + +V++ND  P  +  + N+ +  N  + + I  + A D D   G + ++ +   ++  +  L + + +GE+ L  ++   D        V+   D A+   SST  + I+V D N+H P L    ++I L  ++  G ++  ++AID+D   NG + + +  +  +      D ++  +    L+D  +E    Y L +   D        L +   + V+LK      P         +TI E +  GS+I      D D D+ I Y+I+
Sbjct:    4 ITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDF--GTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERI---DAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFI----IDEDSGLIKTTKLLD--RETTARYSLKVTARDMGT---PSLNTSTTIAVVLKDINDNAPTF-DKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIE 260          
BLAST of Dachsous vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 96.6709 bits (239), Expect = 3.389e-19
Identity = 83/311 (26.69%), Postives = 136/311 (43.73%), Query Frame = 2
Query:  113 LLIFSIKENVPIGEVVGQ------IESPGFSP-PFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNG---DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYH------------DSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDA----GVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            LL  SI EN+P  E   Q       E   F    F M D     F I    GV+ V   +D E    ++  +++ +G   D   + + ++D NDN P F  + +   + E+  IG +               +   R   GD  +   I+Y+            ++  GI    L L + LD+E +S   L + A D G PPL+    V+I V + NDN PKF+  +Y+  +KE+ +     L V+A D D+     VS EL    + T+ +       +  G+V + +S+D+EK K +++ +  +D   P
Sbjct: 3015 LLKVSIDENLPTSEDARQYITRIVAEDADFDEIKFRMVDDFGGLFQIDDINGVVTVVKPLDSEILGFFNLTVVASDGEFEDKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYE---------------LAHFRASGGDQNET--IEYYLKPSDVTSFVNLNAQTGI----LTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRP 3304          

HSP 2 Score: 92.8189 bits (229), Expect = 6.052e-18
Identity = 83/268 (30.97%), Postives = 128/268 (47.76%), Query Frame = 2
Query:  194 FEMHDFQEKKFIIS--KTTGVIKVSGLIDREKQNLYSFLIIS------MNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKV-FAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQAS--LLVKIIVQNANDNVPKFDISRYIASIKEDQEIN--ITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDN 958
            F + + QEK  +IS    TG++K+   +DRE Q++++F II+      M     N+ I + DVNDN PK    +    IPE+ P G+ V     FD D G+NS     +   +SEKV F ID+H   +G  ++    +  LDY     FNL I+  D G P L  S  L V+++    N    +FD     AS+ E+ EI   +  +  + T ++  V  E   +          F++D K G V     LD E   ++ I++  RD+
Sbjct:  757 FSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLL---NSEKVPFRIDHH---SGCIFIHA-PEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPHFSIDQK-GTVRTTHLLDRETKSAYWITVEARDS 1016          

HSP 3 Score: 87.8113 bits (216), Expect = 1.894e-16
Identity = 66/251 (26.29%), Postives = 121/251 (48.21%), Query Frame = 2
Query:  230 ISKTTGVIKVSGLIDREKQNLYSFLIISMNGDT------KNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDE---GKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD 955
            ++  TG++ ++  +D E  +     +++ +           V+I ++D NDN PKF    +   + EN   G KV      D D    G  S + + IVS  +     + +  +SNG     +++ QS+DYE I ++NL + A DGG PPL++  L++I V++ ND+ P FD     A ++E + I    L+   +D D   +G  F  ++     +  F V+ K   +   K L++ K   + +++  +D
Sbjct: 3161 LNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYE-LEIVSETTTDTPVLPFAINSNG----DVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIGHRLLKFSVSDLDGPKNGAPFT-VEIQGDGAKSFKVNEKL-ELLTAKKLEYRKKDKYLLTVIAKD 3404          

HSP 4 Score: 85.1149 bits (209), Expect = 1.258e-15
Identity = 207/925 (22.38%), Postives = 369/925 (39.89%), Query Frame = 2
Query: 3344 IEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLS-----GSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQI-NIDSWTGLITT--KVSLSCAQNVKIRIFVSDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFD-SQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLKNL---EVVYSIKQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQI-NPSSDGIFMINGDSGEIHLVSSPRV----SAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVK----LPEDEAITNFLT-VVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSC-SPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPVNSEIFYVLNPGH--SHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLT-KLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYV 6040
            I++ +    V RV +      Y  PL V+  AT R + S      L ++ I+ N  PP  V+P       F+   +S     G  +  V+A D D+  N    YS  L   +E Q  ++    G IT   K+       + + I  +D   P   ++    +    E        N +  F + + +  G V+G +             I   +   D FL    + S   I++K +L+ +       +         + +   + V +  V  + P F  D  +F  I E+   G+ V  F+     +     + +S+ +   YF +N  +G L      DRE   +I  Y ++IA         T LP  + ++D ND+ P       +I  +  P+T  + I      D D  PN+   + I   + +G+F I  DS    L+  P +      Y+L VT  D G    S  V   I+ +S K  S IR    + ++ L+    K   ++G+ S    + +       + ++     +F V+   G V+ + S   ++I   +  Q+     ++ D S    + I + I+  N+N P+    + KV     LP  E    ++T +VA D D   F  I + +  D F     ID   G ++   PL+      +NL ++A+D E      +D   +++ V +   +   F  + +S+KV+E+   G  L          N  I Y L P    S + +N  TG L    PL  E +  ++LT+   AK      ++T + +    + + ++      E  V     NS   +K LT K    DS+    ++Y+ +    TT     +      +G++ +  S+      ++ LKVI  D G P   +  L++I +  ++ + 
Sbjct: 2452 IDRKTGRIHVSRVLNYHRDKRYQIPL-VVEDATGRRAFS-----TLTLSVIDINDKPPFFVLP-------FYSTSISESAKEGDTVMMVSATDDDE--NDTIEYS--LLDGSESQFFSVHPRQGTITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRFSNSHYLFSVMEDADVGNVIGRVQQMETEIDEIRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLD-RERKNQWKMTIRADAAGGVHAITTVTVDIGDVNDNAPAFHGDYERFT-ISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEENPYFDLNENSGWLTVASQLDRE---KIDHY-KLIARATDEGGFNTDLPFTIVVSDVNDSPPQFEKEEFNI-DLHLPST--SPILHFSIKDDDLSPNNVSQFFIPKGNEEGVFWI--DSNNDLLLKRPEIVENKMQYQLKVTAFD-GVFETSTKV--KINLKSSK-DSDIRCPEANKTVILAENSKKGTVVLGESSLLGPNVT-------FKLSDNDGNVFVVNFRNGIVKVKES---DQIDYEKNQQLEFHRLTIQDNSEVCKELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDAD---FDEIKFRMVDD-FGGLFQIDDINGVVTVVKPLDSEILGFFNLTVVASDGE-----FEDKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQNETIEYYLKPSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTV--VAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHA 3323          

HSP 5 Score: 76.6406 bits (187), Expect = 4.323e-13
Identity = 89/293 (30.38%), Postives = 137/293 (46.76%), Query Frame = 2
Query:  128 IKENVPIGEVV-GQIESPGFSPPFEMHDFQEKKFIISKTTGVIKV--SGLIDREKQNLYSF--LIISMNGDTKN--VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVD--LTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNS-PPFHT 976
            + EN   G VV G+    G +  F++ D     F+++   G++KV  S  ID EK     F  L I  N +     + + I ++NDN PK      + SI EN P        +T +   D   + I+  R+V  D   +F I   D  NG+  V     + LD EI+  FNL + A DG     +A++LV +I Q  NDN P F+ S Y   + E + I       RA+  D   + E  Y+L  +  +S F  ++ +TG + L K LDFE   +  +++  +D+  PP  T
Sbjct: 2921 LAENSKKGTVVLGESSLLGPNVTFKLSDNDGNVFVVNFRNGIVKVKESDQIDYEKNQQLEFHRLTIQDNSEVCKELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDADFDEIK-FRMVD-DFGGLFQI---DDINGVVTV----VKPLDSEILGFFNLTVVASDGEFED-KATILVTVIDQ--NDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQNETIE--YYLKPSDVTS-FVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLET 3198          

HSP 6 Score: 75.485 bits (184), Expect = 1.025e-12
Identity = 127/643 (19.75%), Postives = 252/643 (39.19%), Query Frame = 2
Query: 3443 DRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVKIRIFVSDLGFPKMTSSVDTLL--------KPLYEPKSEEFLINKNLTFIIP--DHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINV---IVNRVGFSWPLFSKDSPKFLEIKENL----PSGSHVAS----FNIRRLKNLEVVYSIKQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQI-NPSSDGIFMINGDSGEIHLVS--SPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSG---FIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNF--------LTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKL 5266
            D G P   S + +++N ++ N N P       H    +        ++  + AVD D+G N+   Y+I    + + + +ID+  G I    ++   ++  + +  +D G P    +   ++        KP     S   +  K   ++IP  D  Q G  VG L     +     L+ S ++   D    +R D+ QL+L K    +K     LN+       +   S + I V   I  R  FS   +  D  + + +   +     SG  + +    FN+  + ++ +   I+       + P +G ++     D E   +I+  V+V   ++ +   F+     V I DENDN PY +   ++   +    T +  +  + A D D G N  +TY I + + + +F I+  SGE+ L     P +   E  + +R       S+    S+H ++     +       +        ++ G    ++  L +   S        Y L        F V  ++G+V     +++  + + + V+   +++S       D+ ++   I   N++ P F R +++  + E+    +         L V A D D G  G + Y +     ++   +D  +G +
Sbjct: 1130 DGGEPQLCSNVIVIVNVLDENDNSPTFTQAIHH----YSVRSKFAGKLCRIFAVDADEGENARLTYNI---TEGDARFSIDN-NGNIIASEAIHGDESYALTVQATDHGTPGQQFAATRVVLTANSAGQKPRKSKNSPPEISGKKSDYVIPISDADQVGLTVGKLE--ASDADGDELWWSISSGDPDSVFDVRQDTGQLLLAKKVELLKRGELRLNISVTDGQAWD-HSTVIIQVSRQISQRPKFSASHYQTDVSERVAVGTQIYTLKASGESLGTKPLVFNLFSVDDVAMEDKIR-------VEPSSGNVIVMEPLDYEAARRIRAVVQVQQANMKSFATFS-----VNINDENDNSPYFVG-HTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIVSGNEESLFKIDAKSGEVRLAKPLDPELQHVESILRIRAIDSAANSLKDEMSLHIRNSNEAPETAKFDRKVYQTTLYDSTRPGTPVLVLNALHHGTVS--------YKLEPN--CTFFEVHTLSGAVHLATWLTK--LKHRKSVECTAIVESTEGQQ--DIAKVIAKIIRTNQHSPIFRRQVYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYRMLSPKDEQMFSVDQYSGAI 1734          

HSP 7 Score: 73.559 bits (179), Expect = 3.540e-12
Identity = 58/210 (27.62%), Postives = 96/210 (45.71%), Query Frame = 2
Query:  359 NDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRI--VSGDSEKVFAIDYHDSSNGIFY-VRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTS 979
            N + P F++      + E+ PIG+ V      D D G N      I  ++G S +V  +D       +   +  ++K+ L+   +    L + AID G P   +   +K+ +++ N++ P+FD   Y   I E+++      +V A D D G +G++ + L N    S   ++D KTG V L KSLD E    H  +I   D   P   S
Sbjct:  602 NKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLE---VLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVS 808          

HSP 8 Score: 71.633 bits (174), Expect = 1.276e-11
Identity = 60/273 (21.98%), Postives = 119/273 (43.59%), Query Frame = 2
Query:  230 ISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKN----VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDF--FTVDHKTGNVYLRKSLDFEKSKSHHISI-------------------GVRDNSPPFH 973
            I + TG I VS +++  +   Y   ++  +   +     + + ++D+ND  P F    +  SI E+   G  V + +  D DE  N      ++ G   + F++     +       + + + L+++     +L I+A D  +PP  A+  V++ + + +  VP+F  S Y+ S+ ED ++     RV+  + +  +    F  +  +  S  F  F+V+  TG + ++ SLD E+     ++I                    V DN+P FH
Sbjct: 2452 IDRKTGRIHVSRVLNYHRDKRYQIPLVVEDATGRRAFSTLTLSVIDINDKPPFFVLPFYSTSISESAKEGDTVMMVSATDDDE--NDTIEYSLLDGSESQFFSVHPRQGT-------ITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRFSNSHYLFSVMEDADVGNVIGRVQQMETE--IDEIRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTIRADAAGGVHAITTVTVDIGDVNDNAPAFH 2713          

HSP 9 Score: 70.0922 bits (170), Expect = 3.855e-11
Identity = 312/1473 (21.18%), Postives = 567/1473 (38.49%), Query Frame = 2
Query: 2909 GEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGI--INLLVIVS----------DNG---PFKPLETEVEISVRIIDANNHSPILIS-TNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQ--PHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVML--IATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLS----GSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCA-QNVK-IRIFVSDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQP--------GYVVGDLNIFPENYG--AKCLFISNTTTSVDGFLHLRFDSQQLILL-------KDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIV---NRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIR--------RLKNLEVVYSIKQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVS---NPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQI---VATDADSGPNSKLTYQI---NPSSDGIFMINGDSG-----EIHLVSSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLI----AGKFAQIFSVDPITG-----SVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDL----------------QRIFINIDYGNE-------NPPRFSRSIFKVKLPEDEAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCS-PLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRI-----NIVKPPVNSEIFYVLNPG-HSHIQINTTTGELRTNGPLHLELVEFIELTI---HAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIF--RVKENSV-DGTFIGQ-IKMVNYCKDHSAKFSIIDGVNHELVFLHESTGKIFVAA-AAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIR-------LTVYDPDIGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASP--FVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPV--GSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGK-HEFDIVVDDARFSSTAVIEI 6943
            G++   +  +D D   NG + Y+           P EIN  TG + ++      NS P+ +  I+L + +S           NG   P KP    ++ S      N HSP+  S   +  + + A  GT V  L   DED G NG I   +       ++   +++ S    V    S + +    E L+V L   A D G+P KSSV  + +   + N + P      Q  ++ ++  +      G +IF V A D D G N    +S+    +    I+ID+ TG++    SL    Q+V    I  SD GFP M  SV  L   + +       +N N    +  HS+         G  V  +  F E+ G  +K  F+ N+       +  R D     +         D       + S+ V  +   + S S +L++ ++    N +   +     D  K   + EN   G+ V     +        + +NLE          +F I+   G + T  + DRET++     VE   +      +P+   VL + ++I D ND+ P    P   I  ++  +  N  I ++    A D D+   + L ++I   +P S   F I+  SG      I  +   + S +EL V++ D GE P+  S V                                  I+  L  +  S +    I +Y +    AGK  +IF+VD   G     +       +R  I N+  +   +  +++H    Y L                 R+ +  +   +       +PP  S       +P  +A    LTV   +        + +S+     D    +   TG+L  +  +  +++    L I  TD +       D + VII V         F+A+H+   V E    GT +  +     ++   P+   +F V +      I++  ++G +    PL  E    I   +    A  K  +T S+              NDN P    +    F+  S+     L  ++A D D+  N    +       ++L+K   +D KSG +  + +     +++H ++ I+    + S   ++  ++SL+  +      PE A F  +V + ++ D T  G  + ++N    H    S     N     +H  +G + +A    K+   K  +     + + G  +I    KVI  +   + + P+F +  +   + E  P  + V+        ++  D D G N  V Y +     ++ F +D  +G ++T +  +F     Y   ++A     P         + V +++ ND+ P+   P+ +L +    P   G  +   TA+D D    + Y I+     +Q++  +V   +G++ +     +SD+ K  + ++ V D + S++ V++I
Sbjct:  508 GDVLVKVDATDQDEGENGKIVYKFT------SELPLEINANTGEITLVEVPKKGNSWPATVWAIDLGLPLSRMSALNLMFYKNGTKIPAKPKPIIIQES-----ENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLS-KLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSP------QFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFP-MRVSVTNLTISVED-------VNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNSEK-----VPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEF----DDVAKEASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPHFSIDQ-KGTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKP-MYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQS--FFRIDLTSGYITTSGIRRLDREKQSEHELWVSICDGGE-PQLCSNVI--------------------------------VIVNVLDENDNSPTFTQAIHHYSVRSKFAGKLCRIFAVDADEGENARLTYNITEGDARFSIDNNGNI---IASEAIHGDESYALTVQATDHGTPGQQFAATRVVLTANSAGQKPRKSKNSPPEISGKKSDYVIPISDADQVGLTVGKLEASDADGDELWWSISSGDPDSVFDVRQDTGQLLLAKKVELLKRGELRLNISVTDGQAW-----DHSTVIIQVSRQISQRPKFSASHYQTDVSERVAVGTQIYTLKASGESLGTKPLVFNLFSVDDVAMEDKIRVEPSSGNVIVMEPLDYEAARRIRAVVQVQQANMKSFATFSVNINDE---------NDNSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIVSGNEESLFK---IDAKSGEV--RLAKPLDPELQH-VESILRIRAIDSAANSLKDEMSLHIRNS--NEAPETAKFDRKVYQTTLYDSTRPGTPVLVLNAL--HHGTVSYKLEPNCTFFEVHTLSGAVHLATWLTKLKHRKSVECTAIVESTEGQQDI---AKVIAKIIRTNQHSPIFRRQVYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYRMLSPKDEQMFSVDQYSGAIRTQMSFDFEKMKEYSFYVQAFDMGQPPRRSLMPSLIVVTVIDENDEPPR--FPSNSLDISMILPTANGVSVGGQTAQDMDSVGSLRYFIK-----DQSVPFSVDSKTGDVLVKDSNGISDMTKLFDLEVFVTDGKQSASYVMKI 1871          

HSP 10 Score: 70.0922 bits (170), Expect = 4.262e-11
Identity = 58/209 (27.75%), Postives = 99/209 (47.37%), Query Frame = 2
Query:  323 DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVD-------LTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASL--LVKIIVQNANDNVPKF-----DISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFL-DNTSPSSDFFTVDHKTGNVYLRKS 904
            D   V  KI+  N + P F    +  +I EN P GS V        + +  D D G N +   R++S   E++F++D +  +       +  + S D+E + +++  +QA D G PP ++ +  L+ + V + ND  P+F     DIS  + +        ++     A D D+   G L YF+ D + P    F+VD KTG+V ++ S
Sbjct: 1652 DIAKVIAKIIRTNQHSPIFRRQVYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYRMLSPKDEQMFSVDQYSGA-------IRTQMSFDFEKMKEYSFYVQAFDMGQPPRRSLMPSLIVVTVIDENDEPPRFPSNSLDISMILPTAN-----GVSVGGQTAQDMDS--VGSLRYFIKDQSVP----FSVDSKTGDVLVKDS 1842          

HSP 11 Score: 69.707 bits (169), Expect = 5.667e-11
Identity = 83/351 (23.65%), Postives = 170/351 (48.43%), Query Frame = 2
Query: 5765 QPQKPLTKLSATDSDKTSN--ITYQFDRSDP--TTQTLYKMYLLD-GKSGNLFXXXXXXXXXXI----RHFLKVIVSDNG--VPSKCTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSA--KFSIID--GVNHELVFLHESTGKIFVAAA-AKIDREKIDKIILWTQVSC--GGSEIRGYKKVI-IHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFL-IDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD 6754
            +P   L K+ ATD D+  N  I Y+F    P        ++ L++  K GN +  +     + +       L ++   NG  +P+K   ++I  S N+        PE  I  V E++  GT + +++  +    ++   ++ I D  G +HE++ + E +G+I VA+  +K+ +EK++ + +  +VS    G+ ++   K + + + DV+++ P F +  +   ++E + P   + ++T  D D G N ++++ +     +   + IDA  G VK    L+   + V+   I AS +  P   +   LT+ + ++ND  PK  + +   ++  + P G+F++ + A D D
Sbjct:  506 KPGDVLVKVDATDQDEGENGKIVYKFTSELPLEINANTGEITLVEVPKKGNSWPATVWAIDLGLPLSRMSALNLMFYKNGTKIPAKPKPIIIQESENKHSPVFSSFPE--IVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDED 854          

HSP 12 Score: 68.9366 bits (167), Expect = 8.688e-11
Identity = 75/307 (24.43%), Postives = 137/307 (44.63%), Query Frame = 2
Query:  119 IFSIKENVPIGEVVGQI----ESPGFSP--PFEMHDF---QEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMN-----------GDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRK---SLDFEKSKSHHISIGVRDNSPPF 970
            I  + E+ PIG VV ++    E  G++    + +HD      +   + + +G I V+  + +  +     L + +               K ++++I DVN++ P+F+  ++   I EN   G  +   T  D D G N    ++   G++++  ++   D+  GI  V+L+  +SLD E        I A D G P   +   + I V++ NDN PK  +    A I ED         + A D D G + +L + L++       F +DH +G +++      LD+ K+   ++SI V D+  P 
Sbjct:  614 IVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNG--KIKFSLGNNQEKSSVISIDAKTGI--VKLL--KSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNSEKVP---FRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPI 911          

HSP 13 Score: 63.5438 bits (153), Expect = 4.097e-9
Identity = 101/456 (22.15%), Postives = 185/456 (40.57%), Query Frame = 2
Query:  245 GVIKVSGLIDREKQNLYSFLIISMNGDTK-----------NVQIKILDVNDNEPKFNATNFEKSIPENYPIGS---KVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFH----TSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHV--KLTDYDAISTSFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEIDSTILNENQHVTFVKTTKRLPTKPIFIFKIFVLNNL-----FKINETTGEILSKRSID 1537
            G ++ + L+DRE ++ Y   + + +  T            +V I+ILD ND+ P      +  S+ EN P      KV+ T   D D    +    +I  GD +  F ID    ++G  Y+     + LD E  S+  L +   DGG P L ++++V + V + NDN P F  + +  S++   +      R+ A D D G +  L Y   N +     F++D+  GN+   +++     +S+ +++   D+  P      T  V              +     +G  S+    IS    V     KL   DA        I +  P  +  +     +L L   +   K   + L +   D      ST   + I++   I     FS S +Q ++   +    Q  T   + + L TKP+ +F +F ++++      ++  ++G ++    +D
Sbjct:  991 GTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSFFRIDL---TSG--YITTSGIRRLDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFTQAIHHYSVR--SKFAGKLCRIFAVDADEGENARLTY---NITEGDARFSIDN-NGNIIASEAI--HGDESYALTVQATDHGTPGQQFAATRVVLTANSAGQKPRKSKNSPPEISGKKSDYVIPISDADQVGLTVGKLEASDADGDELWWSISSGDPDSVFDVRQDTGQLLLAKKVELLKRGELRLNISVTDGQAWDHST---VIIQVSRQISQRPKFSASHYQTDVSERVAVGTQIYTLKASGESLGTKPL-VFNLFSVDDVAMEDKIRVEPSSGNVIVMEPLD 1429          

HSP 14 Score: 63.5438 bits (153), Expect = 4.345e-9
Identity = 241/1149 (20.97%), Postives = 470/1149 (40.91%), Query Frame = 2
Query: 3584 IFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCA-QNVK--IRIFVSDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGA-------KCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRL----------KNLEVVYSIKQP--EKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLP--LIVKIADENDNEPYILSPSSSI-VRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEIHLVSSPRVS----AYELNVTVRDSGEVPKSVSVVFSIHFQSIKTK-SKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQH-SVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCSPLNFMEKNI-YNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPVNSE----IFYVLNPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFI-----GQIKMVNYCKDHSAK--FSIIDGVNHELVFLHESTGKIFVAAAAKID---REKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNK--PVFSQNKFVA-FLNEGQPPKTPVIRLTVYD--PDIGFNSQVEYFIEFYSSQEEFLIDAN---GDVKTNIPLNFHTKSVYD--LVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKL 6862
            + TV A D D+G N I  YSI ++ + E    ID+ +G +     L    Q+V+  +RI   D     +   +   ++   E         K     + D ++PG  V  LN    ++G         C F    T S  G +HL   +  L  LK   +V+       +V + +    I+    I  I+ R     P+F +   +   I+EN+P+GS V S ++  L           N  V Y +  P  E+ F ++  +G + T   FD E   +  FYV+  A  +  P   +++P  ++V + DEND  P    PS+S+ + +  PT    S+    A D DS     L Y I   S   F ++  +G++ +  S  +S     ++L V V D  +     S  + +   +I T+ SK +F  N    +L      +    G +  S  +    LD  ++ I       F + P TG + +   ++ RE+   S I+++ V  +S     +     + + I+  N+  P F  + + + +   +  T  L     D D G     + ++  +   +   I      L     +  E+++ +N K+IA D+  +    +    V I V +  +   + N  + ++   E++   TVL ++ + K  + S+    I Y +    S   ++  TGE+R N   +L+++     T    A+ ++   +   + +  +    I  + P+  +       P S    + L  + AT SD+   I Y    S        K   +  ++G++ +   +      ++ LK++ + +G         I +  + + +  + +      ++ ++++ G FI       +   N   + S K  + I+DG +  L  +  +TG++ +A   + D    E   K++    VS        Y K+++ +      +  P F Q+ +VA  L      K+ ++ + V    P + F+          +S+E + +  +   G +  +  LN+H    Y   LV++ ++    F      LT+ +++IND+ P   +P  +  +  +   G  +  ++A D D  D I Y +      +++ F +V    G I +++KL
Sbjct: 1486 LATVTAFDKDRGENGIVTYSI-VSGNEESLFKIDAKSGEVRLAKPLDPELQHVESILRIRAIDSAANSLKDEMSLHIRNSNEAPETAKFDRKVYQTTLYDSTRPGTPVLVLNAL--HHGTVSYKLEPNCTFFEVHTLS--GAVHL---ATWLTKLKHRKSVE----CTAIVESTEGQQDIAK--VIAKII-RTNQHSPIFRRQVYRGT-IRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYRMLSPKDEQMFSVDQYSGAIRTQMSFDFEKMKEYSFYVQ--AFDMGQPPRRSLMPSLIVVTVIDENDEPPRF--PSNSLDISMILPTANGVSVGGQTAQDMDS--VGSLRYFIKDQS-VPFSVDSKTGDVLVKDSNGISDMTKLFDLEVFVTDGKQ-----SASYVMKISTISTENSKFKFTRNEYHTSLI---ENTTLPPGSIILSVATIGDKLD--HFSIVNPHEAFF-IHPGTGVISSSGIALDREK---SAIIRLVVQAKSHEKNPVMARALVVVGIENINDETPIFMGTPYDITIGHSDIGTVVLEPKVIDNDEG----DVVTISSENMPEYFKIVGGKVVLGKKLPSIEEEDLEFNFKLIAKDNGSVHRVEE---PVKIRVVDKARPVFSQNV-YTAVISKESTKKSTVLVKV-MAKSSLQSKSKGLIGYRILDKKSPFSVDFLTGEVRLN---NLKMLAETNYTFEVEAREVTRPKMIAKAQVEIIVKSGITTHAPVFEKLKYTASTPESTSIGQRLLTIKATTSDENDTIEYSLSGS--------KDIEIHPETGDVTITGQLDYEKTQKYDLKLVATSSGKQVSSEAEFIVLIEDVNDEMPEFIRSDVSAKISDSAITGQFITIMSATDMDTTNSLDEESQKLLYKIVDG-DETLFNISPATGELSLARPVEQDDLVNEDTKKVL---NVSVTDGMFTAYAKLVVEILRSGSMQPPPRFEQSHYVANALENTIVNKSALLTVAVKGGVPPLQFSLAPTTSSNSSTSKEAWPVAIDRKTGRIHVSRVLNYHRDKRYQIPLVVEDATGRRAF----STLTLSVIDINDKPPFFVLPFYSTSISESAKEGDTVMMVSATDDDENDTIEYSLLD---GSESQFFSVHPRQGTITVAKKL 2566          

HSP 15 Score: 62.3882 bits (150), Expect = 9.157e-9
Identity = 220/1060 (20.75%), Postives = 418/1060 (39.43%), Query Frame = 2
Query:  218 KKFIISKTTGVIKVSGLIDREKQNLYSF-LIISMNGDTKNVQIK----ILDVNDNEPKFNATNFEKSIPENYPIG------SKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDF------FTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD------------------NSPPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDAISTSFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKI-HESILFEN-SFSHSRFQVEIDSTILNENQHVTFVKTTKRLPTKPIFIFKIFVLNNL-------FKINETTGEILSKRSIDC-GKYFFNVSMLSLKTNSLIDQTKLEIVVKSGRKLPLYFDRGFRKILVT----TGKSQCFSEIAVRNRHCGMRIQYSYDLLLKTDGILRINEH-GALCTAENVKHNKLMSTRYLYQIKALDETNSSAVCVVLFAIQPSKVFDVLPTEINITLPIIDSPKFN--FSLPIGKIIGTFS----KLPPAQFIGFIQYHLVPEELSTGAITVDSQSGEILMKKFPIHKNPIRLIVK-SVIRKPFNVS---PLNIVAINFQKLFFARSLYQFILTKSEIKGNLVKIGQVSMDSSCTESVSYDLFGVKNDHSHFTIDVATGVIYGKDLGSIS---NKTLMFQVSAKAPKSQTSFAQVIIYIED-GIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSDEYQIIQ----SQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSP 3193
            K   I   TG + ++G +D EK   Y   L+ + +G   + + +    I DVND  P+F  ++    I ++   G      S  D+ T    DE    +   +IV GD E +F I    ++  +   R + +  L  E   +  L +   DG      A L+V+I+   +    P+F+ S Y+A+  E+  +N + L   A     GV    F     TS +S          +D KTG +++ + L++ + K + I + V D                  + PPF                    +   ++  +SE  ++      V  V  TD D   T  +  +L+ S  Q   + P+   + +   + +    +++LT+KA D   P    T  + + I  ES+     S SH  F V  D+ + N       +   +++ T+   I    V  +        F +  +TG+I+ K S+D   K  + +++ +     +   T + + +         F   + +  ++     G S        R+     RI++S   L++ +    +NE+ G L  A  +   K+    Y    +A DE                  F ++ +++N + P  +  +FN    LP    I  FS     L P     F     +P+    G   +DS + ++L+K+  I +N ++  +K +     F  S    +N+ +     +    +    IL ++  KG +V +G+ S+      +V++ L    ND + F ++   G++  K+   I    N+ L F        S+     + + IE+   ++P      L V+I EN     +  Q   +  +   ++  I+      +     I    G + + K  D E + +  +TV   +        + + ++D NDN P  + S  +    +  S+G      + S  D   N  + Y    +KP  + +   +N  TG L +   L+    +    + L V+  D+G   PLETE ++ + ++D N+++P
Sbjct: 2227 KDIEIHPETGDVTITGQLDYEKTQKYDLKLVATSSGKQVSSEAEFIVLIEDVNDEMPEFIRSDVSAKISDSAITGQFITIMSATDMDTTNSLDEESQKLL-YKIVDGD-ETLFNI--SPATGELSLARPVEQDDLVNEDTKKV-LNVSVTDGMFTAY-AKLVVEILRSGSMQPPPRFEQSHYVANALENTIVNKSALLTVAV--KGGVPPLQFSLAPTTSSNSSTSKEAWPVAIDRKTGRIHVSRVLNYHRDKRYQIPLVVEDATGRRAFSTLTLSVIDINDKPPFF-------------------VLPFYSTSISESAKE---GDTVMMVSATDDDENDT-IEYSLLDGSESQFFSVHPRQGTITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRFSNSHYLFSVMEDADVGN------VIGRVQQMETEIDEIRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTIRADAAGGVHAITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFS---LVEENPYFDLNENSGWLTVASQLDREKI--DHYKLIARATDEG----------GFNTDLPFTIVVSDVNDSPPQFEKEEFNIDLHLPSTSPILHFSIKDDDLSPNNVSQF----FIPKGNEEGVFWIDSNN-DLLLKRPEIVENKMQYQLKVTAFDGVFETSTKVKINLKSSKDSDIRCPEANKTVILAENSKKGTVV-LGESSL---LGPNVTFKL--SDNDGNVFVVNFRNGIVKVKESDQIDYEKNQQLEFHRLTIQDNSEVCKELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDADFDEIKFRMVDDFGGLFQIDDINGVVTVVKPLDSEILGFFNLTVVASDGEFEDKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQ--NETIEY---YLKPSDVTSFVNLNAQTGILTLAKPLDFETLSA---LKLTVVAKDSG-VPPLETEAQVEISVMDENDNAP 3214          

HSP 16 Score: 61.6178 bits (148), Expect = 1.632e-8
Identity = 64/265 (24.15%), Postives = 110/265 (41.51%), Query Frame = 2
Query: 6344 NKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEE------FLIDANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGP-DGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFSSTAV-IEIDVEDKNNHVPILKENGRVIN-LSSSLKRGSKILYLHAIDKDLRD-NGKVTFELVSTS 7108
            N P F + K+V  + E       V+ +   D D      V Y +E  S          F I++NGDV  +  +++     Y+L + A     P + +E  L +++ + ND  P     N    +     +G  + K +  D DGP +G  + +  +    ++  +N      E+  ++KL      K+   ++  D +  +T   + I +   + H P +K     IN L + L  G  I  L A D+D  D NG + F LV  S
Sbjct: 3212 NAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIGHRLLKFSVSDLDGPKNGAPFTVEIQGDGAKSFKVNEKL---ELLTAKKLEYRKKDKYLLTVIAKDVKGKTTDCPLTIFIRQTSRHAPTMKPMKIQINTLQNELPEGI-IGRLKASDEDEEDQNGLLRFGLVEGS 3472          

HSP 17 Score: 60.4622 bits (145), Expect = 3.528e-8
Identity = 57/216 (26.39%), Postives = 97/216 (44.91%), Query Frame = 2
Query:  119 IFSIKENVPIGEVVG---QIESPGFSPPFEMHDFQEKK-----FIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDT----KNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRY 730
            +FS+ E+  +G V+G   Q+E+      F +    E+      F + ++TG I V   +DRE++N +   I +           V + I DVNDN P F+      +I E+  +G+ V + +  D D+      S RI     E+    D +++S       L +   LD E I  + L+ +A D G       L   I+V + ND+ P+F+   +
Sbjct: 2614 LFSVMEDADVGNVIGRVQQMETEIDEIRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTIRADAAGGVHAITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSP----SGRIRFSLVEENPYFDLNENSGW-----LTVASQLDREKIDHYKLIARATDEGG--FNTDLPFTIVVSDVNDSPPQFEKEEF 2818          

HSP 18 Score: 57.3806 bits (137), Expect = 2.770e-7
Identity = 63/245 (25.71%), Postives = 113/245 (46.12%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLII-SMNG-----DTKNVQIKILDVNDNEPKFNATNFEKS---IPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVS-------GDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSS-DFFTVDHKTGNVYLRKSL 907
            F I    G+++VS  I+R ++ +Y+F +I S++G       K+V I+ILD ND+ P F+A    ++   I +   +  KVD T   D DEG+N     +  S        ++ ++  ++     N        +   L    +S  NL+    +G   P +   +  II ++ N + P F     I  + ED  I     +++A D D G +G + Y + + + SS +  TVD ++G + +   L
Sbjct:  436 FAIGSKNGILRVSAKINRSER-VYNFKVIASLHGINEKLAEKDVSIEILDSNDHAPVFSAKWMRQTPIVIGKPGDVLVKVDAT---DQDEGENGKIVYKFTSELPLEINANTGEITLVEVPKKGNSWPATVWAIDLGLPLSRMSALNLMFYK-NGTKIPAKPKPI--IIQESENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDL 673          

HSP 19 Score: 56.225 bits (134), Expect = 6.903e-7
Identity = 83/349 (23.78%), Postives = 144/349 (41.26%), Query Frame = 2
Query: 6689 LKLDTNRPVGSFITKITAKDSD-GPDGISYRIRHRKLTNQTLFLNVAFDSGEI--------FLSRKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDE-PQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLD---SDKAIFYKIDNFHPISNNLYLDFESGDLYLTK---SLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAIISN 7687
            +++  + P+G+ + K+ A D D G +G    + H    +    L V   SGEI         +  KL V DV      I       SS   +++ ++D NNH P   E    + +S + K G  I  + A D D  +NGK+ F L +      +   D  T  + L+    +E    +   I  +D    P +  +S+  LT+ ++      P+ +  HS    IPE L  G+ ++     D D   + K  F       P      +D  SG +++      L+Y   P F L +  A  G P   TS +L V+         L+D  +  L+++  ++ ++ ++  N
Sbjct:  615 VEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGF-PMR--VSVTNLTISVEDVNDNPPKCVVQHS-RARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNSEKVP----FRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVE---------LVDIAHNHLAIEFDDVAKEASVYEN 946          

HSP 20 Score: 53.5286 bits (127), Expect = 3.975e-6
Identity = 85/397 (21.41%), Postives = 164/397 (41.31%), Query Frame = 2
Query: 6521 DVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECR--LTVYIVNINDQRPKISIPNRNLKLDTNRPVGS----FITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEPQ--EKGHPYFLGIQLTDNAIDP--QKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDK--AIFYKIDNFHPISNNL-YLDF---ESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMI 7663
            D + N  L FH      L I+ +S+        C+  +TV I N+ND RPKI      + +D N P       +IT+I A+D+D  +     I+ R + +      +   +G + + + L    +G     +V  D  F   A I + V D+N++ P  +++   + +  S   G ++ +  A   D  +  +   +    + +  L    N    +  + +P   E      L +   D+ + P   +  + I  +      P+    + +G       + E+ KSG K+      D+DS+   A+ Y+++     + +   L F    +GD+ +++S++Y    ++ L V     G P   +   L + +E EN      D+  +T  +Q  E I
Sbjct: 2972 DYEKNQQLEFHR-----LTIQDNSEV-------CKELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDADFDE-----IKFRMVDDFGGLFQIDDINGVVTVVKPLDSEILGFFNLTVVASDGEFEDKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQNETIEYYLKPSDVTSFVNL----NAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGK------VKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAI 3341          

HSP 21 Score: 53.1434 bits (126), Expect = 5.844e-6
Identity = 50/189 (26.46%), Postives = 92/189 (48.68%), Query Frame = 2
Query: 2225 PLNIVAINFQKLFFARSLYQFILTKSEIKGN--LVKIGQVSMDSSCTESVSYDLFGVK--NDHSHFTIDVATGVIYGKDLGSISNKTLMFQVSAKA---PKSQTSFAQVIIYIEDGI--HQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSDEYQIIQSQYSDW--LSIHSKTGQIFLNKQFDREQ 2758
            P+ I  ++  +  F++++Y  +++K   K +  LVK+    M  S  +S S  L G +  +  S F++D  TG +   +L  ++     F+V A+    PK   + AQV I ++ GI  H P F+      +  E+T++G  ++ +     + SDE   I+   S    + IH +TG + +  Q D E+
Sbjct: 2068 PVKIRVVDKARPVFSQNVYTAVISKESTKKSTVLVKV----MAKSSLQSKSKGLIGYRILDKKSPFSVDFLTGEVRLNNLKMLAETNYTFEVEAREVTRPK-MIAKAQVEIIVKSGITTHAPVFEKLKYTASTPESTSIGQRLLTI---KATTSDENDTIEYSLSGSKDIEIHPETGDVTITGQLDYEK 2248          

HSP 22 Score: 52.7582 bits (125), Expect = 7.705e-6
Identity = 58/215 (26.98%), Postives = 91/215 (42.33%), Query Frame = 2
Query:  254 KVSGLIDREKQNLYSFLIISMNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIIS-QFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYL 895
            ++  ++  ++ N+ SF   S+N         I D NDN P F        + E+  +   +   T FD D G+N I +  IVSG+ E +F ID          VR  L + LD E+   +  L I+AID     L+  + + I   N      KFD   Y  ++ +        L + A  +     G + Y L+   P+  FF V   +G V+L
Sbjct: 1435 RIRAVVQVQQANMKSFATFSVN---------INDENDNSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIVSGNEESLFKIDAKSGE-----VR--LAKPLDPELQHVESILRIRAIDSAANSLKDEMSLHIRNSNEAPETAKFDRKVYQTTLYDSTRPGTPVLVLNALHH-----GTVSYKLE---PNCTFFEVHTLSGAVHL 1625          
BLAST of Dachsous vs. Ensembl Celegans
Match: cdh-3 (Cadherin-3 [Source:UniProtKB/Swiss-Prot;Acc:P34616])

HSP 1 Score: 93.5893 bits (231), Expect = 2.928e-18
Identity = 75/255 (29.41%), Postives = 124/255 (48.63%), Query Frame = 2
Query:  122 FSIKENVPIGEVVGQIESP-GFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKN-SIQSVRIVSG----DSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTV 868
            FS+ E+  +  ++G +E+  G++      +    K    + T  + VS  +DRE +N    LII+      ++ I +LDVNDN P F        IPE  PIG +V ++   DPDEGKN +I    +V      D+   F I     S+G  ++ +  K  LD E    +++ + AID G P L +S  + I++ + NDN P F I     ++  +   N     + ATD D+  +  L Y +  + P+S+ F++
Sbjct:   34 FSVSEDAKLNTIIGHLEAEIGYTYRLSRGN---SKIKFDEQTLELSVSSPLDRESENAIDMLIITSPPSIIHILIDVLDVNDNSPIFPIDVQRVEIPETAPIGWRVQISGATDPDEGKNGTIGKYELVDSLATVDTMSPFGI---VQSDGFLFLEVTGK--LDRETRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNPPNFGIRSL--TLNWNGLPNTKLFSLNATDLDSNENSLLTYRILPSGPTSEMFSI 278          

HSP 2 Score: 86.6557 bits (213), Expect = 3.693e-16
Identity = 78/258 (30.23%), Postives = 126/258 (48.84%), Query Frame = 2
Query:  230 ISKTTGVIKVSGLIDREK-QNLYSFLIISMNGDTK------NVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISR-YIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTS 979
            + K+TG++K    +D E+      F+I +   D K         IKI+D+NDN P+F+   +  ++ EN   G K+ +  V   D  ++S     IV GD+   F +     S  I  VR      LD E  S+++L+++AID G P  + +  V + V + +DN P+F  SR +   + ED  I    +++ A+D D   +    + LD        F VD  TG V++  SLDFEK +S+ I + + D +    TS
Sbjct: 1989 MEKSTGILKTKSSLDAEEYSECLVFIIATTYFDNKPLSTITKATIKIVDINDNSPRFDQQLYRFNVTENS--GPKL-IGHVIARDIDRSSRVFYEIVGGDANHEFMVT---ESGQIESVR-----DLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRF--SRIFHVEVPEDVRIGEPVIQLSASDADEHSNHR--FELDGGGEGIP-FRVDENTGMVFVNDSLDFEKKQSYRIKVKLTDGAWLIETS 2230          

HSP 3 Score: 78.5666 bits (192), Expect = 1.211e-13
Identity = 80/262 (30.53%), Postives = 126/262 (48.09%), Query Frame = 2
Query:  194 FEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKNVQIKILDVNDNEPKF------NATNFEKSIPENYP--IGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD 955
            F + D  +  F IS   G I  +  +D E    Y F I +    T  V I + D ND  P+F      N    E+    +YP  IGS +      D DEG+N + +  I+SG++  +FA++   S+ G   + LI    LD E  S   L+I+A D G P L A+  + I V + NDN P+F++S Y   I E+ +I    +R+ ATD D     EL Y L++    +  F ++  TG + +   ++ E+++     + V D
Sbjct: 1589 FRIQD-NDYNFTISPFDGTIFTNSPLDFENIKTYRFNI-TAGKSTSQVIIHVTDENDEAPRFITGDVVNLKVLEELDTVSYPLIIGSSI----AEDLDEGQNGLVTYSILSGNT-SLFAVN---STTGDI-LSLI---PLDREESSLHELLIEAKDAGIPSLSATSKILIHVGDINDNTPEFELSSYFIKISENSKIGSKIIRILATDKDK--DAELQYSLESNDEITIPFRINVATGWITVAGKVNREENEEFRFFVKVTD 1834          

HSP 4 Score: 77.411 bits (189), Expect = 2.348e-13
Identity = 153/730 (20.96%), Postives = 311/730 (42.60%), Query Frame = 2
Query: 5051 RIFINIDYGNENPPRF-SRSIFKVKLPEDEAITNFLTVV----ANDPDLGIFGRIIYS-LEGDTFDKKIFIDPSTGK-LSCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPVNSEIFYVLNPGHS---HIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFIS-TRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITY-------------QFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSC--GGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNR--NLKLDTNRPVGSFITKITAKDSD-----------GPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGL 7123
            ++ I++   N+  PRF +  +  +K+ E+    ++  ++    A D D G  G + YS L G+T      ++ +TG  LS  PL+  E +++ L I A D+   S      +K++I V +   +T  F  + + +K+ ENS  G+ + RI       ++E+ Y L          +IN  TG +   G ++ E  E        F  F+  T   +++  I+++ + D NDN P+  +    IF+P+  +  + +  ++  D DK+ ++ +             +     P    +     +   +G++     +      +HF   +        K  TV +      D Q      E A+F+   +S+      +  +V+ C DH              + + +STG   +   + +D E+  + +++   +       +    K  I + D++DN P F Q  +   + E   PK   +   V   DI  +S+V Y I    +  EF++  +G +++   L+  TKS Y L+++A     P       + V +++ +D  P+ S   R  ++++  +  +G  + +++A D+D           G +GI +R+                ++G +F++  L       +   + + D  +     + ++V+D N++ PI ++      L  S +  ++I   HA D D  +NGK+ + +  TSP+F +
Sbjct: 1633 QVIIHVTDENDEAPRFITGDVVNLKVLEELDTVSYPLIIGSSIAEDLDEGQNGLVTYSILSGNT--SLFAVNSTTGDILSLIPLDREESSLHELLIEAKDAGIPSLSAT--SKILIHVGDINDNTPEFELSSYFIKISENSKIGSKIIRILATDKDKDAELQYSLESNDEITIPFRINVATGWITVAGKVNREENE-------EFRFFVKVTDGEKSSKVIVEIHVEDFNDNHPMINDRNSDIFVPDPTRSVEIIHVINVHDLDKSDHLKFSLNNSNLNLSENGEITLKSPLQTAVPVRVTVSDDAGHVAFMEYLFHPHSRKHFPVFV-------EKLDTVSV---REHDEQ------ELAVFKANGDSI------RYSIVSRCSDH--------------LEMEKSTG--ILKTKSSLDAEEYSECLVFIIATTYFDNKPLSTITKATIKIVDINDNSPRFDQQLYRFNVTENSGPK---LIGHVIARDIDRSSRVFYEIVGGDANHEFMVTESGQIESVRDLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRFS---RIFHVEVPEDVRIGEPVIQLSASDADEHSNHRFELDGGGEGIPFRVDE--------------NTGMVFVNDSLDFEKKQSYRIKVKLTDGAWLIETSLFVNVKDVNDNAPIFEKPEY---LFISEENSAEIGQFHASDMDSENNGKIRYSV--TSPYFKI 2288          

HSP 5 Score: 69.707 bits (169), Expect = 4.812e-11
Identity = 65/234 (27.78%), Postives = 112/234 (47.86%), Query Frame = 2
Query: 6299 RGYKKVIIHXXXXXXNKPVFSQNKFVAF--LNEGQPPKTPVI--RLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKE 6985
            +   +VIIHV D +D  P F     V    L E      P+I       D D G N  V Y I    +   F +++  GD+ + IPL+    S+++L+I+A     P + A  ++ +++ +IND  P+  + +  +K+  N  +GS I +I A D D    + Y +           +NVA  +G I ++ K+   +  +  F + V D   SS  ++EI VED N++ P++ +
Sbjct: 1629 KSTSQVIIHVTDENDEAPRFITGDVVNLKVLEELDTVSYPLIIGSSIAEDLDEGQNGLVTYSI-LSGNTSLFAVNSTTGDILSLIPLDREESSLHELLIEAKDAGIPSLSATSKILIHVGDINDNTPEFELSSYFIKISENSKIGSKIIRILATDKDKDAELQYSLESNDEITIPFRINVA--TGWITVAGKVNREENEEFRFFVKVTDGEKSSKVIVEIHVEDFNDNHPMIND 1859          

HSP 6 Score: 64.3142 bits (155), Expect = 2.352e-9
Identity = 69/321 (21.50%), Postives = 143/321 (44.55%), Query Frame = 2
Query:  251 IKVSGLIDREKQNLYSFLIISMN------GDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIV-SGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIAS----IKEDQEINITFLRVRA-TDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDAISTSFDLEILNRSPFQL 1177
            ++V+G +DRE ++LYS  + +++        + ++ I ILD+NDN P F   +   ++  N    +K+      D D  +NS+ + RI+ SG + ++F+I   +          IL    + E + +   V++A D G PPL  +L + + ++  N++ P  +I  Y +     I + +++N   L + + TD+D  +      +++N +  S F  +  ++ N+   K ++    + + +     D   P        +            I +     ++ + +D  P + VAHV+    D  S     E+ N   F++
Sbjct:  181 LEVTGKLDRETRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNPPNFGIRSL--TLNWNGLPNTKLFSLNATDLDSNENSLLTYRILPSGPTSEMFSISDEN----------ILVTQNNTECLQRCEFVVEARDSGVPPLSTTLNIVVNMEYGNEHEPNINIRFYPSDYPFIIVQPEDVNGKTLAILSITDSDGPLGANSTIWIENGNEQSIFSLISRQSINILTVKHVENANQEQYILEFRANDGQSPADRITRKELKIFFKKYVKSTQIHVERESHVT-VEKDTVPGSFVAHVETNCTDMCS----FELANSDVFKI 484          

HSP 7 Score: 57.7658 bits (138), Expect = 2.403e-7
Identity = 54/168 (32.14%), Postives = 78/168 (46.43%), Query Frame = 2
Query:  395 EKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIV--SGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGE-LFYFLDNTSPSSDFFTVDHKTGNV 889
            E  + EN PIG+        D D G + + S +I+  S D + +F +D   S++G     L   ++ D E    +    +A D G P    +    I +++ NDNVPKF    Y A+I      N T   V+A DND  V  + L Y L N     DFF +D +TG V
Sbjct:  637 EIHVLENAPIGTIFGRIQARDEDSGLSGVVSYKILTKSDDYDGIFHLD---STSG----SLRSLKAFDAEKKRSYTFEYEAKDLGTPSKTTNCPATIFIEDVNDNVPKFGSRYYTATISGKS--NETVAIVQANDNDVDVKNQKLQYHLLNY---HDFFQLDKETGKV 792          

HSP 8 Score: 55.8398 bits (133), Expect = 8.377e-7
Identity = 60/228 (26.32%), Postives = 110/228 (48.25%), Query Frame = 2
Query:  221 KFIISKTTGVIKVSGLIDREKQNLYSFLIISMN-------GDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTG 883
            +F+++++  +  V  L DRE ++ Y  ++ +++       G+T  V + +LD +DN P+F+   F   +PE+  IG  V   +  D DE  N      +  G     F +D    + G+ +V      SLD+E    + + ++  DG    ++ SL V   V++ NDN P F+   Y+  I E+    I   +  A+D D+  +G++ Y     S +S +F ++  TG
Sbjct: 2089 EFMVTESGQIESVRDL-DRETKSEYHLIVEAIDDGKPRRRGNT-TVIVTVLDEDDNAPRFSRI-FHVEVPEDVRIGEPVIQLSASDADEHSN--HRFELDGGGEGIPFRVD---ENTGMVFV----NDSLDFEKKQSYRIKVKLTDGAWL-IETSLFVN--VKDVNDNAPIFEKPEYLF-ISEENSAEIG--QFHASDMDSENNGKIRY-----SVTSPYFKIEPSTG 2293          
BLAST of Dachsous vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 361.688 bits (927), Expect = 2.424e-99
Identity = 574/2498 (22.98%), Postives = 1028/2498 (41.15%), Query Frame = 2
Query:  215 EKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLD-NTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSP-PFHTSK-XXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDAIST-------------SFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHE----SILFENSFSHSRFQVEID--STIL-------NENQHVTFVKTTKRLPTKPIFIFKIFVLNNLFKINETTGEILSKRSIDCGKYFFNVSMLSLKTNSLIDQTKLEIVVKSGRKLPL------------------YFDRGFRKILVTTGK--SQCFSEIAVRNRHCGMRIQYSYDLLLKTDGILRINE------HGALCTAENVKHNKLMSTRYLYQIKALDETNSSAVCVVLFAIQPSKVFD----VLPTEINITLPIIDSPKFNFSLPIGKIIGTFSKLPPAQFIGFIQYHLVPEELSTGAITVDSQSGEIL--------MKKFPIHKNPIRLIVKSVIRKPFN-VSPLNIVAINFQKLFFARSLYQFILTKSEIKGNLV-KIGQVSMDSSCTESVSYDLFGVKNDHSHFTIDVATGVIY-GKDLGSISNKTLMFQVSAKAPKSQT-SFAQVIIYIED-GIHQPGFDFSDLLVNIWENTTVGIEI--MQVFPKYPSVSDE--YQIIQSQYSDWLSIHSKTGQIFLNKQFDRE--QVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYC-KNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRM---------KIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNV-FYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPL-NVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQ--INIDSWTGLITTKVSLSCAQNVKIRIFV--SDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDL-----------NIFPENY-GAKCLFISNTTTS--VDGFLHLRFDSQQLILLK--DNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLK---NLEVVY-----------SIKQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVI--ATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVR-----ISAPTTENASIFQIVATDADSGPNSKLTYQI-NPSSDGIFMINGDSGEIHLVSS--------PRVSAYELNVTVRDSGE-VPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIG-----------------NSEIVQIPVVIQSLHDAS---IYDLQRIFINIDYGNENPPRFS-RSIFKVKLPEDEAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPP--VNSEIFYVL-NPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSN--ITYQFD----------RSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVP-EKAIFRV--KENSVDGTFIGQ-IKMVNYCKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVA---FLNEGQPPKTPVIRLTVYDPDIGF-NSQVEYFIEFYS--------SQEEFLIDA----------------NGDVKTNIPLNFH---------------------TKSVYDLVIK--------ASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRK---LTNQTLFLNVAFD--SGEIFLSRKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPIL 6979
            E    I + TG I+    +DRE +  YS + I ++G    V + + D NDN P F  T+     PEN P   K  L    D D    + Q   IVSG+    F +  H   +G+ Y+ L +   LD E    ++L+I+A+DGG PPL+  + V I +Q+ NDN P F+ SRY A++ E+  +  + L+V A+D DA  +G + Y ++   S     F +D +TG +Y+ K+LDFE  + H + +  +D+   P  T+  V + +  ++ N    ++  L      +I+    P   VA + + D D+ +               F L   + S + +I  LP   E+     + NY      L++ A D   P L  ++++ ++I +       FE    H+      D  +++L       +E  +     +    P               F+I+  TG I ++  IDC            +T  +    +L +V + G   PL                   FD+ F  + V   +   +C  +++  +  CG+    +Y +    +G   + E       G +C A  +   +  S  Y + + A D    S   ++   +Q + V D      P E  ++L   +SPK +       I+   +  P     G + Y +V      G   +D  +GEI         ++  P+H   I       +R   + V  L+I+    +   F ++ Y + + +   +G +V  +   S D +    V Y ++    D  +F+I+  +G I   K L   +   ++  + A   +       QV I +ED   + P F+ S + +++ E+  +G  +       K    S +  Y +++       +I +++G + L++  D E  Q   L+VT     +   +T    L  +   ++ P   +  + +    +  S+      +  SD D+  N  ++YR+           I    ++  F I P +G + + + L+    +      L V+ +DNG       +  + VR++DAN++ P    +   F I +    G+ VG +   D D+GEN  I  SL        F +  ++       + + E ++     L ++++ A D+G+P +S+ + + I+  + N N PEI  P Q   +        G+E+  V AVD D G N+   YSI    D++     +ID  +G+I T+V L   +    R+ V  SD G P   +     ++ L    +     + +L F + + +  G+VVG +           N   E++   +  +  N  T   ++    +   S  L++ +  D          +  +    +    SS + + + V  V  + P + +D P  L++ E  P G+ + +F         N ++ Y           S +Q    F ++ +TG L      D E   +    V+ +  +++V+  ++ T + + ++I D ND+ P+ +SP+SS  +     IS  T     +  IVA D DSG N +LTY+I   + +G F IN  +G I LV S         +   + L +  +D G+  PK  S+   +  Q        RFL       +        F++ Q++      + N ++ Y + AG    +F VD   G + T+    RE                    +S  V+      S+ D S    +D+  I+I +   N+N P F   S + + +PE+       TVVA+D D G    +IYS+ G     K  ID S+G+LS  PL+  + + Y L+I A+D  G    R+    + IFV++   +   F  + ++  V E++P GT + +I+ V     VN+ + Y L N       I+  +G + T G L  EL       +   A       +++ +  + + ++DINDN+PI    P    +P   QP + L K+ A D+D  +N  I Y  +          R +P+T  L     L  +SG L               L+V+  D G P + +  LI++ + +  Q   ++  +   +RV  KENS  GT + Q + + +  +    +FS   G    ++ L   +G+I V     +D    D+    +  +        Y++ I    + D N    SQ    +    L   QP +  V+ L     D  F  S  E  IE           SQ++F+                   + D  +N  L +H                     T  V D  I+        A+ +  P +     + V IV++ND +P    PN  + +     +G+ IT I+A D D    ++YR+       + N ++F   A D  SG++ L R+L      ++E D++  DA   +  V+ + V D+N++ P+ 
Sbjct:  120 ETDLAIDRATGEIRTKVKLDRETRASYSLVAIPLSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREI-----VSNY-----TLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPE---------THAQWFQIDPQTGLITTRSHIDC------------ETEPV---PQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTI---GEGFKHLTEFEVRSASGEICIAGELDFERRSS--YEFPVLATDRGGLSTTAMI--KMQLTDVNDNRPVFYPREYKVSL--RESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGN-EAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPD-GYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRD---RYQLTVLATDNG-TPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLP--INSSFQVHPVTG-----EISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADP-QEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQD-PIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTE-RLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPP-RFLQAVYRATILENVPSGSFVL-QVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASD-RGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMV--LATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLL-------------HLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLD---YDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVV-LVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFP-PNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIF---ALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVF 2532          

HSP 2 Score: 133.265 bits (334), Expect = 3.585e-30
Identity = 422/1973 (21.39%), Postives = 788/1973 (39.94%), Query Frame = 2
Query: 3101 LVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNVFY-IHQTAVYGTEVGTLLXXXXXXXXXXXXXXSL--KQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFC----PLLS-----GSEIFTVNAVDPD-KGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSL--SCAQNVKIRIFVSDLGFPKMTSSVDTLLKPL----YEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGA-KCLFISNTTTSVDGFLHLRFDSQQ-LILLKDNLNVKNVHY-SLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGS---HVASFNIRRLKNLEVVYSIKQPEKY---FVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSI-VRISAPTTENAS---IFQIVATDADSGPNSKLTYQINPSSD-GIFMINGDSGEIHLVSSPRVSA-----YELNVTVRDSGEVPKSV-SVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQS-LHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLTVV-ANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCSP-LNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINI--VKPPVNSEIFY-VLNPG-------------HSHIQINTTTGELRTNGPLHLELVEFIELTIHAF-----AKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTK-----------------LSATDSDKTSNITYQFD--------RSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQ--DHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVN--YCKDHSAKFSIIDGVN---HELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVI-IHXXXXXXNKPVFSQNKFV------AFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSS-----------QEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYI--VNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYR-IRHRKLTNQTLFLNVAF---DSGEIFLSRKLLVSDVGKHEFDIVVD--------DARFSSTAVIEIDVEDKNNHVPIL----KENGRVINL--SSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLID------EPQEKGHPYFLGIQLTDNA-IDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKAIFYKIDNFHPISNNLY-LDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNL------IDNKYITL----------------SLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESRIWNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHDIQ------YFLTPHENFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLL-IKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKL---GQILFTAYASDKDRGRFGIVSYQI-VENP--SENFGINNETGAIYIKNQFIIE 8482
            L+I + +G   PL   + +++ I D N++ PI   +  F  + + A  GT V  +   D D  ENG +E ++  +Q    Q F I+  +   ++ +    ET   +     ++++A D G     +   + I   + N N P I        +IF      P +S     G  +  ++  DPD K   +  N ++     +      D+   L+   + L      N  + +  +D G P + +S    L+        P+ E+ L + N+  +    + PG  V  +     + G    L  S   T        + D Q  LI  + +++ +      L VV     +  +SS   + V ++ V  + P+F + S   + + EN P G     V++ +     N  V Y+I +  K+   F +   +G++      D E  +  +F   V+AT      + T   + +++ D NDN P        + +R S   +  AS   I  +VATD D G   +++Y+I   ++ GIF I+  +GEI +V    +S      + LN++  D G +  +  +VVF     +++          +  +   +P+   G ++G +  +    +    +RY + +G     FS++  +G+++    +  E        Q+ + IQ+ L +  +Y   ++ I ++  N+N P F  S+ ++ +PE   +   L    A+D D G  G++ YSL  ++      ID  +G L  S  L++     + L + ATD  G+ +   + T +++ VQ+   +   F    +S+ V E+      + ++N   +    N+ I Y +++ G               H  I   +G +    PL  E  +  +LT+ A      A    TR I                         V++   N N P+   +K                 ++A+D D   N   ++         +  P T  +     LD +   L+              L V   D G P +   V + I ++   D+      P++ +  V+E    GT + +++ V+  + ++ S  +SI+ G +   H L  +  ++G I       +D E+     L    S GG+  R   +++ + V D++DN+P F+ +  V      A L       +P+ R      D+  NS  E F +   +           +  F ID + G++     L+   +S + L I+A    +        +TV I   ++ND  P+      +L++    PVG+ I   TA D+D G +G + YR IR+    N++    ++    DS    LS +  +      E+ ++V           R  ++  + + + D N+H P         G+  +L  S + + G  + ++ A+D+D  DNG++T+E+   +     R  ++ T  + L+       E  EKG  + L I   D+   +P+K   S   L ++++   +  PR +       TI E++ SGS + +   K L   +      +    ++N+L+ +D++ G +      +   Q  ++L V          ++S  +  Q   ++ G         +   YIT+                 L VPE   +P +I  ++  D +    +  + S+      N      F IDSS+        L   +    T+ I  + + Q      + N  +FV     E    N  +  ++ + TG + E+ P  T+V+++     D+       Y L     ++        SG  I +   LD E   +Y   +L   G  + +RS   T+ V+I+VLD+++  P F    +     G +P L   GQ L    A D D G    + Y +  EN   S  F IN  TGA+        E
Sbjct:  254 LLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELH----ELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTI-------NVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEV----ADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQ-SFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEF--PVLATDRGG--LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPR---GTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKS-----QVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDG-GVPSLSTNLT-ILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVI-------------------------VRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYD-------------LVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVV--LDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPA----DVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFR-INSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKK---SSLNLHLIVQGSHNNPPRFL-QAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPEN-SEPGVIHTVVASDLDEGPNADLIYSITGGNLGN-----KFSIDSSSGELSAR-PLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFV-----EDQNDNAPR-FKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAI--DGQSGL-ITTVGKLDRELQASYNFMVLATDGGRYEVRSA--TVPVQINVLDINDNRPIFERYPYI----GQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASE 2125          

HSP 3 Score: 120.168 bits (300), Expect = 3.283e-26
Identity = 392/1790 (21.90%), Postives = 716/1790 (40.00%), Query Frame = 2
Query: 2318 LVKIGQVSMDSSCTESVSYDLFGVKNDHSH--FTIDVATGVIYGK-----DLGSISNKTLMFQVSAKAPKSQTSFAQV-IIYIEDGIHQPGFDFSDLLVNIWENTTVGIEIMQVFP-KYP------SVSDEYQIIQSQYS----------DWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIGS-----ATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNP-------FEINPTTGCLLIISSLNIWNSNPSGIINLLVIVS----DNGPFKPLETEVEISVRIIDANNHSPILISTNV-------FYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEP---LNVMLIATDRGSPS-KSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVK--IRIFVSDLGFPKMTSSV--------DTL----------LKPLY------EPKSEEFLINKNLTFIIPDHSQPGY----VVGDLNIFPEN---YGAKCLFISN--TTTSVDGFLHLR-FDSQQLILLKDNLNVKNVHYSLNV-VFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHV---ASFNIRRLKNLEVVYSIKQPEKY-FVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTV-LPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGI---FMINGDSGEIHL---VSSPRVSAYELNVTVRDSGEVPK-SVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQ---------------TQHSVSREE--------------------------------IGNSEIVQIPVV-IQSLHDAS-IYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLTVV-ANDPDLGIFGRIIYSLEGDTFDKKIFIDPS-TGKLSCS-PLNFMEKNIYNLKIIATDSEGLSTGRKDFT-KVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPVNSEIFYVLNP-------GHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAE---NPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQ-YVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVF-LHESTGKIFVAAAAKIDREKID--KIILWTQVSCG-----GSEIRGYKKVIIHXXXXXXNKPVFSQN-KFVAFLNEGQPPKTPVIRLTVYDPDIGF--NSQVEYFIEFYSSQEEFLID-ANGDVKTNIPLNFHTKS-VYDLVIKA--SSKASPFVFAECRLTVYIVNI---NDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFD---IVVDDARFSSTAVIEIDVEDKNNHVPILKENGR--VINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWF 7117
            +V++  V  D     S++Y +   ++   H  F+ID  +GVI  +     +  SI    +        P+      +V ++ + D  ++P F  S L+  + E+  +G  +  + P + P      SV + ++ ++  Y+              I   +G + + +  DRE  S   + ++  +   S     + + + + + D+NDN P       +    + + +G +      +DAD+  NG+L YR+    P  +N         F ++  TG L + + L+        +   L+IV      +   + L+T V + +RI+DAN+H+P  +S N         +I      G  V  ++  DED G+NG++   +   +    F I   S+   +  VKSL       E     N+++ A D G P  K S +NL +    S+ NPP  +       ++   P  SGS +  V A       N+  +Y I   + N D  ++D   G+ITT+            + ++V D       SS         D++          +  +Y         S EF         +P++S+PG     V  DL+  P     Y      + N  +  S  G L  R  D +Q           +  Y+L +   ++    S   +  I + V     + P F K S     ++E+ P G+ V   ++ +     N  +VYS+    ++ F I+  +G + T    DRE +    F V  +AT     ++ +  +P+ + + D NDN P I      I ++ A      ++ ++ A DAD G N+++ Y +N  +  +   F IN  +G +     ++S       L V  RD G  P+ S+ ++  +  ++ +    +RF + +  + L    S SG  + Q+  +  S      +++   AG    I S+D ++G ++               +  ++SR                                  + NS+  +I VV +    DA  +     + I ++  N+N P+FS+  F   + E      F+  V A D D G   R+ Y +     D    I+P+ +G +  +  L+   ++IY LKIIATD EG+       T +V I   N  Q T   N     + V E +  G V+  I+         + Y L           S   ++  +G+L     L  EL +  EL + A       R++ T     +     +   Q  PA     P    I  S      L  ++ATD+D   N +      +P  Q  + ++  +G       +     S    +F+++I  D G P+  ++ L+ +  N +     Q +  +   ++ E +  G+ +  +++     D S   +II G N E  F L +S   + V     +DRE+ D  K+ L      G              VII + D +DN P+F ++ K+ A ++E  P +  + +L   D D     NS+V Y I   + +  F ID   G +  N  L++ + +  Y+L+I+A  S    P     C L  + + +   ND  PK  +      L  N PVGS + +  A D D GP G ++Y I     ++++ +     DS    ++   +     +  +D   +  D     ++  + +++E ++   P   E     V+  + +L +G  +  + A D D   +G+V ++L +    F
Sbjct: 1276 VVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLND--NRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQ-LNESQEQAMSLFRMDSLTGALSLQAPLDF-----EAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRIN--SQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVP--SGSFVLQVTAKSLHGAENANLSYEIPAGVAN-DLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQ-----------HSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRF-KLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMV--LATDGGRYEVRSATVPVQINVLDINDNRP-IFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKE-NSPSGTRLLQV-VALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATD-EGVPQMTGTATIRVQIVDVNDNQPTFPPNNL---VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPA-QEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVV--LQLGQDALDQS--LAIIAG-NEESAFELLQSKAIVLVK---PLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPL----CSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAP-SDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSHF 3017          

HSP 4 Score: 117.472 bits (293), Expect = 2.582e-25
Identity = 87/310 (28.06%), Postives = 144/310 (46.45%), Query Frame = 2
Query:  122 FSIKENVPIGEVVGQIESP----GFSPPFEMHDFQ---EKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDT-----KNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFL-----DNTSPS------SDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSK 982
            + +KE++P G VVG + +         P     +    +  F I   +G I+++  +D E ++     I +  G+        V I++ DVNDN P+F A+    S+PE+  +G+ +      D D G +   +  +V    + +FAID            LIL Q LDYE   +  L++ A DGG P L  +L + + VQ+ NDN P F+   Y  ++ E + IN   ++V A+D D G +  + Y +     DN + S      S  F +   +G +YLR  LD E    + +++   DN  P   +K
Sbjct:  834 YYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSG-------HLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAK 1136          

HSP 5 Score: 105.916 bits (263), Expect = 7.811e-22
Identity = 80/268 (29.85%), Postives = 134/268 (50.00%), Query Frame = 2
Query:  212 QEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMN-GD-----TKNVQIKILDVNDNEPKFN----ATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPS-SDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNS-PPFHTS 979
            +E+ F I   TG I ++  +D E + L+  ++++ + G+     T  V I++ DVNDN+P  N    + +    I E+   G  V   +V DPD  K    +V +     +  FA+   D  N I+ V  I+   LD EI+S + L + A D G PPL AS  + + + + NDN P+F+   Y A++ E  +   + L+V A D D G++  L Y L  T  + + +F +D +TG +  R  +D E      +++  RD   PP  ++
Sbjct:  332 KEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDS-KTEYANVNVTLNGGDGHFALTTRD--NSIYLV--IVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSST 594          

HSP 6 Score: 103.99 bits (258), Expect = 2.913e-21
Identity = 304/1472 (20.65%), Postives = 584/1472 (39.67%), Query Frame = 2
Query: 4274 EKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSI-VRISAPTTENASIFQIVATDADSGPNSKLTYQI-------------NPSSDGIFMINGD-SGEIHLVSSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKS-GFIIGQLSYSQTSSSGNLDIRYYL--IAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPR----FSRSIFKVKLPEDEAITNFLTVVA-NDPDLGI-FGRIIYSLEGD-------TFDKKIFIDPSTGKLSCSPLNFMEKNIYNLKIIATD--SEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLE-NSPGGTVLGRINIVKPP-VNSEIFYVLN---PGHSH-IQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKM---YLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMV-------NYCKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVI-IHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDA---RFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVST--------------SPWFGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVL------LKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLD--SDKAIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKEN-KGPNLIDNKYITLSLQVPEMIQKPAI-ISNLLQMDKNSFRYSYYLISVAPEQPENIY-----DPPSFQIDSSNILWWINGDLFESRIWNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVP----EKMIGNLRKCVEIKRLTGVINENEPPKTTVL-KLPEWYHDIQ--YFLTP--HENFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIV 8407
            E    I+  TG++ T    DRET    +    ++A  +S   I     ++V + DENDN P    P +S+ +     T        + A D D  P +   Y I             +   DG+  ++   SG +   ++P    Y L +   D G  P    +  +I  Q +     I    N      ++P++ + G  + Q+  S T +  N  + Y +        Q+F +DP TG++    ++  E     E+ ++ VV +   +  +     + I +   N+N P     F       K+ E      F+  ++ +DPD    +  +  +L G        T D  I++      +   PL+    + Y L ++ATD  +  L   +  F ++     N  +    F    +   V+E   PG +VL  +   +   +NS + Y L      H+   QI+  TG + T   +  E     +LT+ A    +   S   ++A + V I D+NDN+PI  ++   + +  +    + + K+SA+D D   N    +     T    +K    + +   SG + +   +    +  +   V+ +D G  S    + + ++   D++ V   P +    ++E+    +      +V       +Y       + I+ G    +  +  STG+IFV     +        +L    + GG+       V+ + + D     P+F + ++  ++ E  P  T V  +     D+   S V Y I        F I+ N G+++   PL+   KS   L I+A +   P V+   ++ + + ++ND  P+       + +  +  +G+ +    A D D G  G ++Y +   K + + LF  +   SG + LS+ L      +H   +   D      S+   I +DV+D N++ P+ +++   +N+S S    ++I+ ++A D D  +N ++T+ +V                S  FG+  F N+          +E    Y L +  TDN   P     +   + VL       K+ +S +         E  I E+L+ GS +      DLD   + AI Y +    PI+++  +   +G++   + L+  ++  + L+V     G+P +     + + +   N   P + D +   +S++     Q P   +  +  +D++  + +    S+   +  + +     DP S  I +  +L     D  E  I+ L +              +     L +N   P      ++  +R+   +  + G I+  E P   V   + E + D++  Y L P   +  E      + SG N+    +LD E    +RL++    +       S  I V+I V D+++  PE+        V    P +G I+    A+D D G  G + Y+++
Sbjct:  120 ETDLAIDRATGEIRTKVKLDRET----RASYSLVAIPLSGRNIR----VLVTVKDENDNAPTF--PQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTP---GYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPI---FNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFE---TKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYL-----VIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPE----FEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLS---STATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNY-----TIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPV-FYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQA-TLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSL--VKESGKGLFA-IDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGI--FPNSGWIYLRAPLDRETRDRYQLTVLATDNGT-PAAHAKTRVIVRVLDANDNDPKFQKSKY---------EFRIEENLRRGSVVGVVTASDLDLGENAAIRYSL---LPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREE---QPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVL-----DHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSG-NLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATP-VGTIIHNFTATDADTGTNGDLQYRLI 1525          

HSP 7 Score: 97.8265 bits (242), Expect = 2.297e-19
Identity = 92/320 (28.75%), Postives = 134/320 (41.88%), Query Frame = 2
Query:  125 SIKENVPIGEVVGQIESPGFS-----------PPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMN---------------------GDTKNVQ--------IKILDVNDNEPKFN-ATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHP-PLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDN 958
            +I ENVP G  V Q+ +               P    +D     F +    G+I   G  DRE Q  Y   +   +                     GDT N Q        I + DVNDN P+F   + +  S+PEN   G  +      D DEG N+     I  G+    F+ID   SS+G    R      LD E  S++ L IQA D G P   Q    + I V++ NDN P+F +S+Y  S++ED  +  + +++ A D D GV+  L Y L N +     F +D ++G +     LD E   S++  +   D 
Sbjct: 1727 TILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDL----FHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKFSID---SSSGELSAR-----PLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQ--FAIDGQSGLITTVGKLDRELQASYNFMVLATDG 2031          

HSP 8 Score: 95.9005 bits (237), Expect = 8.635e-19
Identity = 90/335 (26.87%), Postives = 151/335 (45.07%), Query Frame = 2
Query:  107 SNLLIFSIKENVPIGEVVGQI---ESPG------FSPPFE-----------MHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKN--------VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIV------SGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGH---PPLQASLLVKIIVQNANDNVPKF----DISRYIAS--IKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSL-----DFEKSKSHHISIGVRDNSPP 967
            S+ L+F ++E+  +G VVG I   E P           FE             D  E  F I + +G + V+ L+DRE Q+ +   I +++    N        V+I++ DVNDN P++     +  + E  P+G+ +   T  D D G N     R++      +   E+  ++   DS  G     L L+  LD+E + ++ L++QA+D        LQ S+ V++ + +AND+ P F          AS  I +   I      + A D D+G +G+L Y +   +     F ++ +TG + L KSL     D EK    ++ IG +D+  P
Sbjct: 1367 SSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGA----LSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGN-GEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQP 1696          

HSP 9 Score: 82.0333 bits (201), Expect = 1.282e-14
Identity = 79/298 (26.51%), Postives = 136/298 (45.64%), Query Frame = 2
Query:  128 IKENVPIGEVVGQIESPGFSPPFEM-HDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLII------------SMNGDTKNVQIKILDVNDNEPKFN-ATNFEKSIPENYPIGSKVDLTTVFDPDEGK--NSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQ-FNLVIQAIDGGHP-PLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSD----FFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD 955
            I E  P+G VV Q+          +    +E  F + ++  ++ V  L DRE+ +LY   ++              +    +V I ILD NDN P F+ +  +E  I E  P+   +      D D+    NS     I SG+ E +F ID      G+ +V       LDY+  ++ + L+I+A D  H  PL +    ++ + + NDN PKF ++ Y+  + E++ +  +  R  A+D D G  G+L Y +   +PS +     F VD ++G V      D+E+ + + + +   D
Sbjct: 2657 ISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSKAIVLVKPL-DRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDL---VTGVLFV----NNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSI-GPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASD 2945          

HSP 10 Score: 80.8777 bits (198), Expect = 2.892e-14
Identity = 66/236 (27.97%), Postives = 108/236 (45.76%), Query Frame = 2
Query:  122 FSIKENVPIGEVVGQIESPGFSPPFEMHDFQE------------KKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTK------NVQIKILDVNDNEPKFNATNFEK-SIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSG---DSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEIN 763
            F I+EN+  G VVG + +          D  E              F +   TG I     +DRE + LY  ++ + +  T        V+I + DVNDN P+      +  S+ E  P G++V      D D G+N+  +  IV G   D   +F+ID    ++G+   R++L    D+E  S + L + A DGG+PP +   ++++ V + NDN P F  S  +  ++ED  + 
Sbjct: 1160 FRIEENLRRGSVVGVVTASDL-------DLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSID---PTSGVIRTRVVL----DHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALG 1381          

HSP 11 Score: 73.9442 bits (180), Expect = 3.831e-12
Identity = 67/257 (26.07%), Postives = 122/257 (47.47%), Query Frame = 2
Query:  212 QEKKFIISKT-TGVIKVSGLIDREKQNLYSFLIIS-------MNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDE--------GKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVP---------KFDISRYIASIKEDQEINITFLRVRATDNDA-GVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKS 904
             +  F+I    +G+++ + ++DRE +++Y   II+       M G T  ++++I+DVNDN+P F   N   ++ E   +G+ +   +  D D         G  S   +  +S     +FA+D +         +L+LK+ LDYE+  ++ L + A D  H   +A  ++ + V + NDN P          F I   I+ I E   ++   L V ATD D+ G + ++ Y ++   P+ + F+V    G V +  S
Sbjct: 2366 HDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTG-TATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMS-----IFALDRYSG-------KLVLKRRLDYELQQEYELDVIASDAAH---EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIE---PAQEGFSVHPSNGVVSVNMS 2602          

HSP 12 Score: 69.3218 bits (168), Expect = 8.300e-11
Identity = 71/282 (25.18%), Postives = 125/282 (44.33%), Query Frame = 2
Query:  125 SIKENVPIGEVVGQIESP----GFSPP--FEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGD-------TKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVP--KFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKS--LDFEK 919
            S++E+ P+G  V QI +     G +    + + +  + +F I   +G+I   G +DRE Q  Y+F++++ +G        T  VQI +LD+NDN P F    +   +P     G  +      D D G N+ + V  ++ ++  V A    + S G     L   QSL  E     +L + A D G+PP  +  L+++++  A    P  +F    Y   +KE+       L+V A  +D       F F           ++D  +G + + K   LD+++
Sbjct: 1960 SVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANA-EIVYSLNAENSAVSAKFRINPSTGA----LSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSF--GAGNEDGILSLDSLSGEIRVNKPHLLDYDR 2234          

HSP 13 Score: 64.6994 bits (156), Expect = 2.022e-9
Identity = 73/289 (25.26%), Postives = 131/289 (45.33%), Query Frame = 2
Query:  131 KENVPIGEVVGQIESPGFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREK-QNLYSFLIISMNGDTKN-------VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSE----KVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFL--RVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD 955
            +EN P  EVV  I S             E  F I   TGV+ V+  +D +     Y  +I + +   +         ++++ D NDNEPKF  T +   + EN P+GS V      D D+G     +  I    S+    K+F +D   S +G+     +     DYE   ++++ + A D G    +AS+ V++ +++ ++  P+F    Y   +     +   ++  +V ATD+D+G  G + Y L  ++P S  F V+  +G V +++ L  +     ++ +  RD
Sbjct: 2782 QENTPNSEVVYDITSGN----------DEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVD---SESGLVTSAFVF----DYEQRQRYDMELLASDMGGK--KASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQL--SAPHS-HFKVNRSSGAVLIKRKLKLDGDGDGNLYMDGRD 3048          

HSP 14 Score: 56.9954 bits (136), Expect = 4.578e-7
Identity = 70/291 (24.05%), Postives = 123/291 (42.27%), Query Frame = 2
Query: 6908 DARF-SSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTE------------------ITIPESLKSGSKITKFVCKDLDSDKAIFYKIDNFHPIS-NNL---YLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQ-KPAI--ISNLLQMD 7702
            DA F +S A + I++ED+N++ P   +   V  +S    +G+ +  +HA D D   N ++ + +V           D N    F+I+       P F GI  T+  +D  + +  I+ L ++        P++ G  +                    +T+ E+ + G+ IT     D+D+  A+ Y++     +   N+    LD  SG L L + L+Y +Q  + L V  +      +     L+V++  EN      DN  + L+ Q P      PAI  IS  L +D
Sbjct: 2298 DAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIV-----------DGNHDNAFVIE-------PAFSGIVRTNIVLD--REIRDIYKLKIIAT--DEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTV---LTVRVNDEN------DNAPVFLAQQPPAYFAILPAISEISESLSVD 2557          
BLAST of Dachsous vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 361.688 bits (927), Expect = 2.424e-99
Identity = 574/2498 (22.98%), Postives = 1028/2498 (41.15%), Query Frame = 2
Query:  215 EKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLD-NTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSP-PFHTSK-XXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDAIST-------------SFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHE----SILFENSFSHSRFQVEID--STIL-------NENQHVTFVKTTKRLPTKPIFIFKIFVLNNLFKINETTGEILSKRSIDCGKYFFNVSMLSLKTNSLIDQTKLEIVVKSGRKLPL------------------YFDRGFRKILVTTGK--SQCFSEIAVRNRHCGMRIQYSYDLLLKTDGILRINE------HGALCTAENVKHNKLMSTRYLYQIKALDETNSSAVCVVLFAIQPSKVFD----VLPTEINITLPIIDSPKFNFSLPIGKIIGTFSKLPPAQFIGFIQYHLVPEELSTGAITVDSQSGEIL--------MKKFPIHKNPIRLIVKSVIRKPFN-VSPLNIVAINFQKLFFARSLYQFILTKSEIKGNLV-KIGQVSMDSSCTESVSYDLFGVKNDHSHFTIDVATGVIY-GKDLGSISNKTLMFQVSAKAPKSQT-SFAQVIIYIED-GIHQPGFDFSDLLVNIWENTTVGIEI--MQVFPKYPSVSDE--YQIIQSQYSDWLSIHSKTGQIFLNKQFDRE--QVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYC-KNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRM---------KIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNV-FYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPL-NVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQ--INIDSWTGLITTKVSLSCAQNVKIRIFV--SDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDL-----------NIFPENY-GAKCLFISNTTTS--VDGFLHLRFDSQQLILLK--DNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLK---NLEVVY-----------SIKQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVI--ATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVR-----ISAPTTENASIFQIVATDADSGPNSKLTYQI-NPSSDGIFMINGDSGEIHLVSS--------PRVSAYELNVTVRDSGE-VPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIG-----------------NSEIVQIPVVIQSLHDAS---IYDLQRIFINIDYGNENPPRFS-RSIFKVKLPEDEAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPP--VNSEIFYVL-NPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSN--ITYQFD----------RSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVP-EKAIFRV--KENSVDGTFIGQ-IKMVNYCKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVA---FLNEGQPPKTPVIRLTVYDPDIGF-NSQVEYFIEFYS--------SQEEFLIDA----------------NGDVKTNIPLNFH---------------------TKSVYDLVIK--------ASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRK---LTNQTLFLNVAFD--SGEIFLSRKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPIL 6979
            E    I + TG I+    +DRE +  YS + I ++G    V + + D NDN P F  T+     PEN P   K  L    D D    + Q   IVSG+    F +  H   +G+ Y+ L +   LD E    ++L+I+A+DGG PPL+  + V I +Q+ NDN P F+ SRY A++ E+  +  + L+V A+D DA  +G + Y ++   S     F +D +TG +Y+ K+LDFE  + H + +  +D+   P  T+  V + +  ++ N    ++  L      +I+    P   VA + + D D+ +               F L   + S + +I  LP   E+     + NY      L++ A D   P L  ++++ ++I +       FE    H+      D  +++L       +E  +     +    P               F+I+  TG I ++  IDC            +T  +    +L +V + G   PL                   FD+ F  + V   +   +C  +++  +  CG+    +Y +    +G   + E       G +C A  +   +  S  Y + + A D    S   ++   +Q + V D      P E  ++L   +SPK +       I+   +  P     G + Y +V      G   +D  +GEI         ++  P+H   I       +R   + V  L+I+    +   F ++ Y + + +   +G +V  +   S D +    V Y ++    D  +F+I+  +G I   K L   +   ++  + A   +       QV I +ED   + P F+ S + +++ E+  +G  +       K    S +  Y +++       +I +++G + L++  D E  Q   L+VT     +   +T    L  +   ++ P   +  + +    +  S+      +  SD D+  N  ++YR+           I    ++  F I P +G + + + L+    +      L V+ +DNG       +  + VR++DAN++ P    +   F I +    G+ VG +   D D+GEN  I  SL        F +  ++       + + E ++     L ++++ A D+G+P +S+ + + I+  + N N PEI  P Q   +        G+E+  V AVD D G N+   YSI    D++     +ID  +G+I T+V L   +    R+ V  SD G P   +     ++ L    +     + +L F + + +  G+VVG +           N   E++   +  +  N  T   ++    +   S  L++ +  D          +  +    +    SS + + + V  V  + P + +D P  L++ E  P G+ + +F         N ++ Y           S +Q    F ++ +TG L      D E   +    V+ +  +++V+  ++ T + + ++I D ND+ P+ +SP+SS  +     IS  T     +  IVA D DSG N +LTY+I   + +G F IN  +G I LV S         +   + L +  +D G+  PK  S+   +  Q        RFL       +        F++ Q++      + N ++ Y + AG    +F VD   G + T+    RE                    +S  V+      S+ D S    +D+  I+I +   N+N P F   S + + +PE+       TVVA+D D G    +IYS+ G     K  ID S+G+LS  PL+  + + Y L+I A+D  G    R+    + IFV++   +   F  + ++  V E++P GT + +I+ V     VN+ + Y L N       I+  +G + T G L  EL       +   A       +++ +  + + ++DINDN+PI    P    +P   QP + L K+ A D+D  +N  I Y  +          R +P+T  L     L  +SG L               L+V+  D G P + +  LI++ + +  Q   ++  +   +RV  KENS  GT + Q + + +  +    +FS   G    ++ L   +G+I V     +D    D+    +  +        Y++ I    + D N    SQ    +    L   QP +  V+ L     D  F  S  E  IE           SQ++F+                   + D  +N  L +H                     T  V D  I+        A+ +  P +     + V IV++ND +P    PN  + +     +G+ IT I+A D D    ++YR+       + N ++F   A D  SG++ L R+L      ++E D++  DA   +  V+ + V D+N++ P+ 
Sbjct:  120 ETDLAIDRATGEIRTKVKLDRETRASYSLVAIPLSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREI-----VSNY-----TLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPE---------THAQWFQIDPQTGLITTRSHIDC------------ETEPV---PQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTI---GEGFKHLTEFEVRSASGEICIAGELDFERRSS--YEFPVLATDRGGLSTTAMI--KMQLTDVNDNRPVFYPREYKVSL--RESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGN-EAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPD-GYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRD---RYQLTVLATDNG-TPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLP--INSSFQVHPVTG-----EISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADP-QEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQD-PIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTE-RLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPP-RFLQAVYRATILENVPSGSFVL-QVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASD-RGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMV--LATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLL-------------HLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLD---YDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVV-LVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFP-PNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIF---ALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVF 2532          

HSP 2 Score: 133.265 bits (334), Expect = 3.585e-30
Identity = 422/1973 (21.39%), Postives = 788/1973 (39.94%), Query Frame = 2
Query: 3101 LVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNVFY-IHQTAVYGTEVGTLLXXXXXXXXXXXXXXSL--KQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFC----PLLS-----GSEIFTVNAVDPD-KGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSL--SCAQNVKIRIFVSDLGFPKMTSSVDTLLKPL----YEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGA-KCLFISNTTTSVDGFLHLRFDSQQ-LILLKDNLNVKNVHY-SLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGS---HVASFNIRRLKNLEVVYSIKQPEKY---FVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSI-VRISAPTTENAS---IFQIVATDADSGPNSKLTYQINPSSD-GIFMINGDSGEIHLVSSPRVSA-----YELNVTVRDSGEVPKSV-SVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQS-LHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLTVV-ANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCSP-LNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINI--VKPPVNSEIFY-VLNPG-------------HSHIQINTTTGELRTNGPLHLELVEFIELTIHAF-----AKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTK-----------------LSATDSDKTSNITYQFD--------RSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQ--DHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVN--YCKDHSAKFSIIDGVN---HELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVI-IHXXXXXXNKPVFSQNKFV------AFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSS-----------QEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYI--VNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYR-IRHRKLTNQTLFLNVAF---DSGEIFLSRKLLVSDVGKHEFDIVVD--------DARFSSTAVIEIDVEDKNNHVPIL----KENGRVINL--SSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLID------EPQEKGHPYFLGIQLTDNA-IDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKAIFYKIDNFHPISNNLY-LDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNL------IDNKYITL----------------SLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESRIWNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHDIQ------YFLTPHENFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLL-IKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKL---GQILFTAYASDKDRGRFGIVSYQI-VENP--SENFGINNETGAIYIKNQFIIE 8482
            L+I + +G   PL   + +++ I D N++ PI   +  F  + + A  GT V  +   D D  ENG +E ++  +Q    Q F I+  +   ++ +    ET   +     ++++A D G     +   + I   + N N P I        +IF      P +S     G  +  ++  DPD K   +  N ++     +      D+   L+   + L      N  + +  +D G P + +S    L+        P+ E+ L + N+  +    + PG  V  +     + G    L  S   T        + D Q  LI  + +++ +      L VV     +  +SS   + V ++ V  + P+F + S   + + EN P G     V++ +     N  V Y+I +  K+   F +   +G++      D E  +  +F   V+AT      + T   + +++ D NDN P        + +R S   +  AS   I  +VATD D G   +++Y+I   ++ GIF I+  +GEI +V    +S      + LN++  D G +  +  +VVF     +++          +  +   +P+   G ++G +  +    +    +RY + +G     FS++  +G+++    +  E        Q+ + IQ+ L +  +Y   ++ I ++  N+N P F  S+ ++ +PE   +   L    A+D D G  G++ YSL  ++      ID  +G L  S  L++     + L + ATD  G+ +   + T +++ VQ+   +   F    +S+ V E+      + ++N   +    N+ I Y +++ G               H  I   +G +    PL  E  +  +LT+ A      A    TR I                         V++   N N P+   +K                 ++A+D D   N   ++         +  P T  +     LD +   L+              L V   D G P +   V + I ++   D+      P++ +  V+E    GT + +++ V+  + ++ S  +SI+ G +   H L  +  ++G I       +D E+     L    S GG+  R   +++ + V D++DN+P F+ +  V      A L       +P+ R      D+  NS  E F +   +           +  F ID + G++     L+   +S + L I+A    +        +TV I   ++ND  P+      +L++    PVG+ I   TA D+D G +G + YR IR+    N++    ++    DS    LS +  +      E+ ++V           R  ++  + + + D N+H P         G+  +L  S + + G  + ++ A+D+D  DNG++T+E+   +     R  ++ T  + L+       E  EKG  + L I   D+   +P+K   S   L ++++   +  PR +       TI E++ SGS + +   K L   +      +    ++N+L+ +D++ G +      +   Q  ++L V          ++S  +  Q   ++ G         +   YIT+                 L VPE   +P +I  ++  D +    +  + S+      N      F IDSS+        L   +    T+ I  + + Q      + N  +FV     E    N  +  ++ + TG + E+ P  T+V+++     D+       Y L     ++        SG  I +   LD E   +Y   +L   G  + +RS   T+ V+I+VLD+++  P F    +     G +P L   GQ L    A D D G    + Y +  EN   S  F IN  TGA+        E
Sbjct:  254 LLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELH----ELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTI-------NVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEV----ADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQ-SFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEF--PVLATDRGG--LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPR---GTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKS-----QVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDG-GVPSLSTNLT-ILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVI-------------------------VRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYD-------------LVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVV--LDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPA----DVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFR-INSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKK---SSLNLHLIVQGSHNNPPRFL-QAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPEN-SEPGVIHTVVASDLDEGPNADLIYSITGGNLGN-----KFSIDSSSGELSAR-PLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFV-----EDQNDNAPR-FKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAI--DGQSGL-ITTVGKLDRELQASYNFMVLATDGGRYEVRSA--TVPVQINVLDINDNRPIFERYPYI----GQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASE 2125          

HSP 3 Score: 120.168 bits (300), Expect = 3.283e-26
Identity = 392/1790 (21.90%), Postives = 716/1790 (40.00%), Query Frame = 2
Query: 2318 LVKIGQVSMDSSCTESVSYDLFGVKNDHSH--FTIDVATGVIYGK-----DLGSISNKTLMFQVSAKAPKSQTSFAQV-IIYIEDGIHQPGFDFSDLLVNIWENTTVGIEIMQVFP-KYP------SVSDEYQIIQSQYS----------DWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIGS-----ATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNP-------FEINPTTGCLLIISSLNIWNSNPSGIINLLVIVS----DNGPFKPLETEVEISVRIIDANNHSPILISTNV-------FYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEP---LNVMLIATDRGSPS-KSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVK--IRIFVSDLGFPKMTSSV--------DTL----------LKPLY------EPKSEEFLINKNLTFIIPDHSQPGY----VVGDLNIFPEN---YGAKCLFISN--TTTSVDGFLHLR-FDSQQLILLKDNLNVKNVHYSLNV-VFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHV---ASFNIRRLKNLEVVYSIKQPEKY-FVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTV-LPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGI---FMINGDSGEIHL---VSSPRVSAYELNVTVRDSGEVPK-SVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQ---------------TQHSVSREE--------------------------------IGNSEIVQIPVV-IQSLHDAS-IYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLTVV-ANDPDLGIFGRIIYSLEGDTFDKKIFIDPS-TGKLSCS-PLNFMEKNIYNLKIIATDSEGLSTGRKDFT-KVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPVNSEIFYVLNP-------GHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAE---NPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQ-YVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVF-LHESTGKIFVAAAAKIDREKID--KIILWTQVSCG-----GSEIRGYKKVIIHXXXXXXNKPVFSQN-KFVAFLNEGQPPKTPVIRLTVYDPDIGF--NSQVEYFIEFYSSQEEFLID-ANGDVKTNIPLNFHTKS-VYDLVIKA--SSKASPFVFAECRLTVYIVNI---NDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFD---IVVDDARFSSTAVIEIDVEDKNNHVPILKENGR--VINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWF 7117
            +V++  V  D     S++Y +   ++   H  F+ID  +GVI  +     +  SI    +        P+      +V ++ + D  ++P F  S L+  + E+  +G  +  + P + P      SV + ++ ++  Y+              I   +G + + +  DRE  S   + ++  +   S     + + + + + D+NDN P       +    + + +G +      +DAD+  NG+L YR+    P  +N         F ++  TG L + + L+        +   L+IV      +   + L+T V + +RI+DAN+H+P  +S N         +I      G  V  ++  DED G+NG++   +   +    F I   S+   +  VKSL       E     N+++ A D G P  K S +NL +    S+ NPP  +       ++   P  SGS +  V A       N+  +Y I   + N D  ++D   G+ITT+            + ++V D       SS         D++          +  +Y         S EF         +P++S+PG     V  DL+  P     Y      + N  +  S  G L  R  D +Q           +  Y+L +   ++    S   +  I + V     + P F K S     ++E+ P G+ V   ++ +     N  +VYS+    ++ F I+  +G + T    DRE +    F V  +AT     ++ +  +P+ + + D NDN P I      I ++ A      ++ ++ A DAD G N+++ Y +N  +  +   F IN  +G +     ++S       L V  RD G  P+ S+ ++  +  ++ +    +RF + +  + L    S SG  + Q+  +  S      +++   AG    I S+D ++G ++               +  ++SR                                  + NS+  +I VV +    DA  +     + I ++  N+N P+FS+  F   + E      F+  V A D D G   R+ Y +     D    I+P+ +G +  +  L+   ++IY LKIIATD EG+       T +V I   N  Q T   N     + V E +  G V+  I+         + Y L           S   ++  +G+L     L  EL +  EL + A       R++ T     +     +   Q  PA     P    I  S      L  ++ATD+D   N +      +P  Q  + ++  +G       +     S    +F+++I  D G P+  ++ L+ +  N +     Q +  +   ++ E +  G+ +  +++     D S   +II G N E  F L +S   + V     +DRE+ D  K+ L      G              VII + D +DN P+F ++ K+ A ++E  P +  + +L   D D     NS+V Y I   + +  F ID   G +  N  L++ + +  Y+L+I+A  S    P     C L  + + +   ND  PK  +      L  N PVGS + +  A D D GP G ++Y I     ++++ +     DS    ++   +     +  +D   +  D     ++  + +++E ++   P   E     V+  + +L +G  +  + A D D   +G+V ++L +    F
Sbjct: 1276 VVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLND--NRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQ-LNESQEQAMSLFRMDSLTGALSLQAPLDF-----EAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRIN--SQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVP--SGSFVLQVTAKSLHGAENANLSYEIPAGVAN-DLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQ-----------HSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRF-KLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMV--LATDGGRYEVRSATVPVQINVLDINDNRP-IFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKE-NSPSGTRLLQV-VALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATD-EGVPQMTGTATIRVQIVDVNDNQPTFPPNNL---VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPA-QEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVV--LQLGQDALDQS--LAIIAG-NEESAFELLQSKAIVLVK---PLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPL----CSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAP-SDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSHF 3017          

HSP 4 Score: 117.472 bits (293), Expect = 2.582e-25
Identity = 87/310 (28.06%), Postives = 144/310 (46.45%), Query Frame = 2
Query:  122 FSIKENVPIGEVVGQIESP----GFSPPFEMHDFQ---EKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDT-----KNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFL-----DNTSPS------SDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSK 982
            + +KE++P G VVG + +         P     +    +  F I   +G I+++  +D E ++     I +  G+        V I++ DVNDN P+F A+    S+PE+  +G+ +      D D G +   +  +V    + +FAID            LIL Q LDYE   +  L++ A DGG P L  +L + + VQ+ NDN P F+   Y  ++ E + IN   ++V A+D D G +  + Y +     DN + S      S  F +   +G +YLR  LD E    + +++   DN  P   +K
Sbjct:  834 YYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSG-------HLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAK 1136          

HSP 5 Score: 105.916 bits (263), Expect = 7.811e-22
Identity = 80/268 (29.85%), Postives = 134/268 (50.00%), Query Frame = 2
Query:  212 QEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMN-GD-----TKNVQIKILDVNDNEPKFN----ATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPS-SDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNS-PPFHTS 979
            +E+ F I   TG I ++  +D E + L+  ++++ + G+     T  V I++ DVNDN+P  N    + +    I E+   G  V   +V DPD  K    +V +     +  FA+   D  N I+ V  I+   LD EI+S + L + A D G PPL AS  + + + + NDN P+F+   Y A++ E  +   + L+V A D D G++  L Y L  T  + + +F +D +TG +  R  +D E      +++  RD   PP  ++
Sbjct:  332 KEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDS-KTEYANVNVTLNGGDGHFALTTRD--NSIYLV--IVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSST 594          

HSP 6 Score: 103.99 bits (258), Expect = 2.913e-21
Identity = 304/1472 (20.65%), Postives = 584/1472 (39.67%), Query Frame = 2
Query: 4274 EKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSI-VRISAPTTENASIFQIVATDADSGPNSKLTYQI-------------NPSSDGIFMINGD-SGEIHLVSSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKS-GFIIGQLSYSQTSSSGNLDIRYYL--IAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPR----FSRSIFKVKLPEDEAITNFLTVVA-NDPDLGI-FGRIIYSLEGD-------TFDKKIFIDPSTGKLSCSPLNFMEKNIYNLKIIATD--SEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLE-NSPGGTVLGRINIVKPP-VNSEIFYVLN---PGHSH-IQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKM---YLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMV-------NYCKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVI-IHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDA---RFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVST--------------SPWFGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVL------LKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLD--SDKAIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKEN-KGPNLIDNKYITLSLQVPEMIQKPAI-ISNLLQMDKNSFRYSYYLISVAPEQPENIY-----DPPSFQIDSSNILWWINGDLFESRIWNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVP----EKMIGNLRKCVEIKRLTGVINENEPPKTTVL-KLPEWYHDIQ--YFLTP--HENFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIV 8407
            E    I+  TG++ T    DRET    +    ++A  +S   I     ++V + DENDN P    P +S+ +     T        + A D D  P +   Y I             +   DG+  ++   SG +   ++P    Y L +   D G  P    +  +I  Q +     I    N      ++P++ + G  + Q+  S T +  N  + Y +        Q+F +DP TG++    ++  E     E+ ++ VV +   +  +     + I +   N+N P     F       K+ E      F+  ++ +DPD    +  +  +L G        T D  I++      +   PL+    + Y L ++ATD  +  L   +  F ++     N  +    F    +   V+E   PG +VL  +   +   +NS + Y L      H+   QI+  TG + T   +  E     +LT+ A    +   S   ++A + V I D+NDN+PI  ++   + +  +    + + K+SA+D D   N    +     T    +K    + +   SG + +   +    +  +   V+ +D G  S    + + ++   D++ V   P +    ++E+    +      +V       +Y       + I+ G    +  +  STG+IFV     +        +L    + GG+       V+ + + D     P+F + ++  ++ E  P  T V  +     D+   S V Y I        F I+ N G+++   PL+   KS   L I+A +   P V+   ++ + + ++ND  P+       + +  +  +G+ +    A D D G  G ++Y +   K + + LF  +   SG + LS+ L      +H   +   D      S+   I +DV+D N++ P+ +++   +N+S S    ++I+ ++A D D  +N ++T+ +V                S  FG+  F N+          +E    Y L +  TDN   P     +   + VL       K+ +S +         E  I E+L+ GS +      DLD   + AI Y +    PI+++  +   +G++   + L+  ++  + L+V     G+P +     + + +   N   P + D +   +S++     Q P   +  +  +D++  + +    S+   +  + +     DP S  I +  +L     D  E  I+ L +              +     L +N   P      ++  +R+   +  + G I+  E P   V   + E + D++  Y L P   +  E      + SG N+    +LD E    +RL++    +       S  I V+I V D+++  PE+        V    P +G I+    A+D D G  G + Y+++
Sbjct:  120 ETDLAIDRATGEIRTKVKLDRET----RASYSLVAIPLSGRNIR----VLVTVKDENDNAPTF--PQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTP---GYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPI---FNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFE---TKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYL-----VIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPE----FEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLS---STATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNY-----TIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPV-FYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQA-TLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSL--VKESGKGLFA-IDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGI--FPNSGWIYLRAPLDRETRDRYQLTVLATDNGT-PAAHAKTRVIVRVLDANDNDPKFQKSKY---------EFRIEENLRRGSVVGVVTASDLDLGENAAIRYSL---LPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREE---QPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVL-----DHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSG-NLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATP-VGTIIHNFTATDADTGTNGDLQYRLI 1525          

HSP 7 Score: 97.8265 bits (242), Expect = 2.297e-19
Identity = 92/320 (28.75%), Postives = 134/320 (41.88%), Query Frame = 2
Query:  125 SIKENVPIGEVVGQIESPGFS-----------PPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMN---------------------GDTKNVQ--------IKILDVNDNEPKFN-ATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHP-PLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDN 958
            +I ENVP G  V Q+ +               P    +D     F +    G+I   G  DRE Q  Y   +   +                     GDT N Q        I + DVNDN P+F   + +  S+PEN   G  +      D DEG N+     I  G+    F+ID   SS+G    R      LD E  S++ L IQA D G P   Q    + I V++ NDN P+F +S+Y  S++ED  +  + +++ A D D GV+  L Y L N +     F +D ++G +     LD E   S++  +   D 
Sbjct: 1727 TILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDL----FHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKFSID---SSSGELSAR-----PLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQ--FAIDGQSGLITTVGKLDRELQASYNFMVLATDG 2031          

HSP 8 Score: 95.9005 bits (237), Expect = 8.635e-19
Identity = 90/335 (26.87%), Postives = 151/335 (45.07%), Query Frame = 2
Query:  107 SNLLIFSIKENVPIGEVVGQI---ESPG------FSPPFE-----------MHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKN--------VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIV------SGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGH---PPLQASLLVKIIVQNANDNVPKF----DISRYIAS--IKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSL-----DFEKSKSHHISIGVRDNSPP 967
            S+ L+F ++E+  +G VVG I   E P           FE             D  E  F I + +G + V+ L+DRE Q+ +   I +++    N        V+I++ DVNDN P++     +  + E  P+G+ +   T  D D G N     R++      +   E+  ++   DS  G     L L+  LD+E + ++ L++QA+D        LQ S+ V++ + +AND+ P F          AS  I +   I      + A D D+G +G+L Y +   +     F ++ +TG + L KSL     D EK    ++ IG +D+  P
Sbjct: 1367 SSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGA----LSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGN-GEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQP 1696          

HSP 9 Score: 82.0333 bits (201), Expect = 1.282e-14
Identity = 79/298 (26.51%), Postives = 136/298 (45.64%), Query Frame = 2
Query:  128 IKENVPIGEVVGQIESPGFSPPFEM-HDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLII------------SMNGDTKNVQIKILDVNDNEPKFN-ATNFEKSIPENYPIGSKVDLTTVFDPDEGK--NSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQ-FNLVIQAIDGGHP-PLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSD----FFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD 955
            I E  P+G VV Q+          +    +E  F + ++  ++ V  L DRE+ +LY   ++              +    +V I ILD NDN P F+ +  +E  I E  P+   +      D D+    NS     I SG+ E +F ID      G+ +V       LDY+  ++ + L+I+A D  H  PL +    ++ + + NDN PKF ++ Y+  + E++ +  +  R  A+D D G  G+L Y +   +PS +     F VD ++G V      D+E+ + + + +   D
Sbjct: 2657 ISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSKAIVLVKPL-DRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDL---VTGVLFV----NNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSI-GPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASD 2945          

HSP 10 Score: 80.8777 bits (198), Expect = 2.892e-14
Identity = 66/236 (27.97%), Postives = 108/236 (45.76%), Query Frame = 2
Query:  122 FSIKENVPIGEVVGQIESPGFSPPFEMHDFQE------------KKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTK------NVQIKILDVNDNEPKFNATNFEK-SIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSG---DSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEIN 763
            F I+EN+  G VVG + +          D  E              F +   TG I     +DRE + LY  ++ + +  T        V+I + DVNDN P+      +  S+ E  P G++V      D D G+N+  +  IV G   D   +F+ID    ++G+   R++L    D+E  S + L + A DGG+PP +   ++++ V + NDN P F  S  +  ++ED  + 
Sbjct: 1160 FRIEENLRRGSVVGVVTASDL-------DLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSID---PTSGVIRTRVVL----DHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALG 1381          

HSP 11 Score: 73.9442 bits (180), Expect = 3.831e-12
Identity = 67/257 (26.07%), Postives = 122/257 (47.47%), Query Frame = 2
Query:  212 QEKKFIISKT-TGVIKVSGLIDREKQNLYSFLIIS-------MNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDE--------GKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVP---------KFDISRYIASIKEDQEINITFLRVRATDNDA-GVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKS 904
             +  F+I    +G+++ + ++DRE +++Y   II+       M G T  ++++I+DVNDN+P F   N   ++ E   +G+ +   +  D D         G  S   +  +S     +FA+D +         +L+LK+ LDYE+  ++ L + A D  H   +A  ++ + V + NDN P          F I   I+ I E   ++   L V ATD D+ G + ++ Y ++   P+ + F+V    G V +  S
Sbjct: 2366 HDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTG-TATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMS-----IFALDRYSG-------KLVLKRRLDYELQQEYELDVIASDAAH---EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIE---PAQEGFSVHPSNGVVSVNMS 2602          

HSP 12 Score: 69.3218 bits (168), Expect = 8.300e-11
Identity = 71/282 (25.18%), Postives = 125/282 (44.33%), Query Frame = 2
Query:  125 SIKENVPIGEVVGQIESP----GFSPP--FEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGD-------TKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVP--KFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKS--LDFEK 919
            S++E+ P+G  V QI +     G +    + + +  + +F I   +G+I   G +DRE Q  Y+F++++ +G        T  VQI +LD+NDN P F    +   +P     G  +      D D G N+ + V  ++ ++  V A    + S G     L   QSL  E     +L + A D G+PP  +  L+++++  A    P  +F    Y   +KE+       L+V A  +D       F F           ++D  +G + + K   LD+++
Sbjct: 1960 SVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANA-EIVYSLNAENSAVSAKFRINPSTGA----LSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSF--GAGNEDGILSLDSLSGEIRVNKPHLLDYDR 2234          

HSP 13 Score: 64.6994 bits (156), Expect = 2.022e-9
Identity = 73/289 (25.26%), Postives = 131/289 (45.33%), Query Frame = 2
Query:  131 KENVPIGEVVGQIESPGFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREK-QNLYSFLIISMNGDTKN-------VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSE----KVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFL--RVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD 955
            +EN P  EVV  I S             E  F I   TGV+ V+  +D +     Y  +I + +   +         ++++ D NDNEPKF  T +   + EN P+GS V      D D+G     +  I    S+    K+F +D   S +G+     +     DYE   ++++ + A D G    +AS+ V++ +++ ++  P+F    Y   +     +   ++  +V ATD+D+G  G + Y L  ++P S  F V+  +G V +++ L  +     ++ +  RD
Sbjct: 2782 QENTPNSEVVYDITSGN----------DEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVD---SESGLVTSAFVF----DYEQRQRYDMELLASDMGGK--KASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQL--SAPHS-HFKVNRSSGAVLIKRKLKLDGDGDGNLYMDGRD 3048          

HSP 14 Score: 56.9954 bits (136), Expect = 4.578e-7
Identity = 70/291 (24.05%), Postives = 123/291 (42.27%), Query Frame = 2
Query: 6908 DARF-SSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTE------------------ITIPESLKSGSKITKFVCKDLDSDKAIFYKIDNFHPIS-NNL---YLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQ-KPAI--ISNLLQMD 7702
            DA F +S A + I++ED+N++ P   +   V  +S    +G+ +  +HA D D   N ++ + +V           D N    F+I+       P F GI  T+  +D  + +  I+ L ++        P++ G  +                    +T+ E+ + G+ IT     D+D+  A+ Y++     +   N+    LD  SG L L + L+Y +Q  + L V  +      +     L+V++  EN      DN  + L+ Q P      PAI  IS  L +D
Sbjct: 2298 DAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIV-----------DGNHDNAFVIE-------PAFSGIVRTNIVLD--REIRDIYKLKIIAT--DEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTV---LTVRVNDEN------DNAPVFLAQQPPAYFAILPAISEISESLSVD 2557          
BLAST of Dachsous vs. Ensembl Fly
Match: ft (gene:FBgn0001075 transcript:FBtr0077478)

HSP 1 Score: 164.851 bits (416), Expect = 1.192e-39
Identity = 336/1505 (22.33%), Postives = 608/1505 (40.40%), Query Frame = 2
Query: 4283 FVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLI-VKIADENDNEP--------YILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEIHLVSSPRVSA-----YELNVTVRDSGEVPKSVSVVFSIHFQS------IKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIV---QIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFS---RSIFKVKLPEDEAITN--FLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCS-PLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPV--NSEIFYVLNPGHSHIQINT-TTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTT-------------------QTLYKMYL---LDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPS-----KCTTVLIDISLNQDHQYVQIVPE--KAIFRV--KENSVDGTFIGQI--KMVNYCKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDRE--KIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYRI-RHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDD------ARFSSTAVIEIDVEDKNNHVPI-LKENGRVINLSSSLKRGS--KILYLHAIDKDLRDNGKVTFELVST-SPWFGLRGFDNNTAALFLIDEPQEKGH-PYFLGIQLTDNAIDPQKRLMSIF--ALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKAIFYKIDNFHPISNN------LYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIV--GSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESRI-------WNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLK---LPEWYHDIQYFLTPHENFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIVENPSEN-FGINNETGAIYIKNQFIIEKK 8488
            F ++ +TGQL T R  DRE  +Q  + + VIA     P   +    + + +AD NDN+P        Y L+     +++     +   +  + A+D D G N+ + Y++    +G+F ++  SG I L      S      Y+L V+ RD+G+       +  I  +S              +    +  +     S+    +G +    T+   N  I Y +I G  AQ F +D  +G + T   + REE  N  +           +   +  Y    + I I   N+N P F+    S   + LPE+ A+    +L+ V  D D G+  RI YSL  +  +++  I P TG L    P+     ++ +++++ATD+       K    V+I   +   HT  F+ T +   + E +   T    +      +  N  I Y +  G++         G L    PL  E  ++  LT+        +RS   +   + + +ID NDN P    +     IP +      + KL+A D D   N    F  S  T                    + L K+       G+ G+L    +          L+  VSDNG+P      K   ++ D++ N         PE  +A + V   E + +GT I  +  +  +   +    +S+  G       L  +TG++  +   ++DRE  +I  +I+  + +     +     + I V D +DN P F+Q+     + E  P  T ++R    D D G NSQV + I   + ++ F ID+  G +  + PL++   + Y L I AS   +P +       V +V+ ND  P         ++    P+ + I  +TA D D G +G +SY I +      Q     +  ++G I   R++    +      +V  D       + S+  ++ + VED N++ P+ +  N  ++    S  +GS   ++ +HA D D   NG VT+E+VS     F L+    NT  +     PQ K    Y L ++ TD A+  ++R   ++   +T      +S  P+         ++ E+   G+ I   V   L S + I Y + N     +         +D + G L     L+    P    +   AI   G P    +      ++K +  P  +D  ++     V E +Q    IS L   D ++     +L+ +     + + +P + ++  ++ L       +E RI       +      ++     ++P    +  Y F   ++PE    N ++  ++ ++  V  + +  +   L    + +W +D+ + L P     LT +            + LD+E  ++Y   L+++       S S TI V  +VLD+++  P F   S++  V   +P   +++ T  A D D G  G++ Y I     ++ FGI++  G I  +     E +
Sbjct:  650 FALDALTGQLTTRRPLDREKMSQ--YEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGEGLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRV-RDRDAGVNSRISYSLTNNP-NQQFRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLI--ADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFPDGYLFVRAPLDREERDYYALTVSCRDAGQPSRS---SVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYM-----LLEATVSDNGIPRLQDKVKVKVIVTDVNDN--------APEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQL--SLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQ---RNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILT-VTAHLASAE-IEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFV---YNVSEDLQIGHTISTLRAHDPDTLGSVTFLL-MDGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSDGVQYTEAYATIQVSDTNDNPPLFEDTVYSF---DIPE----NAQRGYQVGQI--VARDADLGQNAQLSYGVVSDWANDV-FSLNPQTGM-LTLT------------ARLDYEEVQHY--ILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVV-TVSAKDIDSGNNGLIEYSITAGDVDSEFGIDS-NGTIRTRRNLDREHR 2094          

HSP 2 Score: 161.77 bits (408), Expect = 8.983e-39
Identity = 378/1666 (22.69%), Postives = 669/1666 (40.16%), Query Frame = 2
Query:  326 TKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPP--LQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD---NSPPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDAISTSFDLEI---LNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEIDSTILNENQHVTFVKTTKRLPTKPIFIFKIFVLN-NLFKINETTGEILSKRSID---CGKYFFNV-----SMLSLKTNSL---------------IDQTKLEIVVKSGRKLPLYFDRGFRKILVTTGKSQCFSEIAVRNRHCGMRIQYSYDLLLKTDGILRINEHGALCTAENVK-----HNKLMSTRYLYQIKALDETNSSAVCVVLFAIQPSKVFDVLPTEINITLPIIDSPKFNFSLPI--GKIIGTFSKLPPAQ-FIGFIQYHLVPEELSTGAITVDSQSGEILMKKFPIHKNPIRLI-------------VKSVIRKPFNVSPLNIVAINFQKLFFARSLYQFILTKSEIKGNLVKIGQVS-MDSSCTESVSYDLFGVKNDHSHFTIDVATGVIYGK---DLGSISNKTLMFQVSAKAPKSQTSFAQVIIYIEDGIHQPGFDFSDLL-VNIWENTTVGIEIMQVFPKYPSVSDEYQIIQSQYS------DWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDAD-SFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNS----NPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNVFY-IHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLET-INSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPP-------EIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTG--LITTKVSLSCAQNVKIRIFVSDLGFPKMTSSVDTLL---------KPLYEPKSEEFLINKNL---TFIIPDHS----QPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVI-VNRVGFSWPLFSKDSPKF-LEIKENLPSGSHVASFNIRRLKNLE--VVYSI---KQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQ-INPSSDGIFMINGDSGEIHLVS---SPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFI-----IGQLSYSQTSSSGNL-----DIRYYLIAGKFAQIFSVDPITGSVQTQHSVSRE 4972
            T  V I I DVND  P F + N E +I EN  I + V      D DEG+N      +     E +   D    S      +L +  +LD E+ S + L I A D G PP   ++ LL++I+  + NDN P FD  +Y AS+ E+  I    L+V ATD D G +G + Y +     + D F++   TG V + K+L++E+   + +++   D    +P   T+++ + I  I+ N        L +  L+ +  +  P      + +  YDA +   + ++   L      L +I     ++ L+  +   + +   LTL A+D   P L+ T  + +++ +    +  F    +   +   + +    +T   T K         F +   + + F I+  TGEI +  ++D      Y   +     S+   + +S+                D T   + V   R     F  G R + +  G      E AV +     R Q+ +D+  KT         G + T   +K     H+ L    Y   I A+D+   S       + +      + P E+  T   + +  F  S  +  GK+I   S   P +  +G I+Y +    +   ++ VD  SG + + +  +      L              ++SV     NV+  N  A   ++L     +Y   + + E    L+ + + S  DS    +V Y L   +ND         +G IY +   D   I +   + +   +     T  A V++++ D    P   F+ L  +N+ EN  +G  +++V     S  D      + YS      +   I  ++G I +    DREQ    ++ V   +    A   + + I D NDN P  ++S  +F+F +L     +   +  +D D   PN  +SY ++   P+     F I+P TG +    ++   +S    +P  +  L V+ +DNG   PL +E  +++ I+DA+N+ P          + Q AV G  +  +   D+      E++ SL   +    F + +   + ++  VK ++   N+ +E   +++ ATDRG P +S    +VI     N + P       ++++P+         P+  GS I TV A D D G N +  YSI    + +D  ++D  TG  +I  ++     Q   + I V DLG+  + SSV  L           P++  K     I +N    TF+   H+     P   +      P         ++ +  ++   +   ++ +++  L+  +  KN   S+             +NLY++V+ VN     +P F +  P F  ++ E    G+ V +       + E   VY +      +K F I+  TG +   R  DRET+N++   V                 +I+ I D ND   +I    +S +  +AP     +  + +  D  +  N++ +Y  IN +    F I+  +GEI   S       S Y L +   D+G  P++ S    I  + +                   P+  +G+I      G    +  +S  +L        Y LI GK     SVD  +G V++  S  RE
Sbjct: 2150 TVKVTILIKDVNDEVPVFISAN-ETAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRIL--DENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHD-FSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPT----FLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPE-RISKGEFVFGARALDLDDG------ENAVVHYTISGRDQHYFDINTKT---------GVVSTKLELKTKTKSHDDLT---YTIVISAMDQGEQS------LSSKAELTVILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGD-SLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQL-----IYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRL---QNDFDGTFEITESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPP-KFTRLFSLNVTENAEIGSFVIRV---TSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASDGAWRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSPM-----FSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGK-PPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGR--HDGWITLVKPIQVPPNTRYE---LVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENE-------PV--GSTILTVGATDDDTGPNGMLRYSISGGNERQD-FSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPL-SSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQ--IKAKNPDSSMESY----------ANLYVHVLGVNEF---YPQFLQ--PVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRT-QNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPT-----------FTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDRE 3718          

HSP 3 Score: 144.05 bits (362), Expect = 2.296e-33
Identity = 393/1887 (20.83%), Postives = 768/1887 (40.70%), Query Frame = 2
Query: 2705 IHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKP-LETEVEISVRIIDANNHS----PILISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIE------------KLSKNTFVIRVKSLETINSY--FEPLNVMLIATDRGSPSK-----------------SSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNED---------QINIDSWTGLITTKVSLSCAQNVKIRIFVSDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNV-HYSLNVVFNK---KNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENL--PSGSHVASFNIRRLK----NLEVVYSIKQPEK-YFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEP-YILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEIHLVSS---PRVSAYELNVTVRDSG-EVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLH--DASIYDLQRIFINIDYGNENPPRF-------SRSIFKVKLPEDEAITNFLT-VVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCSP--LNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENS--PGGTVLGRINIVKPPVNSEIFYVLNPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSD--KTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHE---LVFLHESTGKIFVAAAAKIDREKI----DKIILWTQVSCGGSEIRGYKKVI--IHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDP-DIGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARF---SSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSP--WFGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDS--DKAIFYKIDNFHPISNN--LYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGS--PEKITSFNLSVQIEKENKGPNLIDNKYI-TLSLQVPEMIQKPAIISNLLQMDKN----SFRYSYYLISVAPEQPENIYDPPSFQID--SSNILWWINGDLFESRIWNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKL 8041
            +   TG++ LN   DRE  S   + +++ + +        + + D NDN P  +++  +F   + +  G     +   DAD   N  LSY    +     N+ F +NP TG L + + L+           L+V   DNG  +P L T + +   ++D N+++    P+  S+ VF   +     TEV T+  KD D G NG IE S+        F I+            +  ++T+ + V + +  + +  F  L    +     SP K                 SS + + I   + N   P  +   +   M     +   + +  V AVD D+G N   +Y ++ A D ED          +N       +   +      +  + I   D G P  ++    L++ L E  +      K  +  + +++  G +V  ++    + GA      +             +   ++ +  NLN + +  YSL V       +N    ++ L IN++   +  + P F  DSP    + EN   P+G +V + N         N +V Y +K+ +   F IN  +G +   +  DRE   Q ++ + ++A    +P +     + V++ D NDN+P + L    + VR + P+     +    ATD D G N+KL + +       F I+ ++GEI   ++      S Y L +  +DS    P++ SV  +I    +      +F S + ++ +    SK  F+ G  +       G   + +Y I+G+    F ++  TG V T+  +  +   + ++    +VI ++   + S+     + + +      PP         + S F   + ED      +T V A  P  G+ G+I Y++ G      + +DP++G LS     L++   ++Y + I A D  G +   +  T + + V +   +        ++ +VLE    P    + + +      N  + Y L          T +GE+ T   L  E +      + A  + +       T     +  +   ++ P        + +  + +    + +++++D D    +N +Y F      ++   + + ++ +SGN+ +   +    +  + LKV+ SD G     T + I I  +Q+    +       F   E       +GQI   +  +D     S+I     +   +  +  +TG++F   A +    +     + +   T ++    +   Y + +  I++ D  +N P F Q +++A L +       ++R+   D  D+G N +++Y +  ++    F +   +G +    P+     + Y+LV++A+ +  P    E R+ + +   N   P+ S+ +  + +  N PVGS I  + A D D GP+G + Y I      N+    +V   +G I + ++L    + ++  +I V D  +   SS A++ I + D N++ P+         +  +   G+ +   HA DKD   N  + +  + + P   F +    N T +  +  + +E+   Y L I+    A +P   + S   L V +     ++P+ +        + E+   G+++      D DS  D  ++Y +      SN+    +D  +G +Y+ + L+   Q R +L V     GS          + + I+  N  P  I + Y  T+S   P   +    ++ +  +DK+    + ++SY +I+   +Q        SF+ID  +  I      D  E+  +NL I  +        P    + G   V+IE+ +  + +       + L G I+ENEP  T+++ L
Sbjct: 1870 LEPSTGKLILNDTLDRETKSKYELRIRVSDGVQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYG---VVSDWANDVFSLNPQTGMLTLTARLDYEEVQH---YILIVQAQDNG--QPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVF---ENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGIDSNGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETAIMEN---VAINTVVIAVKAVDNDEGRNGYIDYLMKEARD-EDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINIL--DINDNRPTF-LDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDIALLKPLDRE--QQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPS--GTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIP-KFDSTTYNVAVPERISKGEFVFGARALDL--DDGENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYT-IVISAMDQGEQSLSSKAELTVIL-----RPPELFPTFAYMANSHFA--MSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAAD--GDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGTFEITESGEIYTRMRLDREEIGDYAFVVEAVDQGVP----HMTGTASVLLHLLDKNDNPPKFTRLFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSF------SENPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASD-GAWRAETPITITIQ-DQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATD--RDKQGPNSVISYSLQQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTN-EMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISG---GNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEER-RIYTLQIK----AKNPDSSMESYANLYVHVLGVNEFYPQFL-QPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGS---SNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPPEFIKHYYTSTISEAAPVGTK----VTTVKAIDKDVRTQNNQFSYSIINGNLKQ--------SFKIDVQTGEISTASRLDREETSTYNLVIGAIDT----GLPP---QTGSATVHIELED--VNDNGPTFTPEGLNGYISENEPAGTSIMTL 3673          

HSP 4 Score: 131.339 bits (329), Expect = 1.679e-29
Identity = 332/1499 (22.15%), Postives = 609/1499 (40.63%), Query Frame = 2
Query: 2510 QTSFAQVIIYI-EDGIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSD---------EYQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQ-----LKNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFED-LSSLGEMECPLKCSDADSFP-NGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPIL-ISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRG-SPSKSSVINLVINFIESNRNPPE-------IVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQ--INIDSWTGLITTKVSLSCA----QNVKIRIFVSDLGFPKMTSSVDTLLKPLYEPKS--EEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFL---HLRFD--SQQLILLKDNLNVKNVH-YSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSK--DSPKFLEIKENLPSGSHVASFNIR-RLKNLEVVYSIKQP-EKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRI-SAPTTENASI----FQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEIHLVS---SPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSG-NLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSL-------HDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAI-TNFLTVVANDP-DLGIFGRIIYSLEGDTFDKKIFIDPSTGKLS-CSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSP-GGTVL--GRINIVKPPVNSEIFYVLNPGHSH--IQINTTTGELRTNGPLHLELVEFIELTI-------HAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVN--YCKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGY---KKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGF-NSQVEYFIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGP 6760
            Q++ +Q++I I ++  + P FD      ++ EN ++G  ++QV     S +D          Y I+    +   SI   TG + + K  + E++S   +TV+     L+N  G         +   ++   +  +       E+ +   G     +   DAD+ P N  + Y +K     G ++ F IN ++G + ++  L+    +      L ++  D G   PL     + V + D N++ P+  + +    + +    GT V T    D+D G N ++  +L   H ++ F+I+  +           E  + Y    ++ L+A D   +  ++S +NL I+  + N N P+       + +P++         +  G  +F   A+D D G N++ +Y+I       DQ   +I++ TG+++TK+ L        ++   I +S +   + + S    L  +  P      F    N  F + +  +PG ++  ++      G     +     ++ G +    LR D  S  L + +D L+ +  H Y + +     +  S+ S   I + V     + P+  +   + + LE +E+ P    V   + R    N  V+Y ++   +  F I   +G++ T    DRE      F VE +   V  P +     +++ + D+NDN P          R+ S   TENA I     ++ ++D D G N+  +Y  + +    F I   SG I +       +   Y L V   D G       +  +I  Q+    +   F  +  S +    Q +S  ++GQ+  +     G N  I Y L   + + +FS+DP TG V ++ +V      +S+ V+ P  + +L           +Y    + INI   + NPP+F ++ +   LP+D       + V AND  DLG    + YSL          +    G ++   P+       Y L + ATD  G+   + D T+V+I V      T  F+   + + V EN P G T+L  G  +    P N  + Y ++ G+      ++  TG +     L  +L++   L I       H  +       I T              +  IP   PV  F+  ++   K        DS K + I Y F  S P        ++++  +G +    S     +  + L++   +     +    L    L  +  Y Q +     F V E S  GT +G ++  +    +D    + ++   N +   +  +TG I+VA    +DRE  ++++L       GS IRG    +  +I      ++ P F ++ + + ++E  P  T V  +   D D+   N+Q  Y I   + ++ F ID   G++ T   L+    S Y+LVI A     P       + + + ++ND  P  +    N  +  N P G+ I  + A D D P
Sbjct: 2258 QSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQV-----SATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLK----EGDSDLFRINASSGDIALLKPLDREQQSE---YTLTLVAMDTGS-PPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHR-FHIDSETGEISTATTLDREETSVY----HLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPER---------ISKGEFVFGARALDLDDGENAVVHYTIS----GRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKG----LVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLE-EESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGTFEITE-SGEIYTRMRLDREEIGDYAFVVEAVDQGV--PHMTGTASVLLHLLDKNDNPP-------KFTRLFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASD-GAWRAETPITITIQDQN---DNAPEFEHSFYSFSFPELQ-QSIALVGQIIATDRDKQGPNSVISYSL--QQPSPMFSIDPATGEVFSKKAV---RFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGT-NEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATD-RGVPP-QSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGP-NGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADK--------DSPKNAIIHYAFLPSGPDRH----FFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIYVAR--HLDRETQNRVVLTVMAKNYGS-IRGNDTDEAQVIISIQDGNDPPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPDLP 3681          

HSP 5 Score: 128.642 bits (322), Expect = 1.097e-28
Identity = 244/1084 (22.51%), Postives = 437/1084 (40.31%), Query Frame = 2
Query: 4160 DSPKFLEIKENLPSGSHVASFNIRRLKNLEVVYSIKQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNS----------------KLTYQINPSSDGIFMINGDSGEIHLVSSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGN-----SEIVQIPVVIQSLHDASIYDLQR-IFINIDYGNENPP----RFSRSIFKVKLPEDEAI--TNFLTVVANDPDLGIFG----RIIYSLEGDTFDKKIFIDPSTGKLSCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPP--VNSEIFYVLNPGHS--HIQINTTTGELRTNGPLHLELVEFIELTIHAF-----AKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKM-YLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVP---SKCTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVFLHESTG-----------------------------KIFVAAAAKIDR----EKIDKIILWTQ---VSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVI------KASSKASPFVFAECRLTVYIVNINDQRPKISIPNRN---LKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDA---RFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELV--STSPWFGL 7123
            D+    E+ E  P G+ V     +     +  Y   +P + F ++PVTG++ T  + DRE      + + V+++  + P     + + +K+ D NDN P    PS +I   S   T    +    ATDAD G N                 +L    NPS D  ++    +G +   S     +Y+LN++ RD G  P+   +  ++    +     I    +S         +  G  +  +  S      N  I YYL   +    F+V+P TG + T   V+  +  N     S+   +  V    H +   D +  + +N+   N++ P    RF     KV   ++ A+  T    V   D D G+ G    RI+   E   F  +   D    +++   L+  E   YNL ++A D    +  R     +II V +   H   F  + +S  + E +P G+ +  I        VN+++ Y +  G+      ++  TG + T GPL  E+ + +EL+I A       KF  T+        + V I+D ND  P  ++    + +     PQ  +  ++ATD D+ +N +  F  + P+ + LY + + LD  +G L  +  +      ++ + VI  D G P   S   TV ++++   D+   Q  P   I+ + ++  D     +++       H       DG N  + +  ES G                             K+ V+A     R    + I +I+L ++   + CG ++  GY+  ++   +   N    SQ            P   V  + V   +   NS +EY I      + F ID  +G + T  PL+   ++ Y L I       +S+ AS   + +C + + I+++ND  P  ++   +   + L  N  VG  I     +D D   G++ RI +    N      +   +G ++L R +          +++  DA     SS   + + + D N+H P+        +L  + K  ++   L A D DL DNG++++E++  +T   FG+
Sbjct:   66 DTSADFEVLEGQPRGTTVGFIPTKP----KFSYRFNEPPREFTLDPVTGEVKTNVVLDREGMRD-HYDLVVLSSQPTYP-----IEVRIKVLDVNDNSPEFPEPSIAI-SFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESR---GSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPI--FDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYL--AETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVN-GVLDREEIGKYNLTVVAMDQG--TPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQ--------LKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALA-PSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDND-PQFYPRHYIYSLADDDDDIKLKKEVEKERILL-HVTASDKDDGDNALIEYRLESGGEGLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQRN----SQ------------PNREVGIVQVKSTNGKANSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDA--GVNSRISYSLTNNPNQQFRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGV 1099          

HSP 6 Score: 122.479 bits (306), Expect = 6.764e-27
Identity = 404/1856 (21.77%), Postives = 732/1856 (39.44%), Query Frame = 2
Query: 2663 EYQIIQSQYSDWLSIHSKTGQIFLNKQFDRE-QVSY-----------------------LVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNP---FEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNV-FYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFT--VNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITT----------KVSL-------------SCAQN-VKIRIFVSDLGFPKMTSSVDT--------------LLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKD-NLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLK---NLEVVYSIKQPEKY--FVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVR-ISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGI-----FMINGDSGEIHL---VSSPRVSAYELNVTVRDSGEVPK---SVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSK-SGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQ-TQHSVSREEIGNSEIVQIPVVIQSLHDA--SIYDLQRIFINI----DYGNENP-PRFS-RSIFKVKLPEDEAI-TNFLTVVANDPDLGI---FGRIIYSLEGDTFDKKIFIDPSTGKLSCSPLNFMEKNI--YNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPVNSEIFYVLNPGH-SHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTV-----LIDISLNQ--------DHQYVQIVP-EKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDG----VNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYK-------------------KVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLID--------ANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHR-KLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARF----SSTAVIEIDVEDKNNHVPILKEN---GRVINLSSSLKRGSKILYLHAIDKDLRD-NGKVTFEL-VSTSPWFGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKAIFYKIDNFHPISNNL---YLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPE-KITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAII--SNLLQMDKNSFRYSYYLIS 7738
            EY IIQ   +    I +++G+I   +  DRE Q +Y                        +V + + +L  +A +                + S+   +  + +++G+     +  D D+  N  +SY +        NNP   F I P TG L +   +    + P  +I++ ++ +D G    L +++ +SV I D N+H+P+   T+    + +T    T    L   D D+G+NG I   + + +  + F +         +R         Y+    + +   D G PS+SSV+ +VI+ I+ N N P+      +    F  P  + ++ F   + AVD D G N+  +++  L+   +D   ID+  G I T          KVS              S A N + +   VSD G P++   V                L  P +   SE      ++T +    +  G + GD            ++ S    +  G  +L   + QL L +  +   + +H+ + V  +      +SSN  I ++V     + P F++ S + + + E  P+G+ +  F         N +VV+SI    +   F I+ +TG L   +  D   E+   + + + A+    P + T +   V + D+NDN P    PS++IVR I         I  + A D DSG N K++Y I+     +     F IN ++G IH    +    +  + L V   D  +  +   S   + ++  + I   + +    N+  +      SK S   + Q+      SS N  + Y +++G   ++F +   TG +  T     ++E      V+  + ++S  +A  S      ++I I      G+E+  P+F  RS     + E+E I T+ LTV A+     I      +  +      D+   ID   G LS +     E     Y +++ A    G    R   TKV + V +       F  T F   V E+   G  +  +    P     + ++L  GH     +  +TG+L  N  L  E     EL I        +  +Q T A   +++ D NDN P+  +      IP + Q    + ++ A D+D   N    +      +     ++ L+ ++G L L + +       + L V   DNG PS  TT+     ++D++ N           +  + VP    +  V    +D    G I+      D  ++F I           L   H ST  + V A    D       +  TQ+       R Y+                   KV I + DV+D  PVF      A + E     T VI +   D D G N  ++Y ++    ++    D         +G ++    L+   +S Y L I A  +  P    E +L + I++ ND  P       +  +  N  +G+ + +++A D D  +G + RIR+   L +Q    +++ D+G + +++ L    + ++   +  +D         TA + I++ D N++ P   ++    RV+  ++    G  +L ++A D D    N +V + L    S  F +     + A L  +D  Q+    Y L +   D    P   L     + V ++      P +    S   T+ E+L SG+ +     +  D D+ +  K+  F+ +  ++   ++D E+G++    +L+      + L +        E + +S NL++ +   N   N+      T ++ VPE I K   +  +  L +D       +Y IS
Sbjct:  867 EYDIIQGDRAQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALD------------RESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSL-------TNNPNQQFRIGPVTGVLYLQRPIR---AEPGSLIHVELMATDAGSPP-LSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGV--FPDGYLFVRAPLDREERDYYA---LTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFT----NSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFT--LSSQTQD-FTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEG-LNGD------------VYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSE-VSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDY--EDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIF--PSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGP-QELFKLQRNTGIITFTPGPQFKQE------VRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQP--RTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDTLGSVTFLLMDGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRV------SDGVQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGV---VSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGIDSNGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETAIM-ENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVD--EGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVME-NTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDIALLKPLDREQQS--EYTLTLVAMDTGSPP---LTGTGIVRVEVQDINDNDP-VFELQSYHATVRENLPSGTHV--LTPRATDKDEGLNAKL-RFNLLGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVND--NIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTIS 2636          

HSP 7 Score: 111.309 bits (277), Expect = 1.950e-23
Identity = 124/454 (27.31%), Postives = 214/454 (47.14%), Query Frame = 2
Query:  122 FSIKENVPIGEVVGQIES-PGFSPPFEMHDFQE--KKFIISKTTGVIKVSGLIDREK-QNLYSFLIISMNGDTK-NVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSI-QSVRIVSGDSEKVFA-IDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEK---------SKSHHISIGVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQILW---TGGLSEINRDISPNTIVAHVKLTDYDA-ISTSFDLEILNRSPFQLIKILPKMWELKLIN--------DIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEIDSTILNE 1399
            F + E  P G  VG I + P FS     + F E  ++F +   TG +K + ++DRE  ++ Y  +++S        V+IK+LDVNDN P+F   +   S  E+   G+++ L    D D G+N +     IV+G+ +  F  +   + S    Y+ L    +LD E    + L I A DGG PP    L V + + + NDN P FD S Y  S+ E        + V A+DND G + ++ Y+L  T      FTV+ +TG +   + ++  +          KS   ++  RD+  P    +  V ++++D ND+ P I   +    G ++ ++ +    T+VA V + D D+ ++    + I++ +     + L +  +L ++         +IG Y     NLT+ A+D   P+ +TT  L I +++    E  F  S +     S +L+E
Sbjct:   71 FEVLEGQPRGTTVGFIPTKPKFS-----YRFNEPPREFTLDPVTGEVKTNVVLDREGMRDHYDLVVLSSQPTYPIEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQ---FTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFR-LEEAADLHIVRVNGVLDREEIGKY-----NLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEY-----SAVLSE 505          

HSP 8 Score: 110.923 bits (276), Expect = 2.445e-23
Identity = 88/296 (29.73%), Postives = 148/296 (50.00%), Query Frame = 2
Query:  125 SIKENVPIGEVVGQIESPGFSPPFEMH-------DFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMN-------GDTKNVQIKILDVNDNEPKFNATNFEKSIPENY--PIGSKVDLTTVFDPDEGK-NSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNS 961
            S+ EN  IG +V Q+ +                   Q   F IS+ TGV++V+  ++ E+ + YS  + + +       GDT  + I ILD+NDN P F  + +   + EN   P G  V     +D D    NS     +  GDS+ +F I+   +S+G     + L + LD E  S++ L + A+D G PPL  + +V++ VQ+ NDN P F++  Y A+++E+       L  RATD D G++ +L + L         F +D +TG +    +LD E++  +H+++  +D+S
Sbjct: 2286 SVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSD-LFRIN---ASSG----DIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNL--LGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSS 2571          

HSP 9 Score: 108.612 bits (270), Expect = 1.105e-22
Identity = 82/292 (28.08%), Postives = 141/292 (48.29%), Query Frame = 2
Query:  116 LIFSIKENVPIGEVVGQIESPG----FSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNG---DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPF 970
             ++++ E++ IG  +  + +       S  F + D  + KF++  +TG + ++  +DRE ++ Y   I   +G         I++ D NDN P F  T +   IPEN   G +V      D D G+N+  S  +VS  +  VF+++      G+    L L   LDYE +  + L++QA D G P L  ++ V   V + NDN P FD   Y + + E+  I    + V A D D+G +G + Y +      S+ F +D   G +  R++LD E   ++ +++  RD +  F
Sbjct: 1828 FVYNVSEDLQIGHTISTLRAHDPDTLGSVTFLLMDGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSDGVQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLN---PQTGM----LTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSE-FGID-SNGTIRTRRNLDREHRSTYTLTVTARDCADEF 2110          

HSP 10 Score: 107.457 bits (267), Expect = 2.894e-22
Identity = 72/262 (27.48%), Postives = 128/262 (48.85%), Query Frame = 2
Query:  212 QEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKN-------VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTS---PSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            +  +F +   TG + +   +DRE Q ++  ++++ +   K+       + I +LD NDN P+F  ++ E S+ E  P G+++      D D+G NS     I +G+    F ID   S  G  Y    L + LDYE I+ + L I A D G P L  ++L  ++V + NDN P F  +  +  IKE   +    + V A D D+G++G++ Y +       P    F ++ +TG ++  + +D E   +  +++   D + P
Sbjct: 1322 EAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHID---SITGSLY----LHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQP 1576          

HSP 11 Score: 107.071 bits (266), Expect = 3.069e-22
Identity = 270/1206 (22.39%), Postives = 478/1206 (39.64%), Query Frame = 2
Query: 4241 NLEVVYSIKQPEKY--FVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVL----PLIVKIA--DENDNEPYILSPSSSIVRISAPTTENASIFQIV----ATDADSGPNSKLTYQINPSSDGIFMINGDSGEIHLVSSPRV---SAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFL-TVVANDPDLGIFGRIIYSLEGDT-----------------FDKKIFIDPSTGKLSCSPLNFMEKNIYN--LKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRI--NIVKPPVNSEIFYVLNPGHSHIQIN--TTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFR--------------VKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDK----IILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVF-SQNKFVAFLNEGQPPK--------TPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDANGDVKTNIPL-NFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPN--RNLKLD----TNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGE---IFLSRKLLVSDVGKHEFDIVV------DDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDE-PQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYF----------PRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKAIFYKIDNFHPISNNLY-LDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNL 7576
            N  + Y I Q ++   F I+  +G++ T R  DRE   Q  + + ++A+  S+             IV IA  D NDN P       S   IS P  ENA++ Q +      D D+G NS+++Y +  + +  F I   +G ++L    R    S   + +   D+G  P S  +  S+    +   + +   ++  +      +  + F    L+ +      N  I Y +I G   ++F V P  G +  +  + REE    +   + V  +     S   +  + I++   N+N P+F+ S F   +PE+     F+  + A D D+G    + ++L   T                 FD++  +  S    +      +  ++    + + AT S+      +D  KV + V +   +   F    + + + E +  GT +  +        +N +++Y L  G+   Q N  + TG+L     L  E  E   L +   AK  + +   +++A I + ++D NDN P   ++  ++ +  ++     L +  A+D+D+  N    F  S    +  +    +D  +G+L+L   +       + L +  SD G PS  TTVL ++ +  D+    I P  AI R              V  +  D    G++      ++         G+N E   +H            +IDRE ID     ++   +      ++   K V + V+D++DN PVF S N  +       PPK        T V+++   D D   N  V Y I     QE F +  N  + T  P   F  +  Y L +K++ +A         + + I+       + S+P   +  KL      N P+G+ I  +TA  +     I Y + +   T     ++  FD      I  +   L  + G  E+++ V         R S T V  + V DKN+  P   +   V N+S  L+ G  I  L A D D    G VTF L+       L   + +T  L L D   +E    Y L I+++D                  ++Y ++Y           P L  +      IPE+ + G ++ + V +D D  +            +N+++ L+ ++G L LT  L+Y     ++LIV     G P   T+  +
Sbjct:  863 NSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDRE--EQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLP--ENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQFRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFA--LAATDIDLGDNGRISYEIIEGNTERMFGVFP-DGYLFVRAPLDREE---RDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIV--VAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFH---IDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIH---------TLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAIL------PPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEI-VSGPQELFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHLASAE--IEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKV-RVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDTL--GSVTFLLMDGHDGKFL--LEPSTGKLILNDTLDRETKSKYELRIRVSDG-----------------VQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITV 2013          

HSP 12 Score: 105.145 bits (261), Expect = 1.202e-21
Identity = 318/1556 (20.44%), Postives = 612/1556 (39.33%), Query Frame = 2
Query: 4307 QLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSG------------EIHLVSSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKI---RFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGS--VQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFL-TVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKL-SCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVK--PPVNSEIFYVLNPGHSHI-----QINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIP-------AENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVS--DNGVPSKCTTVLIDISLNQDHQYVQIVPEKAI---FRVKE------NSVDGTFIG--QIKMVNYCKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDRE-----KIDKIILWTQVSCGGSEIRGYKKVIIHXX--XXXXNKPVFSQNKFVAFLNEGQP----PKTPVIRLTVY-----DPDIGFNSQVEYFIEFYSSQEEFLIDANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDA---RFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWF----------GLRGFDNNTAALFLIDEPQE------------KGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDS--DKAIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESRIWNLTIMIVKAQKYQNSPSNLYENGYLFVN------IEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHDIQYFLTPHENFELTCSQSQSSGCNIKSKSV-----LDFETHENYRLQLLIKG-SYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKL------GQILFTAYASDKDRGRFGIVSYQIVENPSENFGINNETGAIYIKNQFIIEKKDKQRVKRS---ETNEEALKSYRKSFQFRIS----ASSGVKTSYAYVELTMLIPG 8629
             L T    DRE+    Q  +   A    +P  F  L + V I D NDN P I   S   V ++        +  ++A+D D G NSK+TY +   ++  F +N ++G            + ++ SS    +    V  RD G   +      +++         I   RF  +   +      + +G ++  ++   + S  N      +++G     F ++       V+    + REEIG   +    VV       +      + I+++  N++ P F +S +   L E     +F+ ++ A D D G+  ++ Y +      K   +DP TG + +  PL+   ++   L I A D  G    +  +T++ + + +       F+    ++ + E++P  T++  +         N  + + L P    +      ++  TG+L T  PL  E +   E+++ A  +   T    T +  ++V  ++ ND Q  P       A++   I +    + ++ L  ++A+D D   N   ++ R +   + L++   LD +SG + L+    +SM  +   K++VS  D G        +++I L    + ++    +A    F++ E      NS     +G  Q+K  N   +   ++ II G   +   +   +G+I    A  +DRE     ++  +   +  S   +    Y + I+++   D++DN PVF+ ++      E +P    P+   +   +Y     D D G NS++ Y +    +Q+  +    G +    P+     S+  + + A+   SP + ++  L+V I ++ND  P     +    L     V +    + A D D G +G   RI +  +   T  +   F  G +F+   L   +   +   +   DA     SS   + I V D+N++ P    +    ++  +    + +  L A+D+D+  N +++F L S +  F           LR FD    AL  +    E             G+   L   ++DN I    RL     + V++       P  +      +TI E    G+ IT    +D D   +  ++Y +   +  +    LD  +G L L + L+   Q    LIV          ++S N S+ I   ++  N  +    +  + V E       +      D +    S  + S++     +     +F IDS     +++  L    I + T+ I  +     S S       L V+      I     ++  +++ + +K     +  ++P      K       + Y ++  E       Q +  G N ++  +     +D E+ + +RL ++    +    R  S   +V + V D+++  P FV    + N     PK          +   +A D D    G+V+Y+IV  P E F +   TG I     F    + KQ V+     ++ +EA++S R+S +  I+     S G ++S    E    + G
Sbjct:  221 HLETTGNLDRESRGSYQLNIS--ARDGGSPPRFGYLQVNVTILDVNDNPP-IFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYL-AETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLT---VVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARD--GGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEY-RLESGGEGLFQ---LDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHIEYDIIQGDRAQNFRIDTRSGRI--TTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDR------ESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQFRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNG---RISYEIIEGNTERMFGVFPDGYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDRE--ALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGI---PRLQDKVKVKVIVTDVNDNAPEFL-RAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNE-AGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSS-NASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRD-----TFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGK-------VSYAISKQEP---QLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFV----SMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGII----TFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSG 1721          

HSP 13 Score: 104.375 bits (259), Expect = 2.370e-21
Identity = 76/251 (30.28%), Postives = 122/251 (48.61%), Query Frame = 2
Query:  248 VIKVSGLIDREKQNLYSFLIISMNGDT------KNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDF-----FTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            +++V+G++DRE+   Y+  +++M+  T       ++ I + DVND+EP F  + +   + E  P GS V   T  D D G N+     I+SG+  K F++D      G+    ++    LD EI     L I A DGG  P  A   +K+I+ + ND  P+F       ++ ED         + ATD+D G +G + + L   +PS +      F +D  TG +  R+ LD EK   + IS+  RD   P
Sbjct:  445 IVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMD---PLTGL----IVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFAL---APSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAP 685          

HSP 14 Score: 93.2041 bits (230), Expect = 5.971e-18
Identity = 55/211 (26.07%), Postives = 105/211 (49.76%), Query Frame = 2
Query:  323 DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD 955
            D   V I +   N + P+F+  +++  +PEN P+GS +      D D G N +    I  G+  + F++D  + + GI     +++Q LDY++I +++L I   D G+ PL +  ++ II+ + NDN P F+   Y   I E++ +     +  A D D+  +  + Y    + P   FF ++   G +    S D+E+ + + + I  ++
Sbjct: 3211 DETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVD--ERTGGI-----VIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKN 3414          

HSP 15 Score: 92.4337 bits (228), Expect = 8.277e-18
Identity = 105/378 (27.78%), Postives = 163/378 (43.12%), Query Frame = 2
Query:  122 FSIKENVPIGEVVGQIESPGFSPPFEMHDF-------QEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMN------GDTKNVQ--IKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPD-EGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDAISTSFDLEILNRSPFQLIKILPKMWEL 1207
            F + E   +G  VG +++       +   +        +K F I   TG+I V+  +DRE QN     +++ N       DT   Q  I I D ND  P+F    +  +I E  P+G+KV      D D   +N+  S  I++G+ ++ F ID            +     LD E  S +NLVI AID G PP   S  V I +++ NDN P F        I E++    + + + A+D D   +G  F +         + +VD  +G V    S D E +      I V D+  P   S+  + I V+D NDNP + + L    +S  N D+  N  +A V+  D D +         N +  QL   +P+  +L
Sbjct: 3446 FDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTG-------EISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDNPSTTRSLHI-AVSLFNGDLPSNVKLADVRPNDIDIVGDYRCRLQKNPAQSQLQLAIPRACDL 3814          

HSP 16 Score: 90.5077 bits (223), Expect = 4.031e-17
Identity = 74/261 (28.35%), Postives = 121/261 (46.36%), Query Frame = 2
Query:  245 GVIKVSGLIDREKQNLYSFLIISMNGDTKN------VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGI------FYVRLILKQSLDYEIISQFN----------LVIQAI--DGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD 955
            G + V   +DRE+++ Y+  +   +    +      V I ++D NDN P+F  + F  SIPEN P  + V   T  D D G+N+  S  + S   +  F ID   + NG       F    ++K S + E   +            ++++A   D G P LQ  + VK+IV + NDN P+F  + Y  +I E          V   D D G++G+++Y L   + +   F +D  TG + L + LD E  + HH+ +  +D
Sbjct: 1103 GYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQD--FTID---TRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQ-FNLDSATGQLSLGRRLDRESQEIHHLIVVAKD 1357          

HSP 17 Score: 90.1225 bits (222), Expect = 4.347e-17
Identity = 56/233 (24.03%), Postives = 117/233 (50.21%), Query Frame = 2
Query:  275 REKQNLYSFLIISMNGDTKN------VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD 955
            R  +N+Y+  +++ +           V I I+D ++N PKF    +   +P++   G ++      D  +   +     +++ +   +F++  HD      ++ L+  + +     +++ LV++A D G PP      V I+V   N + P+F ++ Y   + E++ +  T L V ATD+D G +G L Y +   +   D F+VD +TG + +++ LD++  + +H++I V+D
Sbjct: 3084 RSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDG-----WITLV--KPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQD-FSVDERTGGIVIQQQLDYDLIQEYHLNITVQD 3308          

HSP 18 Score: 88.5817 bits (218), Expect = 1.291e-16
Identity = 87/316 (27.53%), Postives = 132/316 (41.77%), Query Frame = 2
Query:  122 FSIKENVPIGEVVGQIESP----GFSPPFEMH-DFQEKKFIISKTTGVIKVSGLIDREK---------------------QNLYSFL--IISMNG-----DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGG-HPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            FSI EN P    VG++ +     G +         Q + F I    G IK     DRE                         Y  L   +S NG     D   V++ + DVNDN P+F    +  +I E    G+ +      D DEG N      +  G+    F +   DS+ G    +L L + LD E     +L++ A D     PL ++  + I+V + NDN P+F  S    S+ E        +R RA+D D GV+ ++ + + +     D F +D  TG++YL K LD+E   S+ ++I   D   P
Sbjct: 1160 FSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNL---DSATG----QLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSI-SAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTP 1467          

HSP 19 Score: 80.1073 bits (196), Expect = 5.461e-14
Identity = 77/299 (25.75%), Postives = 136/299 (45.48%), Query Frame = 2
Query:  107 SNLLIFSIKENVPIGEVVGQIESPGF------SPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKN---VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPD-EGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDY--EIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            + L   ++ EN  IG  V ++ S         +  +   +   +KF I   +G I V+G +DRE+Q+ Y   +++ +G  +    + I I D NDN P+F  + +  S PE     + V      D D +G NS+ S  +       +F+ID   ++  +F  + +  +   Y     + + L + A D G PPL +  LV I + +A++N PKF+ + Y+A + +D       +RV A D     + E+ Y L   + SS  F+V    G + L K +    +  + + +   D   P
Sbjct: 2914 TRLFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASDGAWRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQ--PSPMFSID--PATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSS-IFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVP 3207          

HSP 20 Score: 79.337 bits (194), Expect = 8.164e-14
Identity = 75/270 (27.78%), Postives = 124/270 (45.93%), Query Frame = 2
Query:  215 EKKFIISKTTGVIKVSGLIDREKQ-NLYS--------FLIISMNGDTKN------VQIKILDVNDNEPKFNATNFE-----KSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSP 964
            E +F ++  TGVI  +  ++  +Q N+ S        F + + +  +        V + +LD ND++P  +   F       ++ EN   G+ V    V D D G N   SVRIVSG+    F ++    +  +  VR+     LD E I ++NL + A+D G P    +  + I V + ND+ P F+ S Y A + E          + ATD D GV+ ++ Y + + +    +F++D  TG +     LD E   +  +SI  RD  P
Sbjct:  313 EHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLE---EAADLHIVRV--NGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGN-ELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGP 576          

HSP 21 Score: 78.5666 bits (192), Expect = 1.283e-13
Identity = 71/245 (28.98%), Postives = 117/245 (47.76%), Query Frame = 2
Query:  218 KKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTK------NVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDS-EKVFAIDYH-DSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHP-PLQASLLVKIIVQNANDNVPKFDISRYIAS---------IKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLR 898
            K F +   TG+I  +G +DRE ++     I + +G          +++ ILD ND  P+F+      ++ E+ P  + V L T  D D+G N   SV      S E+++ + +  D+  G    +L  ++ LD E +SQ+ + + A D G P P  A+  V + V + NDN P+F    YI S         +K++ E     L V A+D D G +  + Y L+  S     F +D ++G + LR
Sbjct:  540 KWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNG--SVTFALAPSVERLYPLQFALDALTG----QLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLE--SGGEGLFQLDARSGAISLR 776          

HSP 22 Score: 77.411 bits (189), Expect = 2.941e-13
Identity = 77/274 (28.10%), Postives = 132/274 (48.18%), Query Frame = 2
Query:  212 QEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKN------------VQIKILDVNDNEPKFNATNFEK----SIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFL--DNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTS 979
            + + F I   +G I  +  +DRE+Q  Y   I++ +  + +            V I I+D+NDN P F A + E     S+PEN  +G ++ L+ V D D G NS  S  + +  +++ F I       G+ Y    L++ +  E  S  ++ + A D G PPL + L + +++ + ND+ P FD + Y  S+ E  ++N  F  + ATD D G +G + Y +   NT      F      G +++R  LD E+   + +++  RD   P  +S
Sbjct:  875 RAQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVF-ALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQ-FRIG---PVTGVLY----LQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVF----PDGYLFVRAPLDREERDYYALTVSCRDAGQPSRSS 1135          

HSP 23 Score: 76.6406 bits (187), Expect = 5.844e-13
Identity = 202/915 (22.08%), Postives = 354/915 (38.69%), Query Frame = 2
Query: 5975 GVPSKCTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVFLHE-STGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYRI-----------------RHRKLTNQ----TLFLNV-AFDSGEIFLS-------------RKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPI-LKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTF--------ELVSTSPW-FGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQS--YFPRLIGNHSTEITIPESLKSGSKITKFVCKDLD--SDKAIFYKI---DNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVT---CAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWING--DLFESRIWNLTIMIVKA-QKYQNSPSNLY----------ENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHDIQYFLTPHENFELTCSQSQ-----SSGCNIKSKSVLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIVENPSENFGINNETGAIYIKNQFIIEKK 8488
            G P    T +    L+++    Q +    ++ V E+   G  I  ++  +     S  F ++DG  H+  FL E STGK+ +     +DRE   K  L  +VS G      Y    I V D +DN P+F    +   + E       V ++   D D+G N+Q+ Y +    + + F ++   G +     L++     Y L+++A     P +     +   ++++ND  P     + + ++  N P+ + +  ++AKD D G +G I Y I                 R R+  ++    T  L V A D  + F S             R        + EF       R SST  + I ++D N+ VP+ +  N   I  + ++   + ++ + A+D D   NG + +        ++  + P  F L   D     +  +D  +E    Y L I   D    PQ    S   + +L +   S  + P+         ++ E+   G+ + +    D+D  ++  I Y I   D  H  S    +  ++G + + K+LNY    R+ L V    CA+           +++    +N+ P  +D+ Y+              ++ N +  +        Y+++V      N YD  +  ++S    +   G  DLF     +  I ++K   + Q S   L             G   V +EV +  I +     E++     + EN P  T VL       D    L     F L           S    I + + LD E    Y L L+ + S       S ++ + ISV D+++  P+F   ++   V   I K G+ +F A A D D G   +V Y I       F IN +TG +  K +   + K
Sbjct: 1800 GQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDTLGSVTFLLMDG--HDGKFLLEPSTGKLILNDT--LDRETKSKYELRIRVSDGVQYTEAY--ATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGIDSNGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETAIMENVAIN--TVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALD--RELRSSYLLNITARDRGEPPQS-TESQLLIRILDENDNSPVFDPK-----QYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFS----ISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNR-PTFLDSPYLA------------RVMENTVPPNGG------YVLTV------NAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQD--INDNDPVFELQSYHATVRENLPSGTHVLT--PRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRAS-SVNLTISVSDVNDNIPKFDSTTYNVAVPERISK-GEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTKTK 2663          

HSP 24 Score: 74.7146 bits (182), Expect = 1.841e-12
Identity = 73/236 (30.93%), Postives = 112/236 (47.46%), Query Frame = 2
Query:  242 TGVIKVSGLIDREKQNLYSFLIIS-------MNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDND-AGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSK 925
            +G I     +DRE+   Y+F++ +       M G T +V + +LD NDN PKF    F  ++ EN  IGS V   T  D D G N+  S        EK F I+    +       + +   LD E   ++ L + A DG     +A   + I +Q+ NDN P+F+ S Y  S  E Q+      ++ ATD D  G +  + Y L   SP    F++D  TG V+ +K++ F+ S+
Sbjct: 2862 SGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTG-TASVLLHLLDKNDNPPKFTRL-FSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEK-FRIEPQSGN-------ITVAGHLDREQQDEYILKVVASDGA---WRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSP---MFSIDPATGEVFSKKAVRFKHSQ 3081          

HSP 25 Score: 73.1738 bits (178), Expect = 6.630e-12
Identity = 84/353 (23.80%), Postives = 159/353 (45.04%), Query Frame = 2
Query:  125 SIKENVPIGEVV----GQIESPGFSPPFEMHDFQEK--KFIISKTTGVIKVSGLIDREKQNLYSFLIISMN-------GDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIA----SIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYL-RKSLDFEKSKSHHISIGVRD-NSPPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDA 1126
            +++EN+P G  V       +  G +     +   E   +F I   TG I  +  +DRE+ ++Y   +++ +         + N+ I + DVNDN PKF++T +  ++PE    G  V      D D+G+N++    I SG  +  F I   ++  G+   +L LK          + +VI A+D G   L +   + +I++   +  P F    Y+A    ++ ED        +V AT    G+ G++ Y +       D   VD  +G + + +  LD+E +  + I I   D ++P   +  +  +      ++ P   Q+++    +E+  + SP  ++A VK +D D+
Sbjct: 2499 TVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTI-SGRDQHYFDI---NTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVILR-PPELFPTF---AYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAG-GIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYN---AEVLEEESPPQLIAVVKASDRDS 2839          

HSP 26 Score: 71.2478 bits (173), Expect = 2.553e-11
Identity = 73/301 (24.25%), Postives = 129/301 (42.86%), Query Frame = 2
Query:  128 IKENVPIGEVVGQIESPGFSPP--------FEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTK-----NVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAID----GGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTS 979
            I EN P+G  V Q  +     P        F         FI++++ G I  +   D E++ +Y+  I + N D+      N+ + +L VN+  P+F    F   + E   +G++V      D D G++      +V   ++K F I   D++ G+ YV     + LD E  ++  L + A +     G+   +A +++ I  Q+ ND  P+F    Y ++I E   +      V+A D D       F +          F +D +TG +     LD E++ ++++ IG  D   P  T 
Sbjct: 3343 IPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRI---DTNTGLIYV----ARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISI--QDGND-PPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTG 3633          

HSP 27 Score: 67.3958 bits (163), Expect = 2.995e-10
Identity = 59/238 (24.79%), Postives = 107/238 (44.96%), Query Frame = 2
Query:  269 IDREKQNLYSFLIISMNGDTKNVQ------IKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFY-FLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNS 961
            +D E  +LY   I + +GDT +++      + + D NDN P      +   + E       + +    D D G N     R+   D +  F I    + +G  Y R+     LD E I  +  V++A+D G P +  +  V + + + NDN PKF    +  ++ E+ EI    +RV ++D D G +    Y F +N     + F ++ ++GN+ +   LD E+   + + +   D +
Sbjct: 2768 LDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRL-QNDFDGTFEI----TESGEIYTRM----RLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKF-TRLFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSEN---PGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASDGA 2992          

HSP 28 Score: 58.5362 bits (140), Expect = 1.726e-7
Identity = 76/322 (23.60%), Postives = 142/322 (44.10%), Query Frame = 2
Query: 2855 PYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLN------IWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILI------STNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSL---ETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSL--SCAQNVKIRIFVSDLG 3769
            P   +S  N +  + +  G     +  SD D   N  ++Y +   +     + F +NP TG +     +N      + +S         V   D+G  +  +    ++V ++D N+H PI+          V  + + AV GT V  + +KD D G NG   + +   +    F +E+ + +  ++RV  +   E I  Y    N+ ++A D+G+P++++  +L+I+  + N + P  V  K     +      +GS + ++ A D D G+N+  +Y I L+ +     ++D  TGLI T   L       V++ I   D G
Sbjct:  268 PIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETE-----HQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPR-QDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEE-AADLHIVRVNGVLDREEIGKY----NLTVVAMDQGTPARTTTAHLIIDVNDVNDHEP--VFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDI-LSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGG 575          
BLAST of Dachsous vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304900)

HSP 1 Score: 139.428 bits (350), Expect = 5.561e-32
Identity = 223/981 (22.73%), Postives = 402/981 (40.98%), Query Frame = 2
Query: 4181 IKENLPSGSHVASFNIRRLKNLEVVYSI-----KQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDG----------IFMINGDSGEIHLVSS---PRVSAYELNVTVRD-SGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFI----IGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAIT-NFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKL-SCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPVNSEIFYVLNPGHSHIQINTTT----GELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSN--ITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQ---------YVQIVPEKA-----IFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWT-QVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEF-LIDANGDVKTNI----PLNFH-TKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNR-----PVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVE 6952
            + E  P+G+ V +   R  ++  VVYS+      + +  F ++  TG + T    DRE  +    Y  V+AT  S P       L V + D ND+ P           I    T  +++  + ATD D G N+++ Y I   +DG          IF I+  SG I   SS       +Y L VT  D +    +  +   S+  + +          +  +  + +P+ + G      +  +  +      N  IRY +I G     FS+D ++G V     +  E + +  +V   +  Q     S  +  ++ +N+   N+N PRF  S F+  + E+  +  N + V A D D G    I YS+     +  + +DP TG + +  PL+  E+  +  +++A D  G    +   + V+I VQ+   +  AFN  ++   V E+ P GT +  +    P  +S + Y +  G++  +   T+    G +     L  +  +   LT+ A     +    ++ +A + + I D N+  PI    P    +         +  +SATDSD   N  ITY  +            + ++ ++G +   + +       + L V   D G PS   T  ++I +   +          Y   + E A     + +V  +  D    G+IK +   +D      +ID           ++G I       +DRE +    L    V  G   +    +V I ++DV+D+ P F+ +K   ++ E  P  + V  +  +DPD G N+ V Y I        F L+   G  +  +     L++  T+  ++LV++A   ASP +  +  + + + ++ND  P +    R+ ++  N      P G  I +I A D+D  D + YRI      N    L +   SG + LS +L  +       ++ V D    + A++++ V 
Sbjct:  368 VLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDV--HYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSP-TFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYP-QFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLV---IRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKD--GGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAA-----TDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVID----------PTSGTIRTNKG--LDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVL----RDFQVIFNNFRDHFPSGE-IGRIPAFDADVSDKLHYRILS---GNNANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSVSDGINEAKAIMQLSVR 1311          

HSP 2 Score: 139.043 bits (349), Expect = 6.916e-32
Identity = 195/760 (25.66%), Postives = 333/760 (43.82%), Query Frame = 2
Query: 4913 IFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDE-AITNFLTVV---ANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLS-CSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPP--VNSEIFYVLNPGHSH--IQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQ---PQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFRVK--ENSVDGTFIGQIKM------VNYCKDHSAKFSIIDGVNHELVF-LHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGS-EIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQE-EFLID-ANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGIS----YRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDAR--FSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVS 7102
            IF +D  +G + T+ S+ RE   +  ++     + S           + + +   N+N P+FS   + V++PED+   T   TV    A D D G    I Y++ G     +  ID  +G +S   PL++     Y L I A D  G S  R + T++++ V +   +   F  + F   VLEN P G  + R+         N+EI Y ++    +  + ++  TG ++T  PL  E     E    AF        +   SA   V I   + N   PA NP K +  N  +   P  P+T ++ATD D+ S + Y+    +  T+  + +   +G+ G + +  S+    + R  L V  +D+G  S   TV I+I+   D      + E A +     E++  GT +  +        VN    +S     I+G+     F ++  TG I   A   +DRE     +L      GG+  +     V I V DV+DN P F    + A + E     T VI++   DPD+G N +++Y +     ++  F+ID  +G ++TN  L+  + +V+ L   A  K SP + +   + + + ++ND  P  +     L +  N PVGS + +I A D D  +G++    Y I     +N    +          L+   L  +  +  F++VV  A     + A IEI V D N++ P+L++   + N         +I  + A D D+ D  K+ + ++S
Sbjct:  520 IFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQD--GGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDRE-----EQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNP-KYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGN--TRGRFAITSQNGR-GLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINIT---DANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAP--LDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPD--EGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSD--KLHYRILS 1259          

HSP 3 Score: 119.783 bits (299), Expect = 5.256e-26
Identity = 194/846 (22.93%), Postives = 360/846 (42.55%), Query Frame = 2
Query: 2561 PGFDFSDLLVNIWENTTVGIEIMQVFPKYPS----VSDEYQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVS---YLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMK-IIKPVGMNNP-----FEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSD--NGPFKPLETEVEISVRIIDANNHSPILIS-TNVFYIHQTAVYGTE---VGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVK--IRIFVSDLGFPKMTSSVDTLL--------KPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNV-HYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSH---VASFNIRRLKNLEVVYSIKQ--------PEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSP--SSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPS--SDGIFMINGDSGEIHL---VSSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQ 4954
            P F+ +  + ++ E    G  +  V  + P     V     ++ S+      + S+TG +  +   DRE +    + VV         S T  L +N+LD ND+ P  +  +   +  + +++G     L+ +D D   N  + Y ++ +    G+        F I+  +G +   SSL+   S+     +LLV  +D  +   +       + V+++D N++ P     T    + +    GTE   V  +   D D G N  I  ++   +    F I+ +S +  +++    E++ SY     +++ A D GSPS+S+   L++N I++N N P     +  + ++   P+  G  I  V A D D+G N+   YSI    DN   + +D  TG + T   L   +  +   ++   D G P  ++S   ++         P + PK  E  + ++          PG  V  +     +  ++  +   T  +   F     + + LI +  +L+ K    + L V        S ++ ++IN I +   F+ P+F +++P    + E+ P G+    V++ +     N ++ YS+ +        P+  F INP TG +VT    DRET +   + + V A    NP +     + + + D NDN P   SP   +SI+  +   T   S+ Q+ A+D D G N ++ Y ++     DG F+I+  SG I     +    V+ + L     D G  P S +V   I  + +   S   F S+ +++ +    S  G ++G++         N  + Y +I G  +  FS+    GS + Q
Sbjct:  357 PYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDS---YHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSY----RLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPV--GYNIIRVQAYDSDEGANAEITYSISERDDNF-PLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGED--------QPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHIN-ITDANNFA-PIF-ENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDP-FSINPQTGAIVTNAPLDRETTS--GYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGT---SVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVN-DSPPTFASDKITLYVPE-NSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQ 1173          

HSP 4 Score: 115.161 bits (287), Expect = 1.112e-24
Identity = 81/262 (30.92%), Postives = 130/262 (49.62%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLIISMN---------GDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSK---VDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFF--TVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            F I   +GVI     +DRE  + Y  L+ + +           T +VQ+K+LD NDN P+F+   +   +PE+   G++   V      D D+G N+     I+ G+++  F+ID   S +G     + L + LDYE +  + LVI+A DGG P    +  + + V +ANDN P+F  S++  S+ E+  +    +RV+A D+D G + E+ Y   + S   D F   VD +TG V   K LD E+       +  +D   P
Sbjct:  521 FRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSID---SMSG----DVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITY---SISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVP 772          

HSP 5 Score: 111.309 bits (277), Expect = 1.907e-23
Identity = 95/314 (30.25%), Postives = 149/314 (47.45%), Query Frame = 2
Query:  113 LLIFSIKENVPIGEVVGQIES--PGFSPP-FEMHDFQEKK----FIISKTTGVIKVSGLIDREKQNLYSFLIISMNGD------TKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNS-----IQSVRIVSG---DSE-KVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQ---ASLLVKIIVQNANDNVPKFDISRYIASIKEDQ----EINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            L + S+ E  P G  V  + +  P  SP  + M    + +    F +   TGV+  S  +DRE  +++ F +++ +        T  +Q+ +LD ND+ P F A  FE SI E   +GS V      D D GKN+     I++V   +G   D E  +F I   DS +G+   R     SLD E    ++L++ A D      +   A+  V++ V + NDN P+F    Y   + EDQ    E N T   +RATD D G +  + Y +   +  S  F++D  +G+V L K LD+E  +S+ + I  +D   P
Sbjct:  363 LYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRI---DSRSGVISTR----SSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDN-TVAHIRATDADQGNNAAIRYAIIGGNTQSQ-FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSP 667          

HSP 6 Score: 105.531 bits (262), Expect = 9.402e-22
Identity = 72/255 (28.24%), Postives = 119/255 (46.67%), Query Frame = 2
Query:  245 GVIKVSGLIDREKQNLYSFLIISMNG----DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKN-----SIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHIS-IGVRDNSPPFHTS 979
            G+I ++  +D +++  +   + + +     DT  V I I D N+  P F    +  S+ E+ P+G+ V + +  D D G N     S+    I    S   F+I+    +       ++    LD E  S + L + A DGG+P L  +  V+I V + NDN P F    Y ASI ED  +  + ++V A+D D G++G + Y L +       F +D  +G +   K LD E     H++ I V   SPP  ++
Sbjct:  849 GLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGA-------IVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSST 1096          

HSP 7 Score: 103.99 bits (258), Expect = 3.224e-21
Identity = 73/255 (28.63%), Postives = 120/255 (47.06%), Query Frame = 2
Query:  215 EKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNG------DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDF-FTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDN 958
            + +F I   +G + +   +D E    Y  +I + +G      +T  + + ++D NDN P+F  + F++S+ EN P+G  +     +D DEG N+  +  I   D     A+D         +V+ I  + LD E   +F   + A DGG PP  AS  V I VQ+ NDN P F+   Y A++ EDQ        V ATD D      L Y +   +    F  T  +  G + + +SLD+++ K   +++   D+
Sbjct:  629 QSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTG-----WVQTI--KPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDS 874          

HSP 8 Score: 97.4413 bits (241), Expect = 2.673e-19
Identity = 72/257 (28.02%), Postives = 123/257 (47.86%), Query Frame = 2
Query:  206 DFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMN------GDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEII-SQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD 955
            D ++  F+I  T+G I+ +  +DRE   ++    I+++        T  VQI++ DVND+ P F +      +PEN P+GS V      DPDEG N++    I+ GD    F++     S      +L+    LDYE    +F LV++A     PPL+    ++I+V + NDN P     + I +   D   +    R+ A D D  VS +L Y + + + +++   ++  +G + L   L+    K   + + V D
Sbjct: 1050 DIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSE---RAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDAD--VSDKLHYRILSGN-NANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSVSD 1297          

HSP 9 Score: 87.8113 bits (216), Expect = 1.958e-16
Identity = 78/352 (22.16%), Postives = 150/352 (42.61%), Query Frame = 2
Query:  353 DVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDF--------FTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSKXXXXXXXXXXXXXXXSI----QILWTGGLSEINRDISPNTIVAHVKLTDYD-AISTSFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQ 1369
            ++ +  P F    +  S+ E  P G+ V      DP++       V ++   S+ +F +D   S  G+    +    SLD E++      + A D   PP   +  +++ V + ND+ P F+  ++ ASI+E   +  T + +RATD D G + E+ Y ++  +  +          F +D ++G +  R SLD E S S+H+ +   D +      +       + + D+  +     +  +T  + E     + +  VAH++ TD D   + +    I+  +      I     ++ L+  +      S  L ++A D   PS S T  L + + ++      F  S+FQ
Sbjct:  351 ELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVD---SRTGV----VTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQ 695          

HSP 10 Score: 87.4261 bits (215), Expect = 2.880e-16
Identity = 106/465 (22.80%), Postives = 206/465 (44.30%), Query Frame = 2
Query: 5780 LTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVP--SKCTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKF-----SIIDGV----NHELVFLHESTGKIFVAAAAKIDREKIDK---IILWTQVSCGGSEIR-GYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTP---VIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARF---SSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVS 7102
            +T + A D + +  +       D  +Q+L+K   +D ++G +   +S+   +   H+ +V+ +D+  P  S  TT+ +++    DH       E+    ++E +  G+ +  ++  +     +A+      ++ DG     + E+      +    ++  + +DRE  D    ++    ++   SE R     V + V D +DN P FS+  +   + E Q   T    V  +   D D G N+ + Y I   ++Q +F ID+ +GDV    PL++ +   Y LVI+A    SP      +L V +++ ND  P+         +  N PVG  I ++ A DSD G +  I+Y I  R   +    L V   +G +   + L   + G+  F +V  D      S+++ + I V+D N++ P         N+      G+ +  + A D D  ++ ++ +E+ +
Sbjct:  378 VTTVRARDPEDSPVVYSMVSLLDSRSQSLFK---VDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPT-FEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISER---DDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITT 833          

HSP 11 Score: 73.1738 bits (178), Expect = 5.450e-12
Identity = 118/508 (23.23%), Postives = 216/508 (42.52%), Query Frame = 2
Query: 6152 SIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGS--EIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYS-----SQEE----FLIDA-NGDVKTNIPLNFHTKSVYDLVIKAS---SKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGS---FITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDA---RFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLID--EPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTV--LLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKAIFYKI------DNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSV 7582
            S++D  +  L  +   TG   V  +A +DRE +D +  +  V+   S     G   + ++V D +D+ P F   +F A + EG    + VI L   D DIG N+++EY IE  +     +Q++    F ID+ +G + T   L+  T   Y L++ A+   S  S    A   + V +++ ND  P+ S     +++  ++  G+    +  I A D+D  +  + R        Q+ F ++   SG++ L + L    V  +   I   D      S+T  + ++V D N++ P    +    ++  ++  G  I+ + A D D   N ++T+ +      F L   D  T  +  I   + +E+G  +   +   D  + P K   S   +TV  +     ++ P+       E  + E    G+ +T     D D D  + Y+I        F   S N       G + + +SL+Y  + RFLL V     G      + ++++
Sbjct:  397 SLLDSRSQSLFKVDSRTG--VVTTSASLDRELMD-VHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQF-SIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPL-AVDPRTGWVQTIKPLDREEQGR-FAFQVVAKDGGV-PPKSASSSVVITVQDVNDNDPAFNPKYY-----EANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQN-----GRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINI 887          

HSP 12 Score: 61.6178 bits (148), Expect = 1.896e-8
Identity = 69/328 (21.04%), Postives = 135/328 (41.16%), Query Frame = 2
Query: 6707 RPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARF---SSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDE-----------PQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSK---ITKFVCKDLD--SDKAIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQ-IEKENKGPNLIDNKY 7630
            +P G+ +T + A+D +    +   +      +Q+LF  V   +G +  S  L    +  H F +V  D  F   S T  ++++V D N+H P  +      ++      GS ++ L A D+D+  N ++ + + + +   GL    +    +F ID             +E    Y L +   D A    +R  +  ++ V +      +P+     +  + +PE    G++   +      D D  ++ AI Y I   +   +   +D  SGD+ L K L+Y     + L++     GSP +  +  L V  I+  +  P    +++
Sbjct:  372 QPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLF-KVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGL--AQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQF-SERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGN-TQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQF 694          
BLAST of Dachsous vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0339463)

HSP 1 Score: 139.428 bits (350), Expect = 5.760e-32
Identity = 223/981 (22.73%), Postives = 402/981 (40.98%), Query Frame = 2
Query: 4181 IKENLPSGSHVASFNIRRLKNLEVVYSI-----KQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDG----------IFMINGDSGEIHLVSS---PRVSAYELNVTVRD-SGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFI----IGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAIT-NFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKL-SCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPVNSEIFYVLNPGHSHIQINTTT----GELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSN--ITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQ---------YVQIVPEKA-----IFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWT-QVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEF-LIDANGDVKTNI----PLNFH-TKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNR-----PVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVE 6952
            + E  P+G+ V +   R  ++  VVYS+      + +  F ++  TG + T    DRE  +    Y  V+AT  S P       L V + D ND+ P           I    T  +++  + ATD D G N+++ Y I   +DG          IF I+  SG I   SS       +Y L VT  D +    +  +   S+  + +          +  +  + +P+ + G      +  +  +      N  IRY +I G     FS+D ++G V     +  E + +  +V   +  Q     S  +  ++ +N+   N+N PRF  S F+  + E+  +  N + V A D D G    I YS+     +  + +DP TG + +  PL+  E+  +  +++A D  G    +   + V+I VQ+   +  AFN  ++   V E+ P GT +  +    P  +S + Y +  G++  +   T+    G +     L  +  +   LT+ A     +    ++ +A + + I D N+  PI    P    +         +  +SATDSD   N  ITY  +            + ++ ++G +   + +       + L V   D G PS   T  ++I +   +          Y   + E A     + +V  +  D    G+IK +   +D      +ID           ++G I       +DRE +    L    V  G   +    +V I ++DV+D+ P F+ +K   ++ E  P  + V  +  +DPD G N+ V Y I        F L+   G  +  +     L++  T+  ++LV++A   ASP +  +  + + + ++ND  P +    R+ ++  N      P G  I +I A D+D  D + YRI      N    L +   SG + LS +L  +       ++ V D    + A++++ V 
Sbjct:  368 VLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDV--HYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSP-TFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYP-QFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLV---IRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKD--GGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAA-----TDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVID----------PTSGTIRTNKG--LDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVL----RDFQVIFNNFRDHFPSGE-IGRIPAFDADVSDKLHYRILS---GNNANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSVSDGINEAKAIMQLSVR 1311          

HSP 2 Score: 139.043 bits (349), Expect = 7.044e-32
Identity = 195/760 (25.66%), Postives = 333/760 (43.82%), Query Frame = 2
Query: 4913 IFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDE-AITNFLTVV---ANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLS-CSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPP--VNSEIFYVLNPGHSH--IQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQ---PQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFRVK--ENSVDGTFIGQIKM------VNYCKDHSAKFSIIDGVNHELVF-LHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGS-EIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQE-EFLID-ANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGIS----YRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDAR--FSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVS 7102
            IF +D  +G + T+ S+ RE   +  ++     + S           + + +   N+N P+FS   + V++PED+   T   TV    A D D G    I Y++ G     +  ID  +G +S   PL++     Y L I A D  G S  R + T++++ V +   +   F  + F   VLEN P G  + R+         N+EI Y ++    +  + ++  TG ++T  PL  E     E    AF        +   SA   V I   + N   PA NP K +  N  +   P  P+T ++ATD D+ S + Y+    +  T+  + +   +G+ G + +  S+    + R  L V  +D+G  S   TV I+I+   D      + E A +     E++  GT +  +        VN    +S     I+G+     F ++  TG I   A   +DRE     +L      GG+  +     V I V DV+DN P F    + A + E     T VI++   DPD+G N +++Y +     ++  F+ID  +G ++TN  L+  + +V+ L   A  K SP + +   + + + ++ND  P  +     L +  N PVGS + +I A D D  +G++    Y I     +N    +          L+   L  +  +  F++VV  A     + A IEI V D N++ P+L++   + N         +I  + A D D+ D  K+ + ++S
Sbjct:  520 IFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQD--GGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDRE-----EQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNP-KYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGN--TRGRFAITSQNGR-GLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINIT---DANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAP--LDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPD--EGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSD--KLHYRILS 1259          

HSP 3 Score: 119.783 bits (299), Expect = 5.089e-26
Identity = 194/846 (22.93%), Postives = 360/846 (42.55%), Query Frame = 2
Query: 2561 PGFDFSDLLVNIWENTTVGIEIMQVFPKYPS----VSDEYQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVS---YLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMK-IIKPVGMNNP-----FEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSD--NGPFKPLETEVEISVRIIDANNHSPILIS-TNVFYIHQTAVYGTE---VGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVK--IRIFVSDLGFPKMTSSVDTLL--------KPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNV-HYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSH---VASFNIRRLKNLEVVYSIKQ--------PEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSP--SSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPS--SDGIFMINGDSGEIHL---VSSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQ 4954
            P F+ +  + ++ E    G  +  V  + P     V     ++ S+      + S+TG +  +   DRE +    + VV         S T  L +N+LD ND+ P  +  +   +  + +++G     L+ +D D   N  + Y ++ +    G+        F I+  +G +   SSL+   S+     +LLV  +D  +   +       + V+++D N++ P     T    + +    GTE   V  +   D D G N  I  ++   +    F I+ +S +  +++    E++ SY     +++ A D GSPS+S+   L++N I++N N P     +  + ++   P+  G  I  V A D D+G N+   YSI    DN   + +D  TG + T   L   +  +   ++   D G P  ++S   ++         P + PK  E  + ++          PG  V  +     +  ++  +   T  +   F     + + LI +  +L+ K    + L V        S ++ ++IN I +   F+ P+F +++P    + E+ P G+    V++ +     N ++ YS+ +        P+  F INP TG +VT    DRET +   + + V A    NP +     + + + D NDN P   SP   +SI+  +   T   S+ Q+ A+D D G N ++ Y ++     DG F+I+  SG I     +    V+ + L     D G  P S +V   I  + +   S   F S+ +++ +    S  G ++G++         N  + Y +I G  +  FS+    GS + Q
Sbjct:  357 PYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDS---YHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSY----RLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPV--GYNIIRVQAYDSDEGANAEITYSISERDDNF-PLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGED--------QPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHIN-ITDANNFA-PIF-ENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDP-FSINPQTGAIVTNAPLDRETTS--GYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGT---SVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVN-DSPPTFASDKITLYVPE-NSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQ 1173          

HSP 4 Score: 115.161 bits (287), Expect = 1.113e-24
Identity = 81/262 (30.92%), Postives = 130/262 (49.62%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLIISMN---------GDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSK---VDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFF--TVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            F I   +GVI     +DRE  + Y  L+ + +           T +VQ+K+LD NDN P+F+   +   +PE+   G++   V      D D+G N+     I+ G+++  F+ID   S +G     + L + LDYE +  + LVI+A DGG P    +  + + V +ANDN P+F  S++  S+ E+  +    +RV+A D+D G + E+ Y   + S   D F   VD +TG V   K LD E+       +  +D   P
Sbjct:  521 FRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSID---SMSG----DVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITY---SISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVP 772          

HSP 5 Score: 111.309 bits (277), Expect = 1.957e-23
Identity = 95/314 (30.25%), Postives = 149/314 (47.45%), Query Frame = 2
Query:  113 LLIFSIKENVPIGEVVGQIES--PGFSPP-FEMHDFQEKK----FIISKTTGVIKVSGLIDREKQNLYSFLIISMNGD------TKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNS-----IQSVRIVSG---DSE-KVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQ---ASLLVKIIVQNANDNVPKFDISRYIASIKEDQ----EINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            L + S+ E  P G  V  + +  P  SP  + M    + +    F +   TGV+  S  +DRE  +++ F +++ +        T  +Q+ +LD ND+ P F A  FE SI E   +GS V      D D GKN+     I++V   +G   D E  +F I   DS +G+   R     SLD E    ++L++ A D      +   A+  V++ V + NDN P+F    Y   + EDQ    E N T   +RATD D G +  + Y +   +  S  F++D  +G+V L K LD+E  +S+ + I  +D   P
Sbjct:  363 LYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRI---DSRSGVISTR----SSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDN-TVAHIRATDADQGNNAAIRYAIIGGNTQSQ-FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSP 667          

HSP 6 Score: 105.531 bits (262), Expect = 9.102e-22
Identity = 72/255 (28.24%), Postives = 119/255 (46.67%), Query Frame = 2
Query:  245 GVIKVSGLIDREKQNLYSFLIISMNG----DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKN-----SIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHIS-IGVRDNSPPFHTS 979
            G+I ++  +D +++  +   + + +     DT  V I I D N+  P F    +  S+ E+ P+G+ V + +  D D G N     S+    I    S   F+I+    +       ++    LD E  S + L + A DGG+P L  +  V+I V + NDN P F    Y ASI ED  +  + ++V A+D D G++G + Y L +       F +D  +G +   K LD E     H++ I V   SPP  ++
Sbjct:  849 GLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGA-------IVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSST 1096          

HSP 7 Score: 103.99 bits (258), Expect = 3.200e-21
Identity = 73/255 (28.63%), Postives = 120/255 (47.06%), Query Frame = 2
Query:  215 EKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNG------DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDF-FTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDN 958
            + +F I   +G + +   +D E    Y  +I + +G      +T  + + ++D NDN P+F  + F++S+ EN P+G  +     +D DEG N+  +  I   D     A+D         +V+ I  + LD E   +F   + A DGG PP  AS  V I VQ+ NDN P F+   Y A++ EDQ        V ATD D      L Y +   +    F  T  +  G + + +SLD+++ K   +++   D+
Sbjct:  629 QSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTG-----WVQTI--KPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDS 874          

HSP 8 Score: 97.4413 bits (241), Expect = 2.544e-19
Identity = 72/257 (28.02%), Postives = 123/257 (47.86%), Query Frame = 2
Query:  206 DFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMN------GDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEII-SQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD 955
            D ++  F+I  T+G I+ +  +DRE   ++    I+++        T  VQI++ DVND+ P F +      +PEN P+GS V      DPDEG N++    I+ GD    F++     S      +L+    LDYE    +F LV++A     PPL+    ++I+V + NDN P     + I +   D   +    R+ A D D  VS +L Y + + + +++   ++  +G + L   L+    K   + + V D
Sbjct: 1050 DIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSE---RAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDAD--VSDKLHYRILSGN-NANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSVSD 1297          

HSP 9 Score: 88.1965 bits (217), Expect = 1.944e-16
Identity = 78/352 (22.16%), Postives = 150/352 (42.61%), Query Frame = 2
Query:  353 DVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDF--------FTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSKXXXXXXXXXXXXXXXSI----QILWTGGLSEINRDISPNTIVAHVKLTDYD-AISTSFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQ 1369
            ++ +  P F    +  S+ E  P G+ V      DP++       V ++   S+ +F +D   S  G+    +    SLD E++      + A D   PP   +  +++ V + ND+ P F+  ++ ASI+E   +  T + +RATD D G + E+ Y ++  +  +          F +D ++G +  R SLD E S S+H+ +   D +      +       + + D+  +     +  +T  + E     + +  VAH++ TD D   + +    I+  +      I     ++ L+  +      S  L ++A D   PS S T  L + + ++      F  S+FQ
Sbjct:  351 ELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVD---SRTGV----VTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQ 695          

HSP 10 Score: 87.4261 bits (215), Expect = 2.980e-16
Identity = 106/465 (22.80%), Postives = 206/465 (44.30%), Query Frame = 2
Query: 5780 LTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVP--SKCTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKF-----SIIDGV----NHELVFLHESTGKIFVAAAAKIDREKIDK---IILWTQVSCGGSEIR-GYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTP---VIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARF---SSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVS 7102
            +T + A D + +  +       D  +Q+L+K   +D ++G +   +S+   +   H+ +V+ +D+  P  S  TT+ +++    DH       E+    ++E +  G+ +  ++  +     +A+      ++ DG     + E+      +    ++  + +DRE  D    ++    ++   SE R     V + V D +DN P FS+  +   + E Q   T    V  +   D D G N+ + Y I   ++Q +F ID+ +GDV    PL++ +   Y LVI+A    SP      +L V +++ ND  P+         +  N PVG  I ++ A DSD G +  I+Y I  R   +    L V   +G +   + L   + G+  F +V  D      S+++ + I V+D N++ P         N+      G+ +  + A D D  ++ ++ +E+ +
Sbjct:  378 VTTVRARDPEDSPVVYSMVSLLDSRSQSLFK---VDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPT-FEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISER---DDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITT 833          

HSP 11 Score: 73.1738 bits (178), Expect = 5.230e-12
Identity = 118/508 (23.23%), Postives = 216/508 (42.52%), Query Frame = 2
Query: 6152 SIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGS--EIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYS-----SQEE----FLIDA-NGDVKTNIPLNFHTKSVYDLVIKAS---SKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGS---FITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDA---RFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLID--EPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTV--LLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKAIFYKI------DNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSV 7582
            S++D  +  L  +   TG   V  +A +DRE +D +  +  V+   S     G   + ++V D +D+ P F   +F A + EG    + VI L   D DIG N+++EY IE  +     +Q++    F ID+ +G + T   L+  T   Y L++ A+   S  S    A   + V +++ ND  P+ S     +++  ++  G+    +  I A D+D  +  + R        Q+ F ++   SG++ L + L    V  +   I   D      S+T  + ++V D N++ P    +    ++  ++  G  I+ + A D D   N ++T+ +      F L   D  T  +  I   + +E+G  +   +   D  + P K   S   +TV  +     ++ P+       E  + E    G+ +T     D D D  + Y+I        F   S N       G + + +SL+Y  + RFLL V     G      + ++++
Sbjct:  397 SLLDSRSQSLFKVDSRTG--VVTTSASLDRELMD-VHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQF-SIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPL-AVDPRTGWVQTIKPLDREEQGR-FAFQVVAKDGGV-PPKSASSSVVITVQDVNDNDPAFNPKYY-----EANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQN-----GRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINI 887          

HSP 12 Score: 61.6178 bits (148), Expect = 1.865e-8
Identity = 69/328 (21.04%), Postives = 135/328 (41.16%), Query Frame = 2
Query: 6707 RPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARF---SSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDE-----------PQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSK---ITKFVCKDLD--SDKAIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQ-IEKENKGPNLIDNKY 7630
            +P G+ +T + A+D +    +   +      +Q+LF  V   +G +  S  L    +  H F +V  D  F   S T  ++++V D N+H P  +      ++      GS ++ L A D+D+  N ++ + + + +   GL    +    +F ID             +E    Y L +   D A    +R  +  ++ V +      +P+     +  + +PE    G++   +      D D  ++ AI Y I   +   +   +D  SGD+ L K L+Y     + L++     GSP +  +  L V  I+  +  P    +++
Sbjct:  372 QPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLF-KVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGL--AQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQF-SERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGN-TQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQF 694          
BLAST of Dachsous vs. Ensembl Zebrafish
Match: dchs1a (dachsous cadherin-related 1a [Source:ZFIN;Acc:ZDB-GENE-120410-3])

HSP 1 Score: 276.559 bits (706), Expect = 1.918e-73
Identity = 452/1914 (23.62%), Postives = 809/1914 (42.27%), Query Frame = 2
Query: 2957 NGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIV--SDNGPFKPLETEVEISVRIIDANNHSPILISTNVFY-IHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEK---LSKNTFVIRVK---SLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFC--PLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVKIR--IFVSDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVG-----DLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVI-VNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNI----RRLKNLEVVYSIKQP----EKYFVINPVTGQLVTFRMFDRETENQIQFYVEVI--ATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSS-DGIFMINGDSGEIHL---VSSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLTVVANDPDLGIFGRIIYSL-EGDTFDKKIFIDPSTGKLSCS-PLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPP--VNSEIFYVLNPGHSHIQI-NTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIP-NSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCT-TVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSA--KFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEPQ-EKGHPYFLG-IQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTE--ITIPESLKSGSKITKFVCKD--LDSDKAIFYKIDNFHPISNNLYLDFE---------------SGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESRIWNLTIMIVKAQKYQNSPSNLY-------ENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHD------IQYFLTPHE-NFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIVENPSENFGINNETGAIYIK 8464
            + +L+Y +    P G    F I   +G L + S+L+      +  + LL ++  S NG  K   +   + V ++D N+++P       F  + +    GT  G +           + +  L     Y+  ++++   ++ +T  I  K     E  +SY     ++++A D G+P +S+     I  ++ N N P     +  ++++        SG  + TV+A DPD+G N    YS  ++    ++  ++  TG + +  +LS ++  +    I  SD G P  +S +   ++ L   K      ++ L     + ++PG ++G     D    PE+   +  F     T  DG   +   +  + L ++    K   Y+L V  +  ++    S++   +I V       P F +D P  + + EN   GS   +F          N EV YSI Q          ++P TG L    M D E  + +   V+    A  VS  +  +V   I  + D NDNEP  +S  +S+V +         +  ++A DAD G N ++TY+I   +  G F IN D+G + +   +       Y L +   D G   +S S + S+  Q I    +  +   S           +G  +  +S S      N  + Y  I G     FS+ P+TG + T  ++ RE  G   +  + V  +       +    + + +   N+N P F R  + +++PE++      T+ A D D G  G + Y + +GD F     +D   G LS S  L+   +  Y L + A D +G+ +     T + I V +   ++  F ++ +S++V E++  G+++  ++        NS++ Y L+   S + I +  TG + T   L  E V      ++A     S  + + +SA + V I+D+NDN P    +P+ I +  +S    + L  + A D D  +N +  +  ++P      K + ++  +G +     + +  + +  L V   D G PS+ +  V+I     Q +Q V+         ++EN+  GT + QI    Y    ++   +SI  G   +   +   TG+I+V  +  +D E+  ++ L  +     S    +  V + + DV+DN P F  + +VA++ E Q    P+I++   D D G N QV Y I   S    F ID   G + T   ++    +  +LVI A+ + SP +     LTV IV++ND  P I +P R +++  N  +G+ IT++T  D D    +SY +     T     ++     G + L+  L       +   +   D++  S A + I VED N++ P+  ++   + L+     GS ++ + A DKD  +NG++T+ +VST   F +   D +   LF+  E + +   P  L  I+ +D+   P   L ++  + V +       P     H TE   ++ E    GS I      D  L  D   F    +F   S N+   F+                G L L   L++ I   + L +  +  G P++ +S  + + +   N  P          S  V E  ++   I  L  +D +S                     P+ ++  S I    + +LF    W   + + ++   +   S+++       +  +    + V  K I N R    +K LT  I EN+P    V  L    HD      ++YFLT +  N + +   +Q+SG  ++++   D+E    +    +   +  Y    + T+ V++ V   DEY P F    F  +V  G  K GQ +    A+D+D G  GIV Y +  N S  F +N  TG I +K
Sbjct: 1035 SASLAYHLH---PDGDAAGFGIVSDSGWLFVKSALD----REAKEMYLLTVLATSGNGQLKKTGSAT-VRVSVMDENDNTPRFTQERAFLAVRENLPAGTGFGRV--------SASDRDAGLNGRLSYRLLHLDRHFQINSHTGEISTKLSLDRELQSSY----QLIVVAQDGGTPPRSATGTAFITVLDENDNAPSFSNAQTGRELLLQALEGQPSGFLLGTVHAKDPDEGENGTIFYS--MSGPRAERFTLNPNTGELRSSSALSHSERPEYSFIILASDRGSPPQSSIIALKIQVLSSSKGSPNTNSQPLILKSVEGAKPGSMIGSVRSPDSQALPES--GQVTFTVVGGTDFDGTFVVDRQTGDIYLARELDFEKCPRYTLQVEVDDFSMPLPKSDIITLIIDVQDSNDHSPEFPED-PIIIVVPENTDPGSSFYTFQAVDKDGSGPNSEVHYSILQQWPNIPDLLSLDPTTGALSLGMMLDHEKTSSLLLVVQASDSALDVSQRRRGSVTARIF-VTDVNDNEPVFIS--ASVVSVMEDQPVGFVVVYVMAVDADQGENGRVTYRIQSGNVRGKFSINPDTGSLSILRPIDREEEDLYNLTIVAEDHGLQQRSSSQLLSV--QVIDVNDEAPYFQESQYEAFIAENQPAGSTVLVVSASDMDQGTNGIVTYGSIVGD---DFSIHPVTGVITTTKALDREAQG---VYALTVYARDGGSPPNFAKTTVRVTVLDENDNRPAFGRVYYSLEVPENQEPVTLFTIRATDQDSGDSGLVYYRITDGDHF-GDFHLDKKLGVLSTSRALDRESRAKYTLTVEAQD-QGIPSLTSTVT-LDISVLDLNDNSPVFPSSSYSVEVSEDASAGSLVLEVSASDKDEGSNSQVVYFLSRESSGMFIVDQHTGRIITAATLDREKVASYNFQVYAMDS--SATNPRNSSAEVAVHILDVNDNAPFFITDPLIINVSISSLSNHRVLATMRAEDKDFGANGSVFYRFANPV-----KGFTINSLTGAIQATEKLQALTQSQRILIVEAMDQGNPSQSSLGVVIVYIREQSYQGVRFSRNTRDVSLQENAAKGTAVVQIH-AQYPDGSTSGINYSIFSGNKQQSFSISHHTGEIWVEDSTGLDFEETPRLRLVVKAETASSS--SFMAVNLLLQDVNDNLPRFQLHNYVAYVREAQGYDHPIIQVLANDLDQGQNGQVTYSIRSSSMSGLFKIDPITGSISTAAIMDREIWTQTNLVIMATDRGSPRLAGSATLTVIIVDLNDNSPTIPVP-REVRVPENTLIGTMITQVTGNDVDSGPALSYTLLLDSDTQGKFGIHRY--GGGVSLTTPLDFEIKTWYTLTVSSSDSKQQSHANLTILVEDVNDNAPVFSQDLYEVTLAEHSPAGSSVITVTATDKDSGENGRITYRVVSTKDMFYI---DPSNGTLFIKKEVEFDSQRPSILVVIEASDSGTPP---LTALSTVQVHVSDVNDNAPVF---HQTEYRASVSEDEVPGSTILTLEAADGDLSRDNCGF----DFAIASGNIGNTFQIESSVRFLEGHGFQTVGMLILADKLDFEIASSYNLTIVVSDRGIPQRSSSVPVLINVMDTNDNPPSFSRA--EYSAVVNEGAERGTEILQLFAIDPDST--------------------PNGEVQYS-ISSGDDSELFTVDQWTGAVRLRRSLDSEKQSSHMFVIQASDGQGHFALAPVTVEIKDINNNRPYFPLKSLTASIRENQPQNALVTILHAIDHDKGAYGELRYFLTYNAGNGKDSFLVNQTSG-EVRTRFTFDYEKTNTFNFIAIAMDTGNY----TATVTVQVFVTGEDEYDPVFTESDFAFHVPEGAKK-GQSIGQVNANDEDGGVDGIVLYTLA-NSSPYFELNTSTGVISLK 2853          

HSP 2 Score: 190.66 bits (483), Expect = 2.348e-47
Identity = 350/1448 (24.17%), Postives = 627/1448 (43.30%), Query Frame = 2
Query: 2948 SFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRII--DANNHSPILISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCP--LLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSC-AQNV-KIRIFVSDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNL--NVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGS---HVASFNIRRLKNLEVVYSI-KQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIV-ATDADSGPNSKLTYQINPSSDGIFMINGDSGEIH-------LVSSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIG-QLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITN-FLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCSPLNFMEKNIY---NLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRI---NIVKPPVNSEIFYVLNPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSN--ITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVI-VSDNGVP--SKCTTVLIDIS-LNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVN--YCKDHSA-KFSIIDG-------VNHELVFLH----ESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYK-KVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHE----FDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGL 7123
            S PN  + Y +    P  + +   ++PTTG L +   + + +   S ++ L+V  SD+           ++ RI   D N++ P+ IS +V  + +    G  V  ++  D D GENG +   ++  +    F I   + +  ++R    E  + Y    N+ ++A D G   +SS   L +  I+ N   P      Q  Q   F      +GS +  V+A D D+G N I  Y   +     D  +I   TG+ITT  +L   AQ V  + ++  D G P   +     +  L E  +         +  +P++ +P   +  +    ++ G   L     T   D F     D +  +L             Y+L V    + + S++S + +++ V  +  + P+F   S   +E+ E+  +GS    V++ +     N +VVY + ++    F+++  TG+++T    DRE      F V  + +  +NP+  +   + V I D NDN P+ ++    I+ +S  +  N  +   + A D D G N  + Y+      G F IN  +G I        L  S R+    L V   D G  P   S+   I +   ++   +RF  N+  ++L    +K   ++     Y   S+SG   I Y + +G   Q FS+   TG +  + S     +   E  ++ +V+++   AS      + + +   N+N PRF    +   + E +   +  + V+AND D G  G++ YS+   +      IDP TG +S + +  M++ I+   NL I+ATD             VII   N    T+        ++V EN+  GT++ ++   ++   P  S    + +       I+   G +    PL  E+  +  LT+       S+ S Q + A + + + D+NDN P+ +++  ++ +   +     +  ++ATD D   N  ITY+         +   M+ +D  +G LF+K  +    +    L VI  SD+G P  +  +TV + +S +N +         +A   V E+ V G+ I  ++  +    +D+    F+I  G       +   + FL     ++ G + +A   K+D E      L   VS  G   R     V+I+V D +DN P FS+ ++ A +NEG    T +++L   DPD   N +V+Y I      E F +D   G V+    L+   +S +  VI+AS     F  A   +TV I +IN+ RP   + +    +  N+P  + +T + A D D G  G + Y + +     +  FL V   SGE+   R     D  K        I +D   +++T  +++ V  ++ + P+  E+    ++    K+G  I  ++A D+D   +G V + L ++SP+F L
Sbjct: 1458 SGPNSEVHYSILQQWP-NIPDLLSLDPTTGALSL--GMMLDHEKTSSLL-LVVQASDSALDVSQRRRGSVTARIFVTDVNDNEPVFISASVVSVMEDQPVGFVVVYVMAVDADQGENGRVTYRIQSGNVRGKFSINPDTGSLSILRPIDREEEDLY----NLTIVAEDHGLQQRSSSQLLSVQVIDVNDEAPYF----QESQYEAFIAENQPAGSTVLVVSASDMDQGTNGIVTYGSIVG----DDFSIHPVTGVITTTKALDREAQGVYALTVYARDGGSPPNFAKTTVRVTVLDENDNRPAFGRVYYSLEVPENQEP-VTLFTIRATDQDSGDSGLVYYRITDG-DHFGDFHLDKKLGVLSTSRALDRESRAKYTLTVEAQDQGIPSLTSTVTLDISVLDLNDNSPVFPSSS-YSVEVSEDASAGSLVLEVSASDKDEGSNSQVVYFLSRESSGMFIVDQHTGRIITAATLDREKVASYNFQVYAMDSSATNPRNSSA-EVAVHILDVNDNAPFFIT-DPLIINVSISSLSNHRVLATMRAEDKDFGANGSVFYRFANPVKG-FTINSLTGAIQATEKLQALTQSQRI----LIVEAMDQGN-PSQSSLGVVIVYIREQSYQGVRFSRNTRDVSLQENAAKGTAVVQIHAQYPDGSTSG---INYSIFSGNKQQSFSISHHTGEIWVEDSTG---LDFEETPRLRLVVKA-ETASSSSFMAVNLLLQDVNDNLPRFQLHNYVAYVREAQGYDHPIIQVLANDLDQGQNGQVTYSIRSSSMSGLFKIDPITGSISTAAI--MDREIWTQTNLVIMATDRGSPRLAGSATLTVIIVDLNDNSPTIPVPR---EVRVPENTLIGTMITQVTGNDVDSGPALSYTLLLDSDTQGKFGIHRYGGGVSLTTPLDFEIKTWYTLTVS------SSDSKQQSHANLTILVEDVNDNAPVFSQDLYEVTLAEHSPAGSSVITVTATDKDSGENGRITYRV-------VSTKDMFYIDPSNGTLFIKKEVEFDSQRPSILVVIEASDSGTPPLTALSTVQVHVSDVNDNAPVFHQTEYRA--SVSEDEVPGSTILTLEAADGDLSRDNCGFDFAIASGNIGNTFQIESSVRFLEGHGFQTVGMLILAD--KLDFEIASSYNLTIVVSDRGIPQRSSSVPVLINVMDTNDNPPSFSRAEYSAVVNEGAERGTEILQLFAIDPDSTPNGEVQYSISSGDDSELFTVDQWTGAVRLRRSLDSEKQSSHMFVIQASDGQGHFALAP--VTVEIKDINNNRPYFPLKSLTASIRENQPQNALVTILHAIDHDKGAYGELRYFLTYNAGNGKDSFL-VNQTSGEV---RTRFTFDYEKTNTFNFIAIAMDTGNYTATVTVQVFVTGEDEYDPVFTESDFAFHVPEGAKKGQSIGQVNANDEDGGVDGIVLYTLANSSPYFEL 2843          

HSP 3 Score: 180.259 bits (456), Expect = 2.990e-44
Identity = 396/1695 (23.36%), Postives = 691/1695 (40.77%), Query Frame = 2
Query: 2462 SNKTLMFQV-SAKAPKSQTSFAQVIIYIEDGIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSDEYQII------QSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTN---FTFEDLSSL-------GEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTN-VFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPL-NVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDN--EDQINIDSWTGLITTKVSLSCAQ---NVKIRIFVSDLGFPKMTSSVDTLL------KPLYEPKSEEFLINKN---------LTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVK-NVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHV----ASFNIRRLKNLEVVYSIKQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQI-NPSSDGIFMINGDSGEIHLVSS------PRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFII-------GQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDA-SIYDLQRIFINIDYGNENPPRFS--RSIFKVK--LPEDEAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCS-PLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFN----ATHFSLKVLENSPGGTVLGRINIVKPP--VNSEIFYVLN-PGHSHIQINTTTGELRTNGPL-HLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAEN--PVKIFIPNSNQPQKPLTKLSATDSD---KTSNITY------QFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVP---SKCTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSA-----KFSIIDGVNH--ELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEI----RGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDA----RFSSTAVIEIDVEDKNNHVPILKENGRV-INLSSSLKRGSKILY-LHAIDKDLRDNGKVTFELVSTSPWFG-------------LRGFDNNTAALF-LIDEPQEKGHP 7189
            S+ TL+ +     +PK        +I  +   + P F+ S     I EN   G  I+QVF       D   ++      QS    +  I S+TG I LNK  D E      + VQ ++   +A+     N       + Y  N  T    F  ED S         G+    +  +D D     N++  ++     G N  F +      + +I    I +        L V+ +D+G   PL  E   ++++ID N++ P+         I + A  G+ V  +  +D+D G NG+++ S+ Q    +  + +  S +     V +L  ++   +P  ++ ++A+DRG P  SS   + +   + N N P       +  +    P  +      V A D D G     +YS+     +    Q  +D   G I T  SL   Q   N    +   D G     + V   L      +P + P S    ++           +T   PD ++ G V       PE  G+   F  N  T V             I L   L+ K N   ++ V        +   N  +N+ +     + P+F +    F+ + E+   G+ V    AS     LK++  + S   P  YF ++  TG L T    D E +  +   V+    H  NP  F    + + ++D NDN P  L  SS  + +   T     ++++ A D DSGPN  L++ +   S+   F I+ +SG + L+ S      PR   Y+L V  +DSG    S +    IH Q+   +  +                 + F+        G ++   +S+S +L   Y+L     A  F +   +G +  + ++ RE     E+  + V+  S +          + +++   N+N PRF+  R+   V+  LP   A T F  V A+D D G+ GR+ Y L     D+   I+  TG++S    L+   ++ Y L ++A D  G +  R       I V +   +  +F+         L+ LE  P G +LG ++   P    N  IFY ++ P      +N  TGELR++  L H E  E+      +F    S R     S+II ++I  ++ ++  P  N  P+ +      +P   +  + + DS    ++  +T+       FD +          +++D ++G+++L   +      R+ L+V V D  +P   S   T++ID+  + DH   +   +  I  V EN+  G+     + V+  KD S       +SI+    +  +L+ L  +TG +  +    +D EK   ++L  Q S    ++    RG     I V DV+DN+PVF     V+ + E QP    V+ +   D D G N +V Y I+  + + +F I+ + G +    P++   + +Y+L I A         +   L+V ++++ND+ P          +  N+P GS +  ++A D D G +GI   + +  +      ++    +G I  ++ L     G +   +   D      F+ T V  + V D+N++ P     GRV  +L     +    L+ + A D+D  D+G V +  ++    FG              R  D  + A + L  E Q++G P
Sbjct:  215 SSYTLLLEAFDGGSPKRTGQMILDVIVQDINDNAPVFNQSRYHAMISENLQPGNNILQVFASDADEGDNGLVLYDINRRQSDPDHYFVIDSRTGVITLNKPLDYEMRRVHELVVQARD---NASQPEVTNSFVTIQVRDYNDNQPTMTIIFLSEDGSPRISEGAQPGQYVARISVTDPDYGEYANVNVSLE-----GGNGKFALTTKDSIIYLICVDQILDREEQDHYELRVMATDSG-TPPLRAESSFTIQVIDVNDNPPLFDQQEYTQVIPEVAFPGSFVVQVTARDKDQGPNGDVQYSILQ---NEGTHSDWFSVDAVTGVVTTLTQLDYEIDPTPSITVVASDRGRPPLSSTAVVKVILQDINDNEPVFGSKFYNASIKENAPARTC--FMEVTATDADGGSFGSISYSLGSGQGSVTPSQFTVDKHNGQICTTTSLDRDQGPANYDFTVTAVDGGGLSSVAYVRVDLIDINDNQPAFYPVSYAVSLSTQSAPGTSVLKVTAHDPDAAENGRVT--YRTVPE--GSSPFFTLNKDTGV-------------ISLSRALHGKANSVITMVVSAQDGGGLTAPVNARVNISIVAGLVAPPVFEQAQYYFV-VSEDALRGTQVGVVRASTKNGVLKDISYIISSGDPTGYFTVDSETGALRTSLPLDHEAQPSLNLEVQA---HCGNPPAFGQTRVRITVSDVNDNAPVFLPSSSESLILPEDTRMGTVVYKVQAEDRDSGPNGLLSFDLFTSSAHRTFSIDRNSGHLRLIGSLSYETMPR---YDLQVIAKDSGAPQLSSTFTLVIHVQAENGQGPVFDSLTYRVELKESTPLNTRFLQVRAVNRDGGITTGLSSTSASL--AYHLHPDGDAAGFGIVSDSGWLFVKSALDREA---KEMYLLTVLATSGNGQLKKTGSATVRVSVMDENDNTPRFTQERAFLAVRENLP---AGTGFGRVSASDRDAGLNGRLSYRLL--HLDRHFQINSHTGEISTKLSLDRELQSSYQLIVVAQD--GGTPPRSATGTAFITVLDENDNAPSFSNAQTGRELLLQALEGQPSGFLLGTVHAKDPDEGENGTIFYSMSGPRAERFTLNPNTGELRSSSALSHSERPEY------SFIILASDRGSPPQSSIIALKIQVLSSSKGSPNTNSQPLILKSVEGAKPGSMIGSVRSPDSQALPESGQVTFTVVGGTDFDGT----------FVVDRQTGDIYLARELDFEKCPRYTLQVEVDDFSMPLPKSDIITLIIDVQDSNDHS-PEFPEDPIIIVVPENTDPGSSFYTFQAVD--KDGSGPNSEVHYSILQQWPNIPDLLSLDPTTGAL--SLGMMLDHEKTSSLLLVVQASDSALDVSQRRRGSVTARIFVTDVNDNEPVFISASVVSVM-EDQPVGFVVVYVMAVDADQGENGRVTYRIQSGNVRGKFSINPDTGSLSILRPIDREEEDLYNLTIVAEDHGLQQRSSSQLLSVQVIDVNDEAPYFQESQYEAFIAENQPAGSTVLVVSASDMDQGTNGI---VTYGSIVGDDFSIHPV--TGVITTTKALDREAQGVYALTVYARDGGSPPNFAKTTV-RVTVLDENDNRPAF---GRVYYSLEVPENQEPVTLFTIRATDQDSGDSGLVYYR-ITDGDHFGDFHLDKKLGVLSTSRALDRESRAKYTLTVEAQDQGIP 1827          

HSP 4 Score: 174.866 bits (442), Expect = 1.241e-42
Identity = 498/2298 (21.67%), Postives = 910/2298 (39.60%), Query Frame = 2
Query:  221 KFIISKTTGVIKVSGLIDREKQNL-YSFLIISMNG----DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGH--PPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP-FHTSKXXXXXXXXXXXXXXXSIQILWTGGLSE---INRDISPNTIVAHVKLTDYDAIST---SFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEI-DSTILNEN-QHVTFVK-----TTKRLPTKPIFIFKIFVLNNL--FKINETTGEILSKRSIDC-GKYFFNVSMLSLKTNSLIDQT-----KLEIVVKSGRKLPLYFDRGFRKILVTTGKSQCFSEIAVRNRHCGMRIQYSYDLLLKTDGILRINEH-GALCTAENVKHNKLMSTRYLYQIKALD------ETNSSAVCVVLFAIQPSKVFDVLPTEINITLPIIDSPKFNFSLPIGKIIGTF-SKLPPAQFIGFIQYHLVPEELSTGAITVDSQSGEILMKKFPIHKNPIR---LIVKSVIRKPFNVSPLNIVAINFQKLFFARS-----LYQFILTKSEIKGNLVKIGQV-SMDSSC---TESVSYDLFGVKNDHSHFTIDVATGVIYGK---DLGSISNKTLMFQVSA-KAPKSQTSFAQVIIYIEDG-IHQPGFDFSDLLVNIWENTTVGIEI--MQVFPK---YPSVSDEYQIIQS--QYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLI--------GSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNV-FYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPP-------EIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVKIRIFVS--DLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNV-VFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLKNL----EVVYSIKQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQI-NPSSDGIFMINGDSGEIHLVSSPRVSAYE---LNVTVRDSGEVPKSVS-VVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLT-VVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLS-CSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPV--NSEIFYVLNPGHSHIQINTTTGELRTNGPLHLE-----LVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSD-KTSNITYQFDRSDP----TTQTLYKMYLLDGKS----GNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTT--VLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMV--NYCKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYS--SQEEFLID-ANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGP-DGI 6769
            +F + K  G I  +  +DR++    Y F + +++G        V++ ++D+NDN+P F   ++  S+      G+ V   T  DPD  +N   + R V   S   F +   +   G+    + L ++L  +  S   +V+ A DGG    P+ A + + I+        P F+ ++Y   + ED         VRA+  + GV  ++ Y + +  P+  +FTVD +TG +     LD E   S ++ +     +PP F  ++V + +  ++ N        ++    SE   +  D    T+V  V+  D D+      SFDL     S  +   I      L+LI  +        +L + A D   P LS+T  L I +         F    ++VE+ +ST LN     V  V      TT    T     + +    +   F I   +G +  K ++D   K  + +++L+   N  + +T     ++ ++ ++        +R F  +         F  ++  +R  G+  + SY  LL  D   +IN H G + T   +  ++ + + Y   + A D          +A   VL     +  F    T   + L  ++        P G ++GT  +K P     G I Y +          T++  +GE+       H        +I+ S    P   S   I+A+  Q L  ++          IL   E       IG V S DS     +  V++ + G  +    F +D  TG IY     D       TL  +V     P  ++    +II ++D   H P F    +++ + ENT  G      Q   K    P+    Y I+Q      D LS+   TG + L    D E+ S L++ VQ  +          GS T    + + D+NDN+P   ++      ED   +G +   +   DAD   NG ++YR   I+   +   F INP TG L I+  ++    +   + NL ++  D+G  +   +   +SV++ID N+ +P    +    +I +    G+   T+L+      + G   I          F I  ++      +    E    Y     + + A D GSP   +   + +  ++ N N P        + +P+  + +           +FT+ A D D G + +  Y I    D+    ++D   G+++T  +L      K  + V   D G P +TS+V   +  L    +     + + +  + + +  G +V +++   ++ G+    +   +    G   +   + ++I        K   Y+  V   +       +S+  + V +  V  + P F  D P  + +  +  S   V +      K+      V Y    P K F IN +TG +         T++Q    VE  A    NP   ++  +IV I  E   +    S ++  V +     +  ++ QI A   D G  S + Y I + +    F I+  +GEI +  S  +   E   L + V+   E   S S +  ++  Q +   +  RF  ++    +   Q     II Q+  +      N  + Y + +   + +F +DPITGS+ T   + RE    + +V +     S   A    L  I +++   N+N P       +V++PE+  I   +T V  ND D G        L+ DT   K  I    G +S  +PL+F  K  Y L + ++DS+     ++    + I V++   +   F+   + + + E+SP G+ +  +         N  I Y +        I+ + G L     +  +     ++  IE +        +  ++Q         + D+NDN P+  +   +  +     P   +  L A D D    N  + F  +      T Q    +  L+G      G L L   +   +   + L ++VSD G+P + ++  VLI++    D+       E +   V E +  GT I Q+  +  +   +   ++SI  G + EL  + + TG + +  +  +D EK    +   Q S G         V + + D+++N+P F      A + E QP    V  L   D D G   ++ YF+ + +   ++ FL++  +G+V+T    ++   + ++ +  A    +    A   + V++   ++  P  +  +    +      G  I ++ A D DG  DGI
Sbjct:  625 QFTVDKHNGQICTTTSLDRDQGPANYDFTVTAVDGGGLSSVAYVRVDLIDINDNQPAFYPVSYAVSLSTQSAPGTSVLKVTAHDPDAAENGRVTYRTVPEGSSPFFTL---NKDTGV----ISLSRALHGKANSVITMVVSAQDGGGLTAPVNARVNISIVAGLVAP--PVFEQAQYYFVVSEDALRGTQVGVVRASTKN-GVLKDISYIISSGDPTG-YFTVDSETGALRTSLPLDHEAQPSLNLEVQAHCGNPPAFGQTRVRITVSDVNDNAP------VFLPSSSESLILPEDTRMGTVVYKVQAEDRDSGPNGLLSFDL--FTSSAHRTFSIDRNSGHLRLIGSLSYETMPRYDLQVIAKDSGAPQLSSTFTLVIHVQAENGQGPVFDSLTYRVELKESTPLNTRFLQVRAVNRDGGITTGLSSTSASLAYHLHPDGDAAGFGIVSDSGWLFVKSALDREAKEMYLLTVLATSGNGQLKKTGSATVRVSVMDENDNTPRFTQERAFLAVRENLPAGTGFGRVSASDRDAGLNGRLSY-RLLHLDRHFQINSHTGEIST--KLSLDRELQSSYQLIVVAQDGGTPPRSATGTAFITVLDENDNAPSFSNAQTGRELLLQALE------GQPSGFLLGTVHAKDPDEGENGTIFYSMSGPRAER--FTLNPNTGELRSSSALSHSERPEYSFIILASDRGSPPQSS---IIALKIQVLSSSKGSPNTNSQPLILKSVEGAKPGSMIGSVRSPDSQALPESGQVTFTVVGGTDFDGTFVVDRQTGDIYLARELDFEKCPRYTLQVEVDDFSMPLPKSDIITLIIDVQDSNDHSPEFPEDPIIIVVPENTDPGSSFYTFQAVDKDGSGPNSEVHYSILQQWPNIPDLLSLDPTTGALSLGMMLDHEKTSSLLLVVQASDSALDVSQRRRGSVT--ARIFVTDVNDNEPVFISASVVSVMED-QPVGFVVVYVMAVDADQGENGRVTYR---IQSGNVRGKFSINPDTGSLSILRPIDREEED---LYNLTIVAEDHG-LQQRSSSQLLSVQVIDVNDEAPYFQESQYEAFIAENQPAGS---TVLVVSASDMDQGTNGIVTYGSIVGDDFSIHPVTGVITTTKALDREAQGVYA----LTVYARDGGSPPNFAKTTVRVTVLDENDNRPAFGRVYYSLEVPENQEPVT----------LFTIRATDQDSGDSGLVYYRITDG-DHFGDFHLDKKLGVLSTSRALDRESRAKYTLTVEAQDQGIPSLTSTVTLDISVLDLNDNSPVFPSSSYSVEVSEDASAGSLVLEVSASDKDEGSNSQVVYFLSRESSGMFIVDQHTGRIITAATLDREKVASYNFQVYAMDSSATNPRNSSAEVAVHILDVNDNAPFFITD-PLIINVSISSLSNHRVLATMRAEDKDFGANGSVFYRFANPVKGFTINSLTGAIQATEKLQALTQSQRILIVE--AMDQGNPSQSSLGVVIVYIR-EQSYQGVRFSRNTRDVSLQENAAKGTAVVQIHAQYPD-GSTSGINYSIFSGNKQQSFSISHHTGEIWVEDSTGLDFEETPRLRLVVK--AETASSSSFMAVNLLLQDVN-DNLPRFQLHNYVAYVREAQGYDHPII-QVLANDLDQGQNGQVTYSIRSSSMSGLFKIDPITGSISTAAIMDREIWTQTNLVIMATDRGSPRLAGSATLTVIIVDL---NDNSPTIPVP-REVRVPENTLIGTMITQVTGNDVDSGPALSYTLLLDSDT-QGKFGIHRYGGGVSLTTPLDFEIKTWYTLTVSSSDSK-----QQSHANLTILVEDVNDNAPVFSQDLYEVTLAEHSPAGSSVITVTATDKDSGENGRITYRVVSTKDMFYIDPSNGTLFIKKEVEFDSQRPSILVVIEASDSGTPPLTALSTVQV-------HVSDVNDNAPVFHQTEYRASVSEDEVPGSTILTLEAADGDLSRDNCGFDFAIASGNIGNTFQIESSVRFLEGHGFQTVGMLILADKLDFEIASSYNLTIVVSDRGIPQRSSSVPVLINVMDTNDNPPSFSRAEYSAV-VNEGAERGTEILQLFAIDPDSTPNGEVQYSISSGDDSELFTVDQWTGAVRLRRS--LDSEKQSSHMFVIQASDGQGHF-ALAPVTVEIKDINNNRPYFPLKSLTASIRENQPQNALVTILHAIDHDKGAYGELRYFLTYNAGNGKDSFLVNQTSGEVRTRFTFDYEKTNTFNFIAIAMDTGN--YTATVTVQVFVTGEDEYDPVFTESDFAFHVPEGAKKGQSIGQVNANDEDGGVDGI 2829          

HSP 5 Score: 165.622 bits (418), Expect = 8.626e-40
Identity = 112/348 (32.18%), Postives = 173/348 (49.71%), Query Frame = 2
Query:  116 LIFSIKENVPIGEVVGQIESPGFSPPFE-----MHDFQ----EKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSD-FFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNS--PPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYD 1123
            L   + E  P G VVG I S G  P        + D Q         I ++TG+IK + ++DRE ++ YSF+ ++M G T  V I + D+ND+ P F        IPE   IG+K  L    D DE + + Q   I  G+  + F ++    SN + Y+ L++   LD E  S + L+++A DGG P     +++ +IVQ+ NDN P F+ SRY A I E+ +     L+V A+D D G +G + Y ++      D +F +D +TG + L K LD+E  + H + +  RDN+  P    S V + +   + N    +I  L   G   I+    P   VA + +TD D
Sbjct:   44 LQLQLDEEQPAGTVVGDI-SAGLPPDMTASHYFISDHQGTGVSTDLDIDESTGIIKTARVLDREVRDRYSFIAVTMTGITVEVTILVNDINDHAPVFPRKRATFKIPEQTTIGTKFPLEPAVDADEDQLTTQGYIITDGNVGQAFLLETKRGSNKVLYLDLVVNAVLDRETRSSYTLLLEAFDGGSPKRTGQMILDVIVQDINDNAPVFNQSRYHAMISENLQPGNNILQVFASDADEGDNGLVLYDINRRQSDPDHYFVIDSRTGVITLNKPLDYEMRRVHELVVQARDNASQPEVTNSFVTIQVRDYNDNQPTMTIIFLSEDGSPRISEGAQPGQYVARISVTDPD 390          

HSP 6 Score: 159.458 bits (402), Expect = 6.599e-38
Identity = 333/1442 (23.09%), Postives = 587/1442 (40.71%), Query Frame = 2
Query: 4322 RMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSP--SSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQI---NPSSDGIFMINGDSGEIHLVSSPRVSAYELN------VTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFA---QIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAI-TNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCS-PLNFMEKNIYNLKIIATDSEGLST---GRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINI-VKPPVNSEIFYVLNPGH--SHIQINTTTGELRTNGPLHLELVEFIELTIHAFA----KFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFRV--KENSVDGTFIGQIKMVNYCKDHSAKFSII----------DGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIR--GYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKIS--IPNRNLKLDT--NRPVGSFITKITAKDSD-GPDG-ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARF---SSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAID-KDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEPQ-EKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDS---DKAIFYKIDNFHP-ISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTC---AIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQ-KPA--IISNLLQMDKN---SFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESRIWNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHD------IQYFLTPHENFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNV-EGGIPKLGQILFTAYASDKDRGRFGIVSYQIVENPSENFG 8431
            ++ DRE   Q  + + V+AT    P +       +++ D NDN P       +  I  ++ P    + + Q+ A D D GPN  + Y I     +    F ++  +G   +V++     YE++      V   D G  P S + V  +  Q I     +       +       +++ F+    + +   S G+  I Y L +G+ +     F+VD   G + T  S+ R++            + ++    +  +  + +++   N+N P F    + V L    A  T+ L V A+DPD    GR+ Y    +       ++  TG +S S  L+    ++  + + A D  GL+     R + + V   V         F    +   V E++  GT +G +    K  V  +I Y+++ G    +  +++ TG LRT+ PL  E    + L + A       F  TR   T S + D   + +    P  +E+   + +P   +    + K+ A D D   N    FD     T + ++ + +D  SG+L L  S+      R+ L+VI  D+G P   +T  + I +  ++    +  +   +RV  KE++   T   Q++ VN     +   S            DG       + +S G +FV +A  +DRE  +  +L    + G  +++  G   V + V D +DN P F+Q +    + E  P  T   R++  D D G N ++ Y          F I+++ G++ T + L+   +S Y L++ A    +P   A     + +++ ND  P  S     R L L     +P G  +  + AKD D G +G I Y +   +    TL  N    +GE+  S  L  S+  ++ F I+  D      SS   ++I V   +   P       ++      K GS I  + + D + L ++G+VTF +V  + + G    D  T  ++L  E   EK   Y L +++ D ++   K    I  L + ++    + P         I +PE+   GS    F   D D    +  + Y I    P I + L LD  +G L L   L++      LL+V     A+  S  +  S    + +   N      DN+ + +S  V  +++ +P   ++  ++ +D +   + R +Y +      Q  N+    S   D+ ++      D  E  ++NLTI+       Q S S L     + VN E P           +  +    I EN+P  +TVL +     D      + Y     ++F +       +G  I +   LD E    Y L +  +           T  V ++VLD ++  P F    ++  V E   P     LFT  A+D+D G  G+V Y+I +   ++FG
Sbjct:  424 QILDRE--EQDHYELRVMATDSGTPPLRAESSFTIQVIDVNDNPPLFDQQEYTQVIPEVAFP---GSFVVQVTARDKDQGPNGDVQYSILQNEGTHSDWFSVDAVTG---VVTTLTQLDYEIDPTPSITVVASDRGRPPLSSTAVVKVILQDINDNEPVFGSKFYNASIKENAPARTCFMEVTATDADGGSFGS--ISYSLGSGQGSVTPSQFTVDKHNGQICTTTSLDRDQ----GPANYDFTVTAVDGGGLSSVAYVRVDLIDINDNQPAFYPVSYAVSLSTQSAPGTSVLKVTAHDPDAAENGRVTYRTVPEGSSPFFTLNKDTGVISLSRALHGKANSVITMVVSAQDGGGLTAPVNARVNISIVAGLVAPP-----VFEQAQYYFVVSEDALRGTQVGVVRASTKNGVLKDISYIISSGDPTGYFTVDSETGALRTSLPLDHEAQPSLNLEVQAHCGNPPAFGQTRVRITVSDVNDNAPVFL----PSSSES---LILPEDTRMGTVVYKVQAEDRDSGPNGLLSFDL---FTSSAHRTFSIDRNSGHLRLIGSLSYETMPRYDLQVIAKDSGAPQLSSTFTLVIHVQAENGQGPVF-DSLTYRVELKESTPLNTRFLQVRAVNRDGGITTGLSSTSASLAYHLHPDGDAAGFGIVSDS-GWLFVKSA--LDREAKEMYLLTVLATSGNGQLKKTGSATVRVSVMDENDNTPRFTQERAFLAVRENLPAGTGFGRVSASDRDAGLNGRLSY--RLLHLDRHFQINSHTGEISTKLSLDRELQSSYQLIVVAQDGGTPPRSATGTAFITVLDENDNAPSFSNAQTGRELLLQALEGQPSGFLLGTVHAKDPDEGENGTIFYSMSGPRAERFTLNPN----TGELRSSSALSHSERPEYSFIILASDRGSPPQSSIIALKIQVLSSSKGSPNTNSQPLILKSVEGAKPGSMIGSVRSPDSQALPESGQVTFTVVGGTDFDGTFVVDRQTGDIYLARELDFEKCPRYTLQVEVDDFSMPLPKS--DIITLIIDVQDSNDHSPEFP-EDPIIIVVPENTDPGSSFYTFQAVDKDGSGPNSEVHYSILQQWPNIPDLLSLDPTTGALSLGMMLDHEKTSSLLLVVQASDSALDVSQRRRGSVTARIFVTDVN------DNEPVFISASVVSVMEDQPVGFVVVYVMAVDADQGENGRVTYRI------QSGNVRGKFSINPDTGSLSILRPIDREEEDLYNLTIVAEDHGLQQRSSSQLLSVQVIDVNDEAP---------YFQESQYEAFIAENQPAGSTVLVVSASDMDQGTNGIVTYGSIVGDDFSI----HPVTGV-ITTTKALDREAQGVYALTVYARDGGSPPNFAKTT--VRVTVLDENDNRPAFGRVYYSLEVPENQEPV---TLFTIRATDQDSGDSGLVYYRITDG--DHFG 1790          

HSP 7 Score: 151.369 bits (381), Expect = 1.884e-35
Identity = 336/1504 (22.34%), Postives = 627/1504 (41.69%), Query Frame = 2
Query: 4172 FLEIKENLPSGSHVASFNIR---RLKNLEVVYSIKQPE-KYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNS-KLTYQINPSSD--GIFMINGDSGEIHLVSS---PRVSAYELNVTVRD-SGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAG--KFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYD----LQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLT-VVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLS-CSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINI--VKPPVNSEIFYVLNPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSN--ITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFRVKE-NSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHE---LVFLHESTGKIFVAAAAKIDREKIDK--IILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIR-LTVYDPDIGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGP-DGISYRIRHRKLTNQTLFLNVAFDSGEIFL--SRKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAAL---FLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLL-----KYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKAIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKEN-KGPNLIDNKY-ITLSLQVPEMIQKPAIISNLLQMDKNS---FRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDL-FESRIWNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHDIQY------FLTPHEN----FELTCSQSQSSGCNIKSKSV------LDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIVE-NPSENFGINNETGAIYIKNQFIIEKK 8488
             L+  E  PSG  + + + +     +N  + YS+  P  + F +NP TG+L +          +  F +  +A+   +P   +++ L +++   +   P   S    I++        + I  + + D+ + P S ++T+ +   +D  G F+++  +G+I+L       +   Y L V V D S  +PKS  +   I  Q     S        + +        S F   Q +  +  S  N ++ Y ++        + S+DP TG++     +  E+   S ++ +     S  D S         RIF+  D  +  P   S S+  V   ED+ +   +  V+A D D G  GR+ Y ++      K  I+P TG LS   P++  E+++YNL I+A D  GL   R     + + V +       F  + +   + EN P G+ +  ++   +    N  + Y    G     I+  TG + T   L  E      LT++A          +TT   + V ++D NDN+P        + +P + +P    T + ATD D   +  + Y+    D      +  + LD K G L    ++    + ++ L V   D G+PS  +TV +DIS+   +    + P  +       ++  G+ + ++   +  KD  +   ++  ++ E   +  + + TG+I  AA   +DREK+      ++   S   +      +V +H+ DV+DN P F  +  +  ++        V+  +   D D G N  V  F  F +  + F I++  G ++    L   T+S   L+++A  + +P   +   + VYI   + Q  + S   R++ L  N   G+ + +I A+  DG   GI+Y I      N+    +++  +GEI++  S  L   +  +    +  + A  SS   + + ++D N+++P  + +  V  +  +      I+ + A D D   NG+VT+ + S+S   GL   D  T ++    ++D  +E      L I  TD       RL     LTV++       P    PR       E+ +PE+   G+ IT+    D+DS  A+ Y +           +    G + LT  L++ I+  + L V+ +     ++ +  NL++ +E  N   P    + Y +TL+   P      + +  +   DK+S    R +Y ++S              F ID SN   +I  ++ F+S+  ++ +++++A      P            ++V    + +             ++E+E P +T+L L     D+        F     N    F++  S     G   ++  +      LDFE   +Y L +++       RS S  + V I+V+D ++  P F    ++  V  G  +  +IL   +A D D    G V Y I   + SE F ++  TGA+ ++     EK+
Sbjct: 1222 LLQALEGQPSGFLLGTVHAKDPDEGENGTIFYSMSGPRAERFTLNPNTGELRSSSALSHSERPEYSFII--LASDRGSPPQSSIIALKIQVLSSSKGSPNTNS-QPLILKSVEGAKPGSMIGSVRSPDSQALPESGQVTFTVVGGTDFDGTFVVDRQTGDIYLARELDFEKCPRYTLQVEVDDFSMPLPKSDIITLIIDVQDSNDHSPEFPEDPIIIVVPENTDPGSSFYTFQ-AVDKDGSGPNSEVHYSILQQWPNIPDLLSLDPTTGALSLGMMLDHEK--TSSLLLVVQASDSALDVSQRRRGSVTARIFVT-DVNDNEPVFISASVVSVM--EDQPVGFVVVYVMAVDADQGENGRVTYRIQSGNVRGKFSINPDTGSLSILRPIDREEEDLYNLTIVAED-HGLQQ-RSSSQLLSVQVIDVNDEAPYFQESQYEAFIAENQPAGSTVLVVSASDMDQGTNGIVTYGSIVGDD-FSIHPVTGVITTTKALDREAQGVYALTVYARDGGSPPNFAKTT---VRVTVLDENDNRPAFGRVYYSLEVPENQEPVTLFT-IRATDQDSGDSGLVYYRITDGD-----HFGDFHLDKKLGVLSTSRALDRESRAKYTLTVEAQDQGIPSLTSTVTLDISVLDLNDNSPVFPSSSYSVEVSEDASAGSLVLEVSASD--KDEGSNSQVVYFLSRESSGMFIVDQHTGRIITAAT--LDREKVASYNFQVYAMDSSATNPRNSSAEVAVHILDVNDNAPFFITDPLIINVSISSLSNHRVLATMRAEDKDFGANGSV--FYRFANPVKGFTINSLTGAIQATEKLQALTQSQRILIVEAMDQGNPSQSSLGVVIVYIREQSYQGVRFSRNTRDVSLQENAAKGTAVVQIHAQYPDGSTSGINYSIFS---GNKQQSFSISHHTGEIWVEDSTGLDFEETPRLRLVVKAETASSSSFMAVNLLLQDVNDNLPRFQLHNYVAYVREAQGYDHPIIQVLANDLDQGQNGQVTYSIRSSS-MSGLFKIDPITGSISTAAIMD--REIWTQTNLVIMATDRG---SPRLAGSATLTVIIVDLNDNSPTIPVPR-------EVRVPENTLIGTMITQVTGNDVDSGPALSYTLLLDSDTQGKFGIHRYGGGVSLTTPLDFEIKTWYTLTVSSS---DSKQQSHANLTILVEDVNDNAPVFSQDLYEVTLAEHSP----AGSSVITVTATDKDSGENGRITYRVVSTK----------DMFYIDPSNGTLFIKKEVEFDSQRPSI-LVVIEASDSGTPPLT------ALSTVQVHVSDVNDNAPVFHQTEYRASVSEDEVPGSTILTLEAADGDLSRDNCGFDFAIASGNIGNTFQIESSVRFLEGHGFQTVGMLILADKLDFEIASSYNLTIVVSDRGIPQRSSS--VPVLINVMDTNDNPPSFSRAEYSAVVNEGAERGTEIL-QLFAIDPDSTPNGEVQYSISSGDDSELFTVDQWTGAVRLRRSLDSEKQ 2655          

HSP 8 Score: 136.732 bits (343), Expect = 4.320e-31
Identity = 353/1581 (22.33%), Postives = 634/1581 (40.10%), Query Frame = 2
Query: 3149 VEISVRIIDANNHSPILISTNV-FYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEK-------LSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQ-INIDSWTGLITTKVSLSCAQNVKIRIFV---SDLGFPKMTSSVDTLLKPLY---EPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDG----FLHLRFDSQQLILLKDNL--NVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLE-IKENLPSGSHVASFNIR---RLKNLEVVYSIKQPE----KYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSP-SSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGI----FMINGDSGEIHLVSS----PRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDL--QRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCS-PLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAF-NATHFSLKVLENSPGGTVLGRINI--VKPPVNSEIFYVL--NPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQ-PIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDG---------KSGNLFXXXXXXXXXXIRHFLKVIV-SDNGVPSKCTTVLIDIS-LNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVF----------LHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIR-GYKKVIIHXXXXXXNKPVFSQ----NKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDG-PDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARF----SSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRD-NGKVTFELVSTSPWF-GLRGFDNNTAAL---FLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDK--AIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQ-IEKENKGPNLIDNKY 7630
            VE+++ + D N+H+P+       F I +    GT+       D D  +       +   +  Q F +E        L  +  V  V   ET +SY     ++L A D GSP ++  + L +   + N N P     + H   +    L  G+ I  V A D D+G N +  Y I     + D    IDS TG+IT    L         + V    +   P++T+S  T+    Y   +P      ++++ +  I + +QPG  V  +++   +YG      +N   S++G    F     DS   ++  D +    +  HY L V+        + +     + V  V  + PLF  D  ++ + I E    GS V     R   +  N +V YSI Q E     +F ++ VTG + T    D E +      + V+A+    P + +   + V + D NDNEP   S   ++ ++ +AP        ++ ATDAD G    ++Y +      +    F ++  +G+I   +S       + Y+  VT  D G     +S V  +    I                    QS  G  + +++     ++ N  + Y  +    +  F+++  TG +    S+SR   G +  V I +V+ +     +      R+ I+I  G   PP F ++ +   + ED      + VV      G+   I Y +          +D  TG L  S PL+   +   NL++ A      + G+   T+V I V +   +   F  ++  SL + E++  GTV+ ++         N  + + L  +  H    I+  +G LR  G L  E +   +L +   AK   + + Q +S    V  +   + Q P+      ++ +  S        ++ A + D    IT        T+ +L      DG          SG LF+KS++    K  + L V+  S NG   K  +  + +S ++++    +   E+A   V+EN   GT  G++       D  A      G+N  L +          ++  TG+I  +    +DRE      L      GG+  R       I V D +DN P FS      + +    EGQP    +  +   DPD G N  + Y +    + E F ++ N G+++++  L+   +  Y  +I AS + SP   +   L + +++ +   P  +     LK       GS I  + + DS   P+           T+      V   +G+I+L+R+L      ++   + VDD       S    + IDV+D N+H P   E+  +I +  +   GS      A+DKD    N +V + ++   P    L   D  T AL    ++D   EK     L +Q +D+A+D  +R        + +       P  I   ++ +++ E    G  +   +  D D  +   + Y+I + + +     ++ ++G L + + ++   +  + L +     G  ++ +S  LSVQ I+  ++ P   +++Y
Sbjct:  123 VEVTILVNDINDHAPVFPRKRATFKIPEQTTIGTKFPLEPAVDADEDQLTTQGYIITDGNVGQAFLLETKRGSNKVLYLDLVVNAVLDRETRSSY----TLLLEAFDGGSPKRTGQMILDVIVQDINDNAPVFNQSRYHA--MISENLQPGNNILQVFASDADEGDNGLVLYDINRRQSDPDHYFVIDSRTGVITLNKPLDYEMRRVHELVVQARDNASQPEVTNSFVTIQVRDYNDNQPTMTIIFLSEDGSPRISEGAQPGQYVARISVTDPDYGE----YANVNVSLEGGNGKFALTTKDSIIYLICVDQILDREEQDHYELRVMATDSGTPPLRAESSFTIQVIDVNDNPPLF--DQQEYTQVIPEVAFPGSFVVQVTARDKDQGPNGDVQYSILQNEGTHSDWFSVDAVTGVVTTLTQLDYEIDPTPS--ITVVASDRGRPPLSSTAVVKVILQDINDNEPVFGSKFYNASIKENAPA--RTCFMEVTATDADGGSFGSISYSLGSGQGSVTPSQFTVDKHNGQICTTTSLDRDQGPANYDFTVTAVDGG----GLSSVAYVRVDLIDINDNQPAFYPVSYAVSLSTQSAPGTSVLKVTAHDPDAAENGRVTYRTVPEGSSPFFTLNKDTGVI----SLSRALHGKANSV-ITMVVSAQDGGGLTAPVNARVNISIVAGLVAPPVFEQAQYYFVVSEDALRGTQVGVVRASTKNGVLKDISYIISSGDPTGYFTVDSETGALRTSLPLDHEAQPSLNLEVQAHCGNPPAFGQ---TRVRITVSDVNDNAPVFLPSSSESLILPEDTRMGTVVYKVQAEDRDSGPNGLLSFDLFTSSAHRTFSIDRNSGHLRLIGSLSYETMPRYDLQV--IAK--DSGAPQLSSTFTLVIHVQAENGQGPVFDSLTYRVELKESTPLNTRFLQVRAVNRD--GGITTGLSS---TSASLAYHLHPDGDAAGFGIVSDSGWLFVKSALDREAKEMYLLTVLATSGNGQLKKTGSATVRVSVMDENDNTPRFTQERAFLAVRENLPAGTGFGRVS----ASDRDA------GLNGRLSYRLLHLDRHFQINSHTGEI--STKLSLDRELQSSYQLIVVAQDGGTPPRSATGTAFITVLDENDNAPSFSNAQTGRELLLQALEGQPSGFLLGTVHAKDPDEGENGTIFYSMSGPRA-ERFTLNPNTGELRSSSALSHSERPEYSFIILASDRGSPPQSSIIALKIQVLSSSKGSPNTNSQPLILKSVEGAKPGSMIGSVRSPDSQALPESGQVTFTVVGGTDFDGTFVVDRQTGDIYLARELDFEKCPRYTLQVEVDDFSMPLPKSDIITLIIDVQDSNDHSPEFPEDPIIIVVPENTDPGSSFYTFQAVDKDGSGPNSEVHYSILQQWPNIPDLLSLDPTTGALSLGMMLD--HEKTSSLLLVVQASDSALDVSQRRRGSVTARIFVTDVNDNEPVFI--SASVVSVMEDQPVGFVVVYVMAVDADQGENGRVTYRIQSGN-VRGKFSINPDTGSLSILRPIDREEEDLYNLTIVAEDHGLQQRSSSQLLSVQVIDVNDEAPYFQESQY 1648          

HSP 9 Score: 108.997 bits (271), Expect = 1.029e-22
Identity = 80/241 (33.20%), Postives = 122/241 (50.62%), Query Frame = 2
Query:  248 VIKVSGLIDREKQNLYSFLIISMNGDTKNVQ------IKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIV--SGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFL----DNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHH 934
            +I V  ++DRE+Q+ Y   +++ +  T  ++      I+++DVNDN P F+   + + IPE    GS V   T  D D+G N      I+   G     F++D       +  V   L Q LDYEI    ++ + A D G PPL ++ +VK+I+Q+ NDN P F    Y ASIKE+      F+ V ATD D G  G + Y L     + +PS   FTVD   G +    SLD ++  +++
Sbjct:  419 LICVDQILDREEQDHYELRVMATDSGTPPLRAESSFTIQVIDVNDNPPLFDQQEYTQVIPEVAFPGSFVVQVTARDKDQGPNGDVQYSILQNEGTHSDWFSVD------AVTGVVTTLTQ-LDYEIDPTPSITVVASDRGRPPLSSTAVVKVILQDINDNEPVFGSKFYNASIKENAPARTCFMEVTATDADGGSFGSISYSLGSGQGSVTPSQ--FTVDKHNGQICTTTSLDRDQGPANY 650          

HSP 10 Score: 102.449 bits (254), Expect = 1.108e-20
Identity = 88/307 (28.66%), Postives = 141/307 (45.93%), Query Frame = 2
Query:  128 IKENVPIGEVVGQI------ESPGFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTK---NVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQ---FNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVD-----------HKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTS 979
            + EN  IG ++ Q+        P  S    +    + KF I +  G + ++  +D E +  Y+  + S +   +   N+ I + DVNDN P F+   +E ++ E+ P GS V   T  D D G+N   + R+VS  ++ +F   Y D SNG  +++       + E  SQ     +VI+A D G PPL A   V++ V + NDN P F  + Y AS+ ED+    T L + A D D       F F   +    + F ++              G + L   LDFE + S++++I V D   P  +S
Sbjct: 2274 VPENTLIGTMITQVTGNDVDSGPALSYTLLLDSDTQGKFGIHRYGGGVSLTTPLDFEIKTWYTLTVSSSDSKQQSHANLTILVEDVNDNAPVFSQDLYEVTLAEHSPAGSSVITVTATDKDSGENGRITYRVVS--TKDMF---YIDPSNGTLFIK------KEVEFDSQRPSILVVIEASDSGTPPLTALSTVQVHVSDVNDNAPVFHQTEYRASVSEDEVPGSTILTLEAADGDLSRDNCGFDFAIASGNIGNTFQIESSVRFLEGHGFQTVGMLILADKLDFEIASSYNLTIVVSDRGIPQRSS 2569          

HSP 11 Score: 97.0561 bits (240), Expect = 4.286e-19
Identity = 76/289 (26.30%), Postives = 127/289 (43.94%), Query Frame = 2
Query:  149 GEVVGQIESPGFSPPFEMH-DFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGD-------TKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISR----YIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTS 979
            G +   + S   S  + +H D     F I   +G + V   +DRE + +Y   +++ +G+       +  V++ ++D NDN P+F       ++ EN P G+     +  D D G N   S R++  D  + F I+ H          +  K SLD E+ S + L++ A DGG PP  A+    I V + NDN P F  ++     +    E Q        V A D D G +G +FY +  + P ++ FT++  TG +    +L   +   +   I   D   P  +S
Sbjct: 1025 GGITTGLSSTSASLAYHLHPDGDAAGFGIVSDSGWLFVKSALDREAKEMYLLTVLATSGNGQLKKTGSATVRVSVMDENDNTPRFTQERAFLAVRENLPAGTGFGRVSASDRDAGLNGRLSYRLLHLD--RHFQINSHTG-------EISTKLSLDRELQSSYQLIVVAQDGGTPPRSATGTAFITVLDENDNAPSFSNAQTGRELLLQALEGQPSGFLLGTVHAKDPDEGENGTIFYSM--SGPRAERFTLNPNTGELRSSSALSHSERPEYSFIILASDRGSPPQSS 1302          

HSP 12 Score: 96.6709 bits (239), Expect = 6.518e-19
Identity = 79/253 (31.23%), Postives = 117/253 (46.25%), Query Frame = 2
Query:  194 FEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLI------ISMNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDG-GHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLD-NTSPSSDFFTVDHKTGNVYLRKSLDFEKSKS 928
             E H FQ        T G++ ++  +D E  + Y+  I      I     +  V I ++D NDN P F+   +   + E    G+++      DPD   N      I SGD  ++F +D    +     VRL  ++SLD E  S    VIQA DG GH  L     V + +++ N+N P F +    ASI+E+Q  N     + A D+D G  GEL YFL  N     D F V+  +G V  R + D+EK+ +
Sbjct: 2528 LEGHGFQ--------TVGMLILADKLDFEIASSYNLTIVVSDRGIPQRSSSVPVLINVMDTNDNPPSFSRAEYSAVVNEGAERGTEILQLFAIDPDSTPNGEVQYSISSGDDSELFTVDQWTGA-----VRL--RRSLDSEKQSSHMFVIQASDGQGHFALAP---VTVEIKDINNNRPYFPLKSLTASIRENQPQNALVTILHAIDHDKGAYGELRYFLTYNAGNGKDSFLVNQTSGEVRTRFTFDYEKTNT 2762          

HSP 13 Score: 94.3597 bits (233), Expect = 3.400e-18
Identity = 79/259 (30.50%), Postives = 123/259 (47.49%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKN------VQIKILDVNDNEPK----FNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFY-FLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            F+I   TGVI ++  +D E + ++  ++ + +  ++       V I++ D NDN+P     F + +    I E    G  V   +V DPD G+ +  +V +  G+ +  FA+   DS   I Y+ + + Q LD E    + L + A D G PPL+A     I V + NDN P FD   Y   I E        ++V A D D G +G++ Y  L N    SD+F+VD  TG V     LD+E   +  I++   D   P
Sbjct:  301 FVIDSRTGVITLNKPLDYEMRRVHELVVQARDNASQPEVTNSFVTIQVRDYNDNQPTMTIIFLSEDGSPRISEGAQPGQYVARISVTDPDYGEYANVNVSLEGGNGK--FALTTKDS---IIYL-ICVDQILDREEQDHYELRVMATDSGTPPLRAESSFTIQVIDVNDNPPLFDQQEYTQVIPEVAFPGSFVVQVTARDKDQGPNGDVQYSILQNEGTHSDWFSVDAVTGVVTTLTQLDYEIDPTPSITVVASDRGRP 553          

HSP 14 Score: 80.1073 bits (196), Expect = 6.344e-14
Identity = 74/299 (24.75%), Postives = 131/299 (43.81%), Query Frame = 2
Query:  122 FSIKENVPIGEVVGQIES----PGFSPPFEMHDFQ-EKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDT------KNVQIKILDVNDNEPKFNATNFEKSIP----ENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDA-GVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPF 970
             +++EN+P G   G++ +     G +          ++ F I+  TG I     +DRE Q+ Y  ++++ +G T          I +LD NDN P F+     + +     E  P G  +      DPDEG+N      + SG   + F ++ +          L    +L +    +++ +I A D G PP  + + +KI V +++   P  +    I    E  +       VR+ D+ A   SG++ + +   +     F VD +TG++YL + LDFEK   + + + V D S P 
Sbjct: 1116 LAVRENLPAGTGFGRVSASDRDAGLNGRLSYRLLHLDRHFQINSHTGEISTKLSLDRELQSSYQLIVVAQDGGTPPRSATGTAFITVLDENDNAPSFSNAQTGRELLLQALEGQPSGFLLGTVHAKDPDEGENGTIFYSM-SGPRAERFTLNPNTG-------ELRSSSALSHSERPEYSFIILASDRGSPPQSSIIALKIQVLSSSKGSPNTNSQPLILKSVEGAKPGSMIGSVRSPDSQALPESGQVTFTVVGGTDFDGTFVVDRQTGDIYLARELDFEKCPRYTLQVEVDDFSMPL 1406          

HSP 15 Score: 77.0258 bits (188), Expect = 5.116e-13
Identity = 76/298 (25.50%), Postives = 140/298 (46.98%), Query Frame = 2
Query:  113 LLIFSIK-ENVPIGEVVGQIESPGFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDT----KNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIV----SGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLR-----KSLDFEKSKSHHISIGVRDNSP 964
            L +F+I  ++ P GEV   I S   S          + F + + TG +++   +D EKQ+ + F+I + +G        V ++I D+N+N P F   +   SI EN P  + V +    D D+G  +   +R      +G+ +  F ++    ++G    R     + DYE  + FN +  A+D G+    A++ V++ V   ++  P F  S +   + E  +   +  +V A D D GV G + Y L N+SP   +F ++  TG + L+     + +   K ++  +++ V  +SP
Sbjct: 2607 LQLFAIDPDSTPNGEVQYSISSGDDS----------ELFTVDQWTGAVRLRRSLDSEKQSSHMFVIQASDGQGHFALAPVTVEIKDINNNRPYFPLKSLTASIRENQPQNALVTILHAIDHDKG--AYGELRYFLTYNAGNGKDSFLVN---QTSGEVRTRF----TFDYEKTNTFNFIAIAMDTGN--YTATVTVQVFVTGEDEYDPVFTESDFAFHVPEGAKKGQSIGQVNANDEDGGVDGIVLYTLANSSP---YFELNTSTGVISLKMDAYHRHVTRSKRETRQMTLDVIAHSP 2880          

HSP 16 Score: 73.1738 bits (178), Expect = 8.272e-12
Identity = 63/265 (23.77%), Postives = 112/265 (42.26%), Query Frame = 2
Query:  218 KKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKNVQ------IKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYH---DSSNGIFYV-----RLILKQSLDYEIISQFNLVIQAIDG-GHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            + F I + +G +++ G +  E    Y   +I+ +     +       I +   N   P F++  +   + E+ P+ ++       + D G        I +G S    ++ YH   D     F +      L +K +LD E    + L + A  G G      S  V++ V + NDN P+F   R   +++E+      F RV A+D DAG++G L Y L +       F ++  TG +  + SLD E   S+ + +  +D   P
Sbjct:  937 RTFSIDRNSGHLRLIGSLSYETMPRYDLQVIAKDSGAPQLSSTFTLVIHVQAENGQGPVFDSLTYRVELKESTPLNTRFLQVRAVNRDGG--------ITTGLSSTSASLAYHLHPDGDAAGFGIVSDSGWLFVKSALDREAKEMYLLTVLATSGNGQLKKTGSATVRVSVMDENDNTPRFTQERAFLAVRENLPAGTGFGRVSASDRDAGLNGRLSYRLLHL---DRHFQINSHTGEISTKLSLDRELQSSYQLIVVAQDGGTP 1190          

HSP 17 Score: 70.8626 bits (172), Expect = 4.000e-11
Identity = 65/256 (25.39%), Postives = 118/256 (46.09%), Query Frame = 2
Query:  218 KKFIISKTTGVIKVSGLIDREKQNLYSFLIISMN-GDTKNVQIKILDVNDNEPKFNATNFEK-----SIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            K F I+  TG I+ +  +    Q+    ++ +M+ G+     + ++ V   E  +    F +     S+ EN   G+ V       PD G  S  +  I SG+ ++ F+I +H    G  +V       LD+E   +  LV++A         A   V +++Q+ NDN+P+F +  Y+A ++E Q  +   ++V A D D G +G++ Y + ++S S   F +D  TG++     +D E     ++ I   D   P
Sbjct: 1999 KGFTINSLTGAIQATEKLQALTQSQRILIVEAMDQGNPSQSSLGVVIVYIREQSYQGVRFSRNTRDVSLQENAAKGTAVVQIHAQYPD-GSTSGINYSIFSGNKQQSFSISHH---TGEIWVED--STGLDFEETPRLRLVVKAETASSSSFMA---VNLLLQDVNDNLPRFQLHNYVAYVREAQGYDHPIIQVLANDLDQGQNGQVTYSIRSSSMSG-LFKIDPITGSISTAAIMDREIWTQTNLVIMATDRGSP 2244          

HSP 18 Score: 70.0922 bits (170), Expect = 7.500e-11
Identity = 78/294 (26.53%), Postives = 123/294 (41.84%), Query Frame = 2
Query:  125 SIKENVPIGEVVGQIESP---GFSPPFEMHDF---QEKKFIISKTTGVIKV--SGLIDREKQNLYSFLIISMNGDTKN---VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFH 973
            S++EN   G  V QI +    G +       F   +++ F IS  TG I V  S  +D E+      ++ +    + +   V + + DVNDN P+F   N+   + E       +      D D+G+N   +  I S     +F ID    S     +       +D EI +Q NLVI A D G P L  S  + +I+ + NDN P   + R +  + E+  I     +V   D D+G +      LD  S +   F +    G V L   LDFE    + +++   D+    H
Sbjct: 2066 SLQENAAKGTAVVQIHAQYPDGSTSGINYSIFSGNKQQSFSISHHTGEIWVEDSTGLDFEETPRLRLVVKAETASSSSFMAVNLLLQDVNDNLPRFQLHNYVAYVREAQGYDHPIIQVLANDLDQGQNGQVTYSIRSSSMSGLFKIDPITGSISTAAI-------MDREIWTQTNLVIMATDRGSPRLAGSATLTVIIVDLNDNSPTIPVPREV-RVPENTLIGTMITQVTGNDVDSGPALSYTLLLD--SDTQGKFGIHRYGGGVSLTTPLDFEIKTWYTLTVSSSDSKQQSH 2349          

HSP 19 Score: 59.3066 bits (142), Expect = 1.102e-7
Identity = 93/435 (21.38%), Postives = 188/435 (43.22%), Query Frame = 2
Query:   89 YQSQQNSNLLIFSIKENVPIGEVVGQI------ESPGFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTK------NVQIKILDVNDNEPKFNATNF-EKSIPENYP---IGSKVDLTTVFDPDEGKNSIQSVRIVSG-DSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKII-VQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDND-AGVSGELFYFLDNTSPS-SDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDAIS---TSFDLEILN-RSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKI 1321
            + + Q    L+    E  P G ++G +      E    +  + M   + ++F ++  TG ++ S  +   ++  YSF+I++ +  +        ++I++L  +   P  N+     KS+    P   IGS     +   P+ G+ +     +V G D +  F +D      G  Y    L + LD+E   ++ L ++  D   P  ++ ++  II VQ++ND+ P+F     I  + E+ +   +F   +A D D +G + E+ Y +    P+  D  ++D  TG + L   LD EK+ S  + +   D++      +   +   I + D   +  +  +  +  +  D     +V +V   D D       ++ ++  N R  F    I P    L ++  I   + +  NLT+ A D+     S++Q L++++
Sbjct: 1212 FSNAQTGRELLLQALEGQPSGFLLGTVHAKDPDEGENGTIFYSMSGPRAERFTLNPNTGELRSSSALSHSERPEYSFIILASDRGSPPQSSIIALKIQVLSSSKGSPNTNSQPLILKSVEGAKPGSMIGSVRSPDSQALPESGQVTFT---VVGGTDFDGTFVVDRQ---TGDIY----LARELDFEKCPRYTLQVEVDDFSMPLPKSDIITLIIDVQDSNDHSPEFPEDPIIIVVPENTDPGSSFYTFQAVDKDGSGPNSEVHYSILQQWPNIPDLLSLDPTTGALSLGMMLDHEKTSSLLLVVQASDSALDVSQRRRGSVTARIFVTDVNDNEPVFISASVVSVMEDQPVGFVVVYVMAVDADQGENGRVTYRIQSGNVRGKF---SINPDTGSLSILRPIDREEEDLYNLTIVAEDHGLQQRSSSQLLSVQV 1633          

HSP 20 Score: 53.1434 bits (126), Expect = 9.133e-6
Identity = 128/563 (22.74%), Postives = 226/563 (40.14%), Query Frame = 2
Query: 6044 IVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIID-----GVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDANG--------DVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFS---STAVIEIDVEDKNNHVP-----ILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDE---PQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDS--DKAIFYKI-DNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQ 7648
            +VP     ++ E    GT +G I       D +A    I      GV+ +L  + ESTG   +  A  +DRE  D+   +  V+  G  +    +V I V+D++D+ PVF + +    + E     T        D D    +   Y I   +  + FL++           D+  N  L+  T+S Y L+++A    SP    +  L V + +IND  P  +    +  +  N   G+ I ++ A D+D G +G+     +R+ ++   +  +   +G I L++ L       HE  +   D       + + + I V D N++ P      L E+G    +S   + G  +  +   D D  +   V   L   +  F L   D +   L  +D+    +E+ H Y L +  TD+   P  R  S F + V+        P L         IPE    GS + +   +D D   +  + Y I  N    S+   +D  +G +     L+Y I P   + V  +  G P   ++  + V ++  N    +  +K+   S++
Sbjct:   39 MVPGTLQLQLDEEQPAGTVVGDIS-AGLPPDMTASHYFISDHQGTGVSTDL-DIDESTG--IIKTARVLDREVRDRY-SFIAVTMTGITV----EVTILVNDINDHAPVFPRKRATFKIPEQTTIGTKFPLEPAVDADEDQLTTQGYIITDGNVGQAFLLETKRGSNKVLYLDLVVNAVLDRETRSSYTLLLEAFDGGSPKRTGQMILDVIVQDINDNAPVFNQSRYHAMISENLQPGNNILQVFASDADEGDNGLVLYDINRRQSDPDHYFVIDSRTGVITLNKPLDYEMRRVHELVVQARDNASQPEVTNSFVTIQVRDYNDNQPTMTIIFLSEDGSP-RISEGAQPGQYVARISVTDPDYGEYANVNVSLEGGNGKFALTTKD-SIIYLICVDQILDREEQDH-YELRVMATDSGT-PPLRAESSFTIQVIDVNDN---PPLFDQQEYTQVIPEVAFPGSFVVQVTARDKDQGPNGDVQYSILQNEGTHSDWFSVDAVTGVVTTLTQLDYEIDPTPSITVVASDRGRPPLSSTAVVKVILQDINDNEPVFGSKFYNASIK 585          
BLAST of Dachsous vs. Ensembl Zebrafish
Match: dchs1a (dachsous cadherin-related 1a [Source:ZFIN;Acc:ZDB-GENE-120410-3])

HSP 1 Score: 276.559 bits (706), Expect = 1.918e-73
Identity = 452/1914 (23.62%), Postives = 809/1914 (42.27%), Query Frame = 2
Query: 2957 NGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIV--SDNGPFKPLETEVEISVRIIDANNHSPILISTNVFY-IHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEK---LSKNTFVIRVK---SLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFC--PLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVKIR--IFVSDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVG-----DLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVI-VNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNI----RRLKNLEVVYSIKQP----EKYFVINPVTGQLVTFRMFDRETENQIQFYVEVI--ATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSS-DGIFMINGDSGEIHL---VSSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLTVVANDPDLGIFGRIIYSL-EGDTFDKKIFIDPSTGKLSCS-PLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPP--VNSEIFYVLNPGHSHIQI-NTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIP-NSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCT-TVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSA--KFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEPQ-EKGHPYFLG-IQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTE--ITIPESLKSGSKITKFVCKD--LDSDKAIFYKIDNFHPISNNLYLDFE---------------SGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESRIWNLTIMIVKAQKYQNSPSNLY-------ENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHD------IQYFLTPHE-NFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIVENPSENFGINNETGAIYIK 8464
            + +L+Y +    P G    F I   +G L + S+L+      +  + LL ++  S NG  K   +   + V ++D N+++P       F  + +    GT  G +           + +  L     Y+  ++++   ++ +T  I  K     E  +SY     ++++A D G+P +S+     I  ++ N N P     +  ++++        SG  + TV+A DPD+G N    YS  ++    ++  ++  TG + +  +LS ++  +    I  SD G P  +S +   ++ L   K      ++ L     + ++PG ++G     D    PE+   +  F     T  DG   +   +  + L ++    K   Y+L V  +  ++    S++   +I V       P F +D P  + + EN   GS   +F          N EV YSI Q          ++P TG L    M D E  + +   V+    A  VS  +  +V   I  + D NDNEP  +S  +S+V +         +  ++A DAD G N ++TY+I   +  G F IN D+G + +   +       Y L +   D G   +S S + S+  Q I    +  +   S           +G  +  +S S      N  + Y  I G     FS+ P+TG + T  ++ RE  G   +  + V  +       +    + + +   N+N P F R  + +++PE++      T+ A D D G  G + Y + +GD F     +D   G LS S  L+   +  Y L + A D +G+ +     T + I V +   ++  F ++ +S++V E++  G+++  ++        NS++ Y L+   S + I +  TG + T   L  E V      ++A     S  + + +SA + V I+D+NDN P    +P+ I +  +S    + L  + A D D  +N +  +  ++P      K + ++  +G +     + +  + +  L V   D G PS+ +  V+I     Q +Q V+         ++EN+  GT + QI    Y    ++   +SI  G   +   +   TG+I+V  +  +D E+  ++ L  +     S    +  V + + DV+DN P F  + +VA++ E Q    P+I++   D D G N QV Y I   S    F ID   G + T   ++    +  +LVI A+ + SP +     LTV IV++ND  P I +P R +++  N  +G+ IT++T  D D    +SY +     T     ++     G + L+  L       +   +   D++  S A + I VED N++ P+  ++   + L+     GS ++ + A DKD  +NG++T+ +VST   F +   D +   LF+  E + +   P  L  I+ +D+   P   L ++  + V +       P     H TE   ++ E    GS I      D  L  D   F    +F   S N+   F+                G L L   L++ I   + L +  +  G P++ +S  + + +   N  P          S  V E  ++   I  L  +D +S                     P+ ++  S I    + +LF    W   + + ++   +   S+++       +  +    + V  K I N R    +K LT  I EN+P    V  L    HD      ++YFLT +  N + +   +Q+SG  ++++   D+E    +    +   +  Y    + T+ V++ V   DEY P F    F  +V  G  K GQ +    A+D+D G  GIV Y +  N S  F +N  TG I +K
Sbjct: 1035 SASLAYHLH---PDGDAAGFGIVSDSGWLFVKSALD----REAKEMYLLTVLATSGNGQLKKTGSAT-VRVSVMDENDNTPRFTQERAFLAVRENLPAGTGFGRV--------SASDRDAGLNGRLSYRLLHLDRHFQINSHTGEISTKLSLDRELQSSY----QLIVVAQDGGTPPRSATGTAFITVLDENDNAPSFSNAQTGRELLLQALEGQPSGFLLGTVHAKDPDEGENGTIFYS--MSGPRAERFTLNPNTGELRSSSALSHSERPEYSFIILASDRGSPPQSSIIALKIQVLSSSKGSPNTNSQPLILKSVEGAKPGSMIGSVRSPDSQALPES--GQVTFTVVGGTDFDGTFVVDRQTGDIYLARELDFEKCPRYTLQVEVDDFSMPLPKSDIITLIIDVQDSNDHSPEFPED-PIIIVVPENTDPGSSFYTFQAVDKDGSGPNSEVHYSILQQWPNIPDLLSLDPTTGALSLGMMLDHEKTSSLLLVVQASDSALDVSQRRRGSVTARIF-VTDVNDNEPVFIS--ASVVSVMEDQPVGFVVVYVMAVDADQGENGRVTYRIQSGNVRGKFSINPDTGSLSILRPIDREEEDLYNLTIVAEDHGLQQRSSSQLLSV--QVIDVNDEAPYFQESQYEAFIAENQPAGSTVLVVSASDMDQGTNGIVTYGSIVGD---DFSIHPVTGVITTTKALDREAQG---VYALTVYARDGGSPPNFAKTTVRVTVLDENDNRPAFGRVYYSLEVPENQEPVTLFTIRATDQDSGDSGLVYYRITDGDHF-GDFHLDKKLGVLSTSRALDRESRAKYTLTVEAQD-QGIPSLTSTVT-LDISVLDLNDNSPVFPSSSYSVEVSEDASAGSLVLEVSASDKDEGSNSQVVYFLSRESSGMFIVDQHTGRIITAATLDREKVASYNFQVYAMDS--SATNPRNSSAEVAVHILDVNDNAPFFITDPLIINVSISSLSNHRVLATMRAEDKDFGANGSVFYRFANPV-----KGFTINSLTGAIQATEKLQALTQSQRILIVEAMDQGNPSQSSLGVVIVYIREQSYQGVRFSRNTRDVSLQENAAKGTAVVQIH-AQYPDGSTSGINYSIFSGNKQQSFSISHHTGEIWVEDSTGLDFEETPRLRLVVKAETASSS--SFMAVNLLLQDVNDNLPRFQLHNYVAYVREAQGYDHPIIQVLANDLDQGQNGQVTYSIRSSSMSGLFKIDPITGSISTAAIMDREIWTQTNLVIMATDRGSPRLAGSATLTVIIVDLNDNSPTIPVP-REVRVPENTLIGTMITQVTGNDVDSGPALSYTLLLDSDTQGKFGIHRY--GGGVSLTTPLDFEIKTWYTLTVSSSDSKQQSHANLTILVEDVNDNAPVFSQDLYEVTLAEHSPAGSSVITVTATDKDSGENGRITYRVVSTKDMFYI---DPSNGTLFIKKEVEFDSQRPSILVVIEASDSGTPP---LTALSTVQVHVSDVNDNAPVF---HQTEYRASVSEDEVPGSTILTLEAADGDLSRDNCGF----DFAIASGNIGNTFQIESSVRFLEGHGFQTVGMLILADKLDFEIASSYNLTIVVSDRGIPQRSSSVPVLINVMDTNDNPPSFSRA--EYSAVVNEGAERGTEILQLFAIDPDST--------------------PNGEVQYS-ISSGDDSELFTVDQWTGAVRLRRSLDSEKQSSHMFVIQASDGQGHFALAPVTVEIKDINNNRPYFPLKSLTASIRENQPQNALVTILHAIDHDKGAYGELRYFLTYNAGNGKDSFLVNQTSG-EVRTRFTFDYEKTNTFNFIAIAMDTGNY----TATVTVQVFVTGEDEYDPVFTESDFAFHVPEGAKK-GQSIGQVNANDEDGGVDGIVLYTLA-NSSPYFELNTSTGVISLK 2853          

HSP 2 Score: 190.66 bits (483), Expect = 2.348e-47
Identity = 350/1448 (24.17%), Postives = 627/1448 (43.30%), Query Frame = 2
Query: 2948 SFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRII--DANNHSPILISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCP--LLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSC-AQNV-KIRIFVSDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNL--NVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGS---HVASFNIRRLKNLEVVYSI-KQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIV-ATDADSGPNSKLTYQINPSSDGIFMINGDSGEIH-------LVSSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIG-QLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITN-FLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCSPLNFMEKNIY---NLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRI---NIVKPPVNSEIFYVLNPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSN--ITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVI-VSDNGVP--SKCTTVLIDIS-LNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVN--YCKDHSA-KFSIIDG-------VNHELVFLH----ESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYK-KVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHE----FDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGL 7123
            S PN  + Y +    P  + +   ++PTTG L +   + + +   S ++ L+V  SD+           ++ RI   D N++ P+ IS +V  + +    G  V  ++  D D GENG +   ++  +    F I   + +  ++R    E  + Y    N+ ++A D G   +SS   L +  I+ N   P      Q  Q   F      +GS +  V+A D D+G N I  Y   +     D  +I   TG+ITT  +L   AQ V  + ++  D G P   +     +  L E  +         +  +P++ +P   +  +    ++ G   L     T   D F     D +  +L             Y+L V    + + S++S + +++ V  +  + P+F   S   +E+ E+  +GS    V++ +     N +VVY + ++    F+++  TG+++T    DRE      F V  + +  +NP+  +   + V I D NDN P+ ++    I+ +S  +  N  +   + A D D G N  + Y+      G F IN  +G I        L  S R+    L V   D G  P   S+   I +   ++   +RF  N+  ++L    +K   ++     Y   S+SG   I Y + +G   Q FS+   TG +  + S     +   E  ++ +V+++   AS      + + +   N+N PRF    +   + E +   +  + V+AND D G  G++ YS+   +      IDP TG +S + +  M++ I+   NL I+ATD             VII   N    T+        ++V EN+  GT++ ++   ++   P  S    + +       I+   G +    PL  E+  +  LT+       S+ S Q + A + + + D+NDN P+ +++  ++ +   +     +  ++ATD D   N  ITY+         +   M+ +D  +G LF+K  +    +    L VI  SD+G P  +  +TV + +S +N +         +A   V E+ V G+ I  ++  +    +D+    F+I  G       +   + FL     ++ G + +A   K+D E      L   VS  G   R     V+I+V D +DN P FS+ ++ A +NEG    T +++L   DPD   N +V+Y I      E F +D   G V+    L+   +S +  VI+AS     F  A   +TV I +IN+ RP   + +    +  N+P  + +T + A D D G  G + Y + +     +  FL V   SGE+   R     D  K        I +D   +++T  +++ V  ++ + P+  E+    ++    K+G  I  ++A D+D   +G V + L ++SP+F L
Sbjct: 1458 SGPNSEVHYSILQQWP-NIPDLLSLDPTTGALSL--GMMLDHEKTSSLL-LVVQASDSALDVSQRRRGSVTARIFVTDVNDNEPVFISASVVSVMEDQPVGFVVVYVMAVDADQGENGRVTYRIQSGNVRGKFSINPDTGSLSILRPIDREEEDLY----NLTIVAEDHGLQQRSSSQLLSVQVIDVNDEAPYF----QESQYEAFIAENQPAGSTVLVVSASDMDQGTNGIVTYGSIVG----DDFSIHPVTGVITTTKALDREAQGVYALTVYARDGGSPPNFAKTTVRVTVLDENDNRPAFGRVYYSLEVPENQEP-VTLFTIRATDQDSGDSGLVYYRITDG-DHFGDFHLDKKLGVLSTSRALDRESRAKYTLTVEAQDQGIPSLTSTVTLDISVLDLNDNSPVFPSSS-YSVEVSEDASAGSLVLEVSASDKDEGSNSQVVYFLSRESSGMFIVDQHTGRIITAATLDREKVASYNFQVYAMDSSATNPRNSSA-EVAVHILDVNDNAPFFIT-DPLIINVSISSLSNHRVLATMRAEDKDFGANGSVFYRFANPVKG-FTINSLTGAIQATEKLQALTQSQRI----LIVEAMDQGN-PSQSSLGVVIVYIREQSYQGVRFSRNTRDVSLQENAAKGTAVVQIHAQYPDGSTSG---INYSIFSGNKQQSFSISHHTGEIWVEDSTG---LDFEETPRLRLVVKA-ETASSSSFMAVNLLLQDVNDNLPRFQLHNYVAYVREAQGYDHPIIQVLANDLDQGQNGQVTYSIRSSSMSGLFKIDPITGSISTAAI--MDREIWTQTNLVIMATDRGSPRLAGSATLTVIIVDLNDNSPTIPVPR---EVRVPENTLIGTMITQVTGNDVDSGPALSYTLLLDSDTQGKFGIHRYGGGVSLTTPLDFEIKTWYTLTVS------SSDSKQQSHANLTILVEDVNDNAPVFSQDLYEVTLAEHSPAGSSVITVTATDKDSGENGRITYRV-------VSTKDMFYIDPSNGTLFIKKEVEFDSQRPSILVVIEASDSGTPPLTALSTVQVHVSDVNDNAPVFHQTEYRA--SVSEDEVPGSTILTLEAADGDLSRDNCGFDFAIASGNIGNTFQIESSVRFLEGHGFQTVGMLILAD--KLDFEIASSYNLTIVVSDRGIPQRSSSVPVLINVMDTNDNPPSFSRAEYSAVVNEGAERGTEILQLFAIDPDSTPNGEVQYSISSGDDSELFTVDQWTGAVRLRRSLDSEKQSSHMFVIQASDGQGHFALAP--VTVEIKDINNNRPYFPLKSLTASIRENQPQNALVTILHAIDHDKGAYGELRYFLTYNAGNGKDSFL-VNQTSGEV---RTRFTFDYEKTNTFNFIAIAMDTGNYTATVTVQVFVTGEDEYDPVFTESDFAFHVPEGAKKGQSIGQVNANDEDGGVDGIVLYTLANSSPYFEL 2843          

HSP 3 Score: 180.259 bits (456), Expect = 2.990e-44
Identity = 396/1695 (23.36%), Postives = 691/1695 (40.77%), Query Frame = 2
Query: 2462 SNKTLMFQV-SAKAPKSQTSFAQVIIYIEDGIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSDEYQII------QSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTN---FTFEDLSSL-------GEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTN-VFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPL-NVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDN--EDQINIDSWTGLITTKVSLSCAQ---NVKIRIFVSDLGFPKMTSSVDTLL------KPLYEPKSEEFLINKN---------LTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVK-NVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHV----ASFNIRRLKNLEVVYSIKQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQI-NPSSDGIFMINGDSGEIHLVSS------PRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFII-------GQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDA-SIYDLQRIFINIDYGNENPPRFS--RSIFKVK--LPEDEAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCS-PLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFN----ATHFSLKVLENSPGGTVLGRINIVKPP--VNSEIFYVLN-PGHSHIQINTTTGELRTNGPL-HLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAEN--PVKIFIPNSNQPQKPLTKLSATDSD---KTSNITY------QFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVP---SKCTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSA-----KFSIIDGVNH--ELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEI----RGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDA----RFSSTAVIEIDVEDKNNHVPILKENGRV-INLSSSLKRGSKILY-LHAIDKDLRDNGKVTFELVSTSPWFG-------------LRGFDNNTAALF-LIDEPQEKGHP 7189
            S+ TL+ +     +PK        +I  +   + P F+ S     I EN   G  I+QVF       D   ++      QS    +  I S+TG I LNK  D E      + VQ ++   +A+     N       + Y  N  T    F  ED S         G+    +  +D D     N++  ++     G N  F +      + +I    I +        L V+ +D+G   PL  E   ++++ID N++ P+         I + A  G+ V  +  +D+D G NG+++ S+ Q    +  + +  S +     V +L  ++   +P  ++ ++A+DRG P  SS   + +   + N N P       +  +    P  +      V A D D G     +YS+     +    Q  +D   G I T  SL   Q   N    +   D G     + V   L      +P + P S    ++           +T   PD ++ G V       PE  G+   F  N  T V             I L   L+ K N   ++ V        +   N  +N+ +     + P+F +    F+ + E+   G+ V    AS     LK++  + S   P  YF ++  TG L T    D E +  +   V+    H  NP  F    + + ++D NDN P  L  SS  + +   T     ++++ A D DSGPN  L++ +   S+   F I+ +SG + L+ S      PR   Y+L V  +DSG    S +    IH Q+   +  +                 + F+        G ++   +S+S +L   Y+L     A  F +   +G +  + ++ RE     E+  + V+  S +          + +++   N+N PRF+  R+   V+  LP   A T F  V A+D D G+ GR+ Y L     D+   I+  TG++S    L+   ++ Y L ++A D  G +  R       I V +   +  +F+         L+ LE  P G +LG ++   P    N  IFY ++ P      +N  TGELR++  L H E  E+      +F    S R     S+II ++I  ++ ++  P  N  P+ +      +P   +  + + DS    ++  +T+       FD +          +++D ++G+++L   +      R+ L+V V D  +P   S   T++ID+  + DH   +   +  I  V EN+  G+     + V+  KD S       +SI+    +  +L+ L  +TG +  +    +D EK   ++L  Q S    ++    RG     I V DV+DN+PVF     V+ + E QP    V+ +   D D G N +V Y I+  + + +F I+ + G +    P++   + +Y+L I A         +   L+V ++++ND+ P          +  N+P GS +  ++A D D G +GI   + +  +      ++    +G I  ++ L     G +   +   D      F+ T V  + V D+N++ P     GRV  +L     +    L+ + A D+D  D+G V +  ++    FG              R  D  + A + L  E Q++G P
Sbjct:  215 SSYTLLLEAFDGGSPKRTGQMILDVIVQDINDNAPVFNQSRYHAMISENLQPGNNILQVFASDADEGDNGLVLYDINRRQSDPDHYFVIDSRTGVITLNKPLDYEMRRVHELVVQARD---NASQPEVTNSFVTIQVRDYNDNQPTMTIIFLSEDGSPRISEGAQPGQYVARISVTDPDYGEYANVNVSLE-----GGNGKFALTTKDSIIYLICVDQILDREEQDHYELRVMATDSG-TPPLRAESSFTIQVIDVNDNPPLFDQQEYTQVIPEVAFPGSFVVQVTARDKDQGPNGDVQYSILQ---NEGTHSDWFSVDAVTGVVTTLTQLDYEIDPTPSITVVASDRGRPPLSSTAVVKVILQDINDNEPVFGSKFYNASIKENAPARTC--FMEVTATDADGGSFGSISYSLGSGQGSVTPSQFTVDKHNGQICTTTSLDRDQGPANYDFTVTAVDGGGLSSVAYVRVDLIDINDNQPAFYPVSYAVSLSTQSAPGTSVLKVTAHDPDAAENGRVT--YRTVPE--GSSPFFTLNKDTGV-------------ISLSRALHGKANSVITMVVSAQDGGGLTAPVNARVNISIVAGLVAPPVFEQAQYYFV-VSEDALRGTQVGVVRASTKNGVLKDISYIISSGDPTGYFTVDSETGALRTSLPLDHEAQPSLNLEVQA---HCGNPPAFGQTRVRITVSDVNDNAPVFLPSSSESLILPEDTRMGTVVYKVQAEDRDSGPNGLLSFDLFTSSAHRTFSIDRNSGHLRLIGSLSYETMPR---YDLQVIAKDSGAPQLSSTFTLVIHVQAENGQGPVFDSLTYRVELKESTPLNTRFLQVRAVNRDGGITTGLSSTSASL--AYHLHPDGDAAGFGIVSDSGWLFVKSALDREA---KEMYLLTVLATSGNGQLKKTGSATVRVSVMDENDNTPRFTQERAFLAVRENLP---AGTGFGRVSASDRDAGLNGRLSYRLL--HLDRHFQINSHTGEISTKLSLDRELQSSYQLIVVAQD--GGTPPRSATGTAFITVLDENDNAPSFSNAQTGRELLLQALEGQPSGFLLGTVHAKDPDEGENGTIFYSMSGPRAERFTLNPNTGELRSSSALSHSERPEY------SFIILASDRGSPPQSSIIALKIQVLSSSKGSPNTNSQPLILKSVEGAKPGSMIGSVRSPDSQALPESGQVTFTVVGGTDFDGT----------FVVDRQTGDIYLARELDFEKCPRYTLQVEVDDFSMPLPKSDIITLIIDVQDSNDHS-PEFPEDPIIIVVPENTDPGSSFYTFQAVD--KDGSGPNSEVHYSILQQWPNIPDLLSLDPTTGAL--SLGMMLDHEKTSSLLLVVQASDSALDVSQRRRGSVTARIFVTDVNDNEPVFISASVVSVM-EDQPVGFVVVYVMAVDADQGENGRVTYRIQSGNVRGKFSINPDTGSLSILRPIDREEEDLYNLTIVAEDHGLQQRSSSQLLSVQVIDVNDEAPYFQESQYEAFIAENQPAGSTVLVVSASDMDQGTNGI---VTYGSIVGDDFSIHPV--TGVITTTKALDREAQGVYALTVYARDGGSPPNFAKTTV-RVTVLDENDNRPAF---GRVYYSLEVPENQEPVTLFTIRATDQDSGDSGLVYYR-ITDGDHFGDFHLDKKLGVLSTSRALDRESRAKYTLTVEAQDQGIP 1827          

HSP 4 Score: 174.866 bits (442), Expect = 1.241e-42
Identity = 498/2298 (21.67%), Postives = 910/2298 (39.60%), Query Frame = 2
Query:  221 KFIISKTTGVIKVSGLIDREKQNL-YSFLIISMNG----DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGH--PPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP-FHTSKXXXXXXXXXXXXXXXSIQILWTGGLSE---INRDISPNTIVAHVKLTDYDAIST---SFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEI-DSTILNEN-QHVTFVK-----TTKRLPTKPIFIFKIFVLNNL--FKINETTGEILSKRSIDC-GKYFFNVSMLSLKTNSLIDQT-----KLEIVVKSGRKLPLYFDRGFRKILVTTGKSQCFSEIAVRNRHCGMRIQYSYDLLLKTDGILRINEH-GALCTAENVKHNKLMSTRYLYQIKALD------ETNSSAVCVVLFAIQPSKVFDVLPTEINITLPIIDSPKFNFSLPIGKIIGTF-SKLPPAQFIGFIQYHLVPEELSTGAITVDSQSGEILMKKFPIHKNPIR---LIVKSVIRKPFNVSPLNIVAINFQKLFFARS-----LYQFILTKSEIKGNLVKIGQV-SMDSSC---TESVSYDLFGVKNDHSHFTIDVATGVIYGK---DLGSISNKTLMFQVSA-KAPKSQTSFAQVIIYIEDG-IHQPGFDFSDLLVNIWENTTVGIEI--MQVFPK---YPSVSDEYQIIQS--QYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLI--------GSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNV-FYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPP-------EIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVKIRIFVS--DLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNV-VFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLKNL----EVVYSIKQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQI-NPSSDGIFMINGDSGEIHLVSSPRVSAYE---LNVTVRDSGEVPKSVS-VVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLT-VVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLS-CSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPV--NSEIFYVLNPGHSHIQINTTTGELRTNGPLHLE-----LVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSD-KTSNITYQFDRSDP----TTQTLYKMYLLDGKS----GNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTT--VLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMV--NYCKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYS--SQEEFLID-ANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGP-DGI 6769
            +F + K  G I  +  +DR++    Y F + +++G        V++ ++D+NDN+P F   ++  S+      G+ V   T  DPD  +N   + R V   S   F +   +   G+    + L ++L  +  S   +V+ A DGG    P+ A + + I+        P F+ ++Y   + ED         VRA+  + GV  ++ Y + +  P+  +FTVD +TG +     LD E   S ++ +     +PP F  ++V + +  ++ N        ++    SE   +  D    T+V  V+  D D+      SFDL     S  +   I      L+LI  +        +L + A D   P LS+T  L I +         F    ++VE+ +ST LN     V  V      TT    T     + +    +   F I   +G +  K ++D   K  + +++L+   N  + +T     ++ ++ ++        +R F  +         F  ++  +R  G+  + SY  LL  D   +IN H G + T   +  ++ + + Y   + A D          +A   VL     +  F    T   + L  ++        P G ++GT  +K P     G I Y +          T++  +GE+       H        +I+ S    P   S   I+A+  Q L  ++          IL   E       IG V S DS     +  V++ + G  +    F +D  TG IY     D       TL  +V     P  ++    +II ++D   H P F    +++ + ENT  G      Q   K    P+    Y I+Q      D LS+   TG + L    D E+ S L++ VQ  +          GS T    + + D+NDN+P   ++      ED   +G +   +   DAD   NG ++YR   I+   +   F INP TG L I+  ++    +   + NL ++  D+G  +   +   +SV++ID N+ +P    +    +I +    G+   T+L+      + G   I          F I  ++      +    E    Y     + + A D GSP   +   + +  ++ N N P        + +P+  + +           +FT+ A D D G + +  Y I    D+    ++D   G+++T  +L      K  + V   D G P +TS+V   +  L    +     + + +  + + +  G +V +++   ++ G+    +   +    G   +   + ++I        K   Y+  V   +       +S+  + V +  V  + P F  D P  + +  +  S   V +      K+      V Y    P K F IN +TG +         T++Q    VE  A    NP   ++  +IV I  E   +    S ++  V +     +  ++ QI A   D G  S + Y I + +    F I+  +GEI +  S  +   E   L + V+   E   S S +  ++  Q +   +  RF  ++    +   Q     II Q+  +      N  + Y + +   + +F +DPITGS+ T   + RE    + +V +     S   A    L  I +++   N+N P       +V++PE+  I   +T V  ND D G        L+ DT   K  I    G +S  +PL+F  K  Y L + ++DS+     ++    + I V++   +   F+   + + + E+SP G+ +  +         N  I Y +        I+ + G L     +  +     ++  IE +        +  ++Q         + D+NDN P+  +   +  +     P   +  L A D D    N  + F  +      T Q    +  L+G      G L L   +   +   + L ++VSD G+P + ++  VLI++    D+       E +   V E +  GT I Q+  +  +   +   ++SI  G + EL  + + TG + +  +  +D EK    +   Q S G         V + + D+++N+P F      A + E QP    V  L   D D G   ++ YF+ + +   ++ FL++  +G+V+T    ++   + ++ +  A    +    A   + V++   ++  P  +  +    +      G  I ++ A D DG  DGI
Sbjct:  625 QFTVDKHNGQICTTTSLDRDQGPANYDFTVTAVDGGGLSSVAYVRVDLIDINDNQPAFYPVSYAVSLSTQSAPGTSVLKVTAHDPDAAENGRVTYRTVPEGSSPFFTL---NKDTGV----ISLSRALHGKANSVITMVVSAQDGGGLTAPVNARVNISIVAGLVAP--PVFEQAQYYFVVSEDALRGTQVGVVRASTKN-GVLKDISYIISSGDPTG-YFTVDSETGALRTSLPLDHEAQPSLNLEVQAHCGNPPAFGQTRVRITVSDVNDNAP------VFLPSSSESLILPEDTRMGTVVYKVQAEDRDSGPNGLLSFDL--FTSSAHRTFSIDRNSGHLRLIGSLSYETMPRYDLQVIAKDSGAPQLSSTFTLVIHVQAENGQGPVFDSLTYRVELKESTPLNTRFLQVRAVNRDGGITTGLSSTSASLAYHLHPDGDAAGFGIVSDSGWLFVKSALDREAKEMYLLTVLATSGNGQLKKTGSATVRVSVMDENDNTPRFTQERAFLAVRENLPAGTGFGRVSASDRDAGLNGRLSY-RLLHLDRHFQINSHTGEIST--KLSLDRELQSSYQLIVVAQDGGTPPRSATGTAFITVLDENDNAPSFSNAQTGRELLLQALE------GQPSGFLLGTVHAKDPDEGENGTIFYSMSGPRAER--FTLNPNTGELRSSSALSHSERPEYSFIILASDRGSPPQSS---IIALKIQVLSSSKGSPNTNSQPLILKSVEGAKPGSMIGSVRSPDSQALPESGQVTFTVVGGTDFDGTFVVDRQTGDIYLARELDFEKCPRYTLQVEVDDFSMPLPKSDIITLIIDVQDSNDHSPEFPEDPIIIVVPENTDPGSSFYTFQAVDKDGSGPNSEVHYSILQQWPNIPDLLSLDPTTGALSLGMMLDHEKTSSLLLVVQASDSALDVSQRRRGSVT--ARIFVTDVNDNEPVFISASVVSVMED-QPVGFVVVYVMAVDADQGENGRVTYR---IQSGNVRGKFSINPDTGSLSILRPIDREEED---LYNLTIVAEDHG-LQQRSSSQLLSVQVIDVNDEAPYFQESQYEAFIAENQPAGS---TVLVVSASDMDQGTNGIVTYGSIVGDDFSIHPVTGVITTTKALDREAQGVYA----LTVYARDGGSPPNFAKTTVRVTVLDENDNRPAFGRVYYSLEVPENQEPVT----------LFTIRATDQDSGDSGLVYYRITDG-DHFGDFHLDKKLGVLSTSRALDRESRAKYTLTVEAQDQGIPSLTSTVTLDISVLDLNDNSPVFPSSSYSVEVSEDASAGSLVLEVSASDKDEGSNSQVVYFLSRESSGMFIVDQHTGRIITAATLDREKVASYNFQVYAMDSSATNPRNSSAEVAVHILDVNDNAPFFITD-PLIINVSISSLSNHRVLATMRAEDKDFGANGSVFYRFANPVKGFTINSLTGAIQATEKLQALTQSQRILIVE--AMDQGNPSQSSLGVVIVYIR-EQSYQGVRFSRNTRDVSLQENAAKGTAVVQIHAQYPD-GSTSGINYSIFSGNKQQSFSISHHTGEIWVEDSTGLDFEETPRLRLVVK--AETASSSSFMAVNLLLQDVN-DNLPRFQLHNYVAYVREAQGYDHPII-QVLANDLDQGQNGQVTYSIRSSSMSGLFKIDPITGSISTAAIMDREIWTQTNLVIMATDRGSPRLAGSATLTVIIVDL---NDNSPTIPVP-REVRVPENTLIGTMITQVTGNDVDSGPALSYTLLLDSDT-QGKFGIHRYGGGVSLTTPLDFEIKTWYTLTVSSSDSK-----QQSHANLTILVEDVNDNAPVFSQDLYEVTLAEHSPAGSSVITVTATDKDSGENGRITYRVVSTKDMFYIDPSNGTLFIKKEVEFDSQRPSILVVIEASDSGTPPLTALSTVQV-------HVSDVNDNAPVFHQTEYRASVSEDEVPGSTILTLEAADGDLSRDNCGFDFAIASGNIGNTFQIESSVRFLEGHGFQTVGMLILADKLDFEIASSYNLTIVVSDRGIPQRSSSVPVLINVMDTNDNPPSFSRAEYSAV-VNEGAERGTEILQLFAIDPDSTPNGEVQYSISSGDDSELFTVDQWTGAVRLRRS--LDSEKQSSHMFVIQASDGQGHF-ALAPVTVEIKDINNNRPYFPLKSLTASIRENQPQNALVTILHAIDHDKGAYGELRYFLTYNAGNGKDSFLVNQTSGEVRTRFTFDYEKTNTFNFIAIAMDTGN--YTATVTVQVFVTGEDEYDPVFTESDFAFHVPEGAKKGQSIGQVNANDEDGGVDGI 2829          

HSP 5 Score: 165.622 bits (418), Expect = 8.626e-40
Identity = 112/348 (32.18%), Postives = 173/348 (49.71%), Query Frame = 2
Query:  116 LIFSIKENVPIGEVVGQIESPGFSPPFE-----MHDFQ----EKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSD-FFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNS--PPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYD 1123
            L   + E  P G VVG I S G  P        + D Q         I ++TG+IK + ++DRE ++ YSF+ ++M G T  V I + D+ND+ P F        IPE   IG+K  L    D DE + + Q   I  G+  + F ++    SN + Y+ L++   LD E  S + L+++A DGG P     +++ +IVQ+ NDN P F+ SRY A I E+ +     L+V A+D D G +G + Y ++      D +F +D +TG + L K LD+E  + H + +  RDN+  P    S V + +   + N    +I  L   G   I+    P   VA + +TD D
Sbjct:   44 LQLQLDEEQPAGTVVGDI-SAGLPPDMTASHYFISDHQGTGVSTDLDIDESTGIIKTARVLDREVRDRYSFIAVTMTGITVEVTILVNDINDHAPVFPRKRATFKIPEQTTIGTKFPLEPAVDADEDQLTTQGYIITDGNVGQAFLLETKRGSNKVLYLDLVVNAVLDRETRSSYTLLLEAFDGGSPKRTGQMILDVIVQDINDNAPVFNQSRYHAMISENLQPGNNILQVFASDADEGDNGLVLYDINRRQSDPDHYFVIDSRTGVITLNKPLDYEMRRVHELVVQARDNASQPEVTNSFVTIQVRDYNDNQPTMTIIFLSEDGSPRISEGAQPGQYVARISVTDPD 390          

HSP 6 Score: 159.458 bits (402), Expect = 6.599e-38
Identity = 333/1442 (23.09%), Postives = 587/1442 (40.71%), Query Frame = 2
Query: 4322 RMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSP--SSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQI---NPSSDGIFMINGDSGEIHLVSSPRVSAYELN------VTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFA---QIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAI-TNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCS-PLNFMEKNIYNLKIIATDSEGLST---GRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINI-VKPPVNSEIFYVLNPGH--SHIQINTTTGELRTNGPLHLELVEFIELTIHAFA----KFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFRV--KENSVDGTFIGQIKMVNYCKDHSAKFSII----------DGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIR--GYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKIS--IPNRNLKLDT--NRPVGSFITKITAKDSD-GPDG-ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARF---SSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAID-KDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEPQ-EKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDS---DKAIFYKIDNFHP-ISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTC---AIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQ-KPA--IISNLLQMDKN---SFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESRIWNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHD------IQYFLTPHENFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNV-EGGIPKLGQILFTAYASDKDRGRFGIVSYQIVENPSENFG 8431
            ++ DRE   Q  + + V+AT    P +       +++ D NDN P       +  I  ++ P    + + Q+ A D D GPN  + Y I     +    F ++  +G   +V++     YE++      V   D G  P S + V  +  Q I     +       +       +++ F+    + +   S G+  I Y L +G+ +     F+VD   G + T  S+ R++            + ++    +  +  + +++   N+N P F    + V L    A  T+ L V A+DPD    GR+ Y    +       ++  TG +S S  L+    ++  + + A D  GL+     R + + V   V         F    +   V E++  GT +G +    K  V  +I Y+++ G    +  +++ TG LRT+ PL  E    + L + A       F  TR   T S + D   + +    P  +E+   + +P   +    + K+ A D D   N    FD     T + ++ + +D  SG+L L  S+      R+ L+VI  D+G P   +T  + I +  ++    +  +   +RV  KE++   T   Q++ VN     +   S            DG       + +S G +FV +A  +DRE  +  +L    + G  +++  G   V + V D +DN P F+Q +    + E  P  T   R++  D D G N ++ Y          F I+++ G++ T + L+   +S Y L++ A    +P   A     + +++ ND  P  S     R L L     +P G  +  + AKD D G +G I Y +   +    TL  N    +GE+  S  L  S+  ++ F I+  D      SS   ++I V   +   P       ++      K GS I  + + D + L ++G+VTF +V  + + G    D  T  ++L  E   EK   Y L +++ D ++   K    I  L + ++    + P         I +PE+   GS    F   D D    +  + Y I    P I + L LD  +G L L   L++      LL+V     A+  S  +  S    + +   N      DN+ + +S  V  +++ +P   ++  ++ +D +   + R +Y +      Q  N+    S   D+ ++      D  E  ++NLTI+       Q S S L     + VN E P           +  +    I EN+P  +TVL +     D      + Y     ++F +       +G  I +   LD E    Y L +  +           T  V ++VLD ++  P F    ++  V E   P     LFT  A+D+D G  G+V Y+I +   ++FG
Sbjct:  424 QILDRE--EQDHYELRVMATDSGTPPLRAESSFTIQVIDVNDNPPLFDQQEYTQVIPEVAFP---GSFVVQVTARDKDQGPNGDVQYSILQNEGTHSDWFSVDAVTG---VVTTLTQLDYEIDPTPSITVVASDRGRPPLSSTAVVKVILQDINDNEPVFGSKFYNASIKENAPARTCFMEVTATDADGGSFGS--ISYSLGSGQGSVTPSQFTVDKHNGQICTTTSLDRDQ----GPANYDFTVTAVDGGGLSSVAYVRVDLIDINDNQPAFYPVSYAVSLSTQSAPGTSVLKVTAHDPDAAENGRVTYRTVPEGSSPFFTLNKDTGVISLSRALHGKANSVITMVVSAQDGGGLTAPVNARVNISIVAGLVAPP-----VFEQAQYYFVVSEDALRGTQVGVVRASTKNGVLKDISYIISSGDPTGYFTVDSETGALRTSLPLDHEAQPSLNLEVQAHCGNPPAFGQTRVRITVSDVNDNAPVFL----PSSSES---LILPEDTRMGTVVYKVQAEDRDSGPNGLLSFDL---FTSSAHRTFSIDRNSGHLRLIGSLSYETMPRYDLQVIAKDSGAPQLSSTFTLVIHVQAENGQGPVF-DSLTYRVELKESTPLNTRFLQVRAVNRDGGITTGLSSTSASLAYHLHPDGDAAGFGIVSDS-GWLFVKSA--LDREAKEMYLLTVLATSGNGQLKKTGSATVRVSVMDENDNTPRFTQERAFLAVRENLPAGTGFGRVSASDRDAGLNGRLSY--RLLHLDRHFQINSHTGEISTKLSLDRELQSSYQLIVVAQDGGTPPRSATGTAFITVLDENDNAPSFSNAQTGRELLLQALEGQPSGFLLGTVHAKDPDEGENGTIFYSMSGPRAERFTLNPN----TGELRSSSALSHSERPEYSFIILASDRGSPPQSSIIALKIQVLSSSKGSPNTNSQPLILKSVEGAKPGSMIGSVRSPDSQALPESGQVTFTVVGGTDFDGTFVVDRQTGDIYLARELDFEKCPRYTLQVEVDDFSMPLPKS--DIITLIIDVQDSNDHSPEFP-EDPIIIVVPENTDPGSSFYTFQAVDKDGSGPNSEVHYSILQQWPNIPDLLSLDPTTGALSLGMMLDHEKTSSLLLVVQASDSALDVSQRRRGSVTARIFVTDVN------DNEPVFISASVVSVMEDQPVGFVVVYVMAVDADQGENGRVTYRI------QSGNVRGKFSINPDTGSLSILRPIDREEEDLYNLTIVAEDHGLQQRSSSQLLSVQVIDVNDEAP---------YFQESQYEAFIAENQPAGSTVLVVSASDMDQGTNGIVTYGSIVGDDFSI----HPVTGV-ITTTKALDREAQGVYALTVYARDGGSPPNFAKTT--VRVTVLDENDNRPAFGRVYYSLEVPENQEPV---TLFTIRATDQDSGDSGLVYYRITDG--DHFG 1790          

HSP 7 Score: 151.369 bits (381), Expect = 1.884e-35
Identity = 336/1504 (22.34%), Postives = 627/1504 (41.69%), Query Frame = 2
Query: 4172 FLEIKENLPSGSHVASFNIR---RLKNLEVVYSIKQPE-KYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNS-KLTYQINPSSD--GIFMINGDSGEIHLVSS---PRVSAYELNVTVRD-SGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAG--KFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYD----LQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLT-VVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLS-CSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINI--VKPPVNSEIFYVLNPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSN--ITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFRVKE-NSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHE---LVFLHESTGKIFVAAAAKIDREKIDK--IILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIR-LTVYDPDIGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGP-DGISYRIRHRKLTNQTLFLNVAFDSGEIFL--SRKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAAL---FLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLL-----KYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKAIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKEN-KGPNLIDNKY-ITLSLQVPEMIQKPAIISNLLQMDKNS---FRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDL-FESRIWNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHDIQY------FLTPHEN----FELTCSQSQSSGCNIKSKSV------LDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIVE-NPSENFGINNETGAIYIKNQFIIEKK 8488
             L+  E  PSG  + + + +     +N  + YS+  P  + F +NP TG+L +          +  F +  +A+   +P   +++ L +++   +   P   S    I++        + I  + + D+ + P S ++T+ +   +D  G F+++  +G+I+L       +   Y L V V D S  +PKS  +   I  Q     S        + +        S F   Q +  +  S  N ++ Y ++        + S+DP TG++     +  E+   S ++ +     S  D S         RIF+  D  +  P   S S+  V   ED+ +   +  V+A D D G  GR+ Y ++      K  I+P TG LS   P++  E+++YNL I+A D  GL   R     + + V +       F  + +   + EN P G+ +  ++   +    N  + Y    G     I+  TG + T   L  E      LT++A          +TT   + V ++D NDN+P        + +P + +P    T + ATD D   +  + Y+    D      +  + LD K G L    ++    + ++ L V   D G+PS  +TV +DIS+   +    + P  +       ++  G+ + ++   +  KD  +   ++  ++ E   +  + + TG+I  AA   +DREK+      ++   S   +      +V +H+ DV+DN P F  +  +  ++        V+  +   D D G N  V  F  F +  + F I++  G ++    L   T+S   L+++A  + +P   +   + VYI   + Q  + S   R++ L  N   G+ + +I A+  DG   GI+Y I      N+    +++  +GEI++  S  L   +  +    +  + A  SS   + + ++D N+++P  + +  V  +  +      I+ + A D D   NG+VT+ + S+S   GL   D  T ++    ++D  +E      L I  TD       RL     LTV++       P    PR       E+ +PE+   G+ IT+    D+DS  A+ Y +           +    G + LT  L++ I+  + L V+ +     ++ +  NL++ +E  N   P    + Y +TL+   P      + +  +   DK+S    R +Y ++S              F ID SN   +I  ++ F+S+  ++ +++++A      P            ++V    + +             ++E+E P +T+L L     D+        F     N    F++  S     G   ++  +      LDFE   +Y L +++       RS S  + V I+V+D ++  P F    ++  V  G  +  +IL   +A D D    G V Y I   + SE F ++  TGA+ ++     EK+
Sbjct: 1222 LLQALEGQPSGFLLGTVHAKDPDEGENGTIFYSMSGPRAERFTLNPNTGELRSSSALSHSERPEYSFII--LASDRGSPPQSSIIALKIQVLSSSKGSPNTNS-QPLILKSVEGAKPGSMIGSVRSPDSQALPESGQVTFTVVGGTDFDGTFVVDRQTGDIYLARELDFEKCPRYTLQVEVDDFSMPLPKSDIITLIIDVQDSNDHSPEFPEDPIIIVVPENTDPGSSFYTFQ-AVDKDGSGPNSEVHYSILQQWPNIPDLLSLDPTTGALSLGMMLDHEK--TSSLLLVVQASDSALDVSQRRRGSVTARIFVT-DVNDNEPVFISASVVSVM--EDQPVGFVVVYVMAVDADQGENGRVTYRIQSGNVRGKFSINPDTGSLSILRPIDREEEDLYNLTIVAED-HGLQQ-RSSSQLLSVQVIDVNDEAPYFQESQYEAFIAENQPAGSTVLVVSASDMDQGTNGIVTYGSIVGDD-FSIHPVTGVITTTKALDREAQGVYALTVYARDGGSPPNFAKTT---VRVTVLDENDNRPAFGRVYYSLEVPENQEPVTLFT-IRATDQDSGDSGLVYYRITDGD-----HFGDFHLDKKLGVLSTSRALDRESRAKYTLTVEAQDQGIPSLTSTVTLDISVLDLNDNSPVFPSSSYSVEVSEDASAGSLVLEVSASD--KDEGSNSQVVYFLSRESSGMFIVDQHTGRIITAAT--LDREKVASYNFQVYAMDSSATNPRNSSAEVAVHILDVNDNAPFFITDPLIINVSISSLSNHRVLATMRAEDKDFGANGSV--FYRFANPVKGFTINSLTGAIQATEKLQALTQSQRILIVEAMDQGNPSQSSLGVVIVYIREQSYQGVRFSRNTRDVSLQENAAKGTAVVQIHAQYPDGSTSGINYSIFS---GNKQQSFSISHHTGEIWVEDSTGLDFEETPRLRLVVKAETASSSSFMAVNLLLQDVNDNLPRFQLHNYVAYVREAQGYDHPIIQVLANDLDQGQNGQVTYSIRSSS-MSGLFKIDPITGSISTAAIMD--REIWTQTNLVIMATDRG---SPRLAGSATLTVIIVDLNDNSPTIPVPR-------EVRVPENTLIGTMITQVTGNDVDSGPALSYTLLLDSDTQGKFGIHRYGGGVSLTTPLDFEIKTWYTLTVSSS---DSKQQSHANLTILVEDVNDNAPVFSQDLYEVTLAEHSP----AGSSVITVTATDKDSGENGRITYRVVSTK----------DMFYIDPSNGTLFIKKEVEFDSQRPSI-LVVIEASDSGTPPLT------ALSTVQVHVSDVNDNAPVFHQTEYRASVSEDEVPGSTILTLEAADGDLSRDNCGFDFAIASGNIGNTFQIESSVRFLEGHGFQTVGMLILADKLDFEIASSYNLTIVVSDRGIPQRSSS--VPVLINVMDTNDNPPSFSRAEYSAVVNEGAERGTEIL-QLFAIDPDSTPNGEVQYSISSGDDSELFTVDQWTGAVRLRRSLDSEKQ 2655          

HSP 8 Score: 136.732 bits (343), Expect = 4.320e-31
Identity = 353/1581 (22.33%), Postives = 634/1581 (40.10%), Query Frame = 2
Query: 3149 VEISVRIIDANNHSPILISTNV-FYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEK-------LSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQ-INIDSWTGLITTKVSLSCAQNVKIRIFV---SDLGFPKMTSSVDTLLKPLY---EPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDG----FLHLRFDSQQLILLKDNL--NVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLE-IKENLPSGSHVASFNIR---RLKNLEVVYSIKQPE----KYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSP-SSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGI----FMINGDSGEIHLVSS----PRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDL--QRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCS-PLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAF-NATHFSLKVLENSPGGTVLGRINI--VKPPVNSEIFYVL--NPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQ-PIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDG---------KSGNLFXXXXXXXXXXIRHFLKVIV-SDNGVPSKCTTVLIDIS-LNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVF----------LHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIR-GYKKVIIHXXXXXXNKPVFSQ----NKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDG-PDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARF----SSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRD-NGKVTFELVSTSPWF-GLRGFDNNTAAL---FLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDK--AIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQ-IEKENKGPNLIDNKY 7630
            VE+++ + D N+H+P+       F I +    GT+       D D  +       +   +  Q F +E        L  +  V  V   ET +SY     ++L A D GSP ++  + L +   + N N P     + H   +    L  G+ I  V A D D+G N +  Y I     + D    IDS TG+IT    L         + V    +   P++T+S  T+    Y   +P      ++++ +  I + +QPG  V  +++   +YG      +N   S++G    F     DS   ++  D +    +  HY L V+        + +     + V  V  + PLF  D  ++ + I E    GS V     R   +  N +V YSI Q E     +F ++ VTG + T    D E +      + V+A+    P + +   + V + D NDNEP   S   ++ ++ +AP        ++ ATDAD G    ++Y +      +    F ++  +G+I   +S       + Y+  VT  D G     +S V  +    I                    QS  G  + +++     ++ N  + Y  +    +  F+++  TG +    S+SR   G +  V I +V+ +     +      R+ I+I  G   PP F ++ +   + ED      + VV      G+   I Y +          +D  TG L  S PL+   +   NL++ A      + G+   T+V I V +   +   F  ++  SL + E++  GTV+ ++         N  + + L  +  H    I+  +G LR  G L  E +   +L +   AK   + + Q +S    V  +   + Q P+      ++ +  S        ++ A + D    IT        T+ +L      DG          SG LF+KS++    K  + L V+  S NG   K  +  + +S ++++    +   E+A   V+EN   GT  G++       D  A      G+N  L +          ++  TG+I  +    +DRE      L      GG+  R       I V D +DN P FS      + +    EGQP    +  +   DPD G N  + Y +    + E F ++ N G+++++  L+   +  Y  +I AS + SP   +   L + +++ +   P  +     LK       GS I  + + DS   P+           T+      V   +G+I+L+R+L      ++   + VDD       S    + IDV+D N+H P   E+  +I +  +   GS      A+DKD    N +V + ++   P    L   D  T AL    ++D   EK     L +Q +D+A+D  +R        + +       P  I   ++ +++ E    G  +   +  D D  +   + Y+I + + +     ++ ++G L + + ++   +  + L +     G  ++ +S  LSVQ I+  ++ P   +++Y
Sbjct:  123 VEVTILVNDINDHAPVFPRKRATFKIPEQTTIGTKFPLEPAVDADEDQLTTQGYIITDGNVGQAFLLETKRGSNKVLYLDLVVNAVLDRETRSSY----TLLLEAFDGGSPKRTGQMILDVIVQDINDNAPVFNQSRYHA--MISENLQPGNNILQVFASDADEGDNGLVLYDINRRQSDPDHYFVIDSRTGVITLNKPLDYEMRRVHELVVQARDNASQPEVTNSFVTIQVRDYNDNQPTMTIIFLSEDGSPRISEGAQPGQYVARISVTDPDYGE----YANVNVSLEGGNGKFALTTKDSIIYLICVDQILDREEQDHYELRVMATDSGTPPLRAESSFTIQVIDVNDNPPLF--DQQEYTQVIPEVAFPGSFVVQVTARDKDQGPNGDVQYSILQNEGTHSDWFSVDAVTGVVTTLTQLDYEIDPTPS--ITVVASDRGRPPLSSTAVVKVILQDINDNEPVFGSKFYNASIKENAPA--RTCFMEVTATDADGGSFGSISYSLGSGQGSVTPSQFTVDKHNGQICTTTSLDRDQGPANYDFTVTAVDGG----GLSSVAYVRVDLIDINDNQPAFYPVSYAVSLSTQSAPGTSVLKVTAHDPDAAENGRVTYRTVPEGSSPFFTLNKDTGVI----SLSRALHGKANSV-ITMVVSAQDGGGLTAPVNARVNISIVAGLVAPPVFEQAQYYFVVSEDALRGTQVGVVRASTKNGVLKDISYIISSGDPTGYFTVDSETGALRTSLPLDHEAQPSLNLEVQAHCGNPPAFGQ---TRVRITVSDVNDNAPVFLPSSSESLILPEDTRMGTVVYKVQAEDRDSGPNGLLSFDLFTSSAHRTFSIDRNSGHLRLIGSLSYETMPRYDLQV--IAK--DSGAPQLSSTFTLVIHVQAENGQGPVFDSLTYRVELKESTPLNTRFLQVRAVNRD--GGITTGLSS---TSASLAYHLHPDGDAAGFGIVSDSGWLFVKSALDREAKEMYLLTVLATSGNGQLKKTGSATVRVSVMDENDNTPRFTQERAFLAVRENLPAGTGFGRVS----ASDRDA------GLNGRLSYRLLHLDRHFQINSHTGEI--STKLSLDRELQSSYQLIVVAQDGGTPPRSATGTAFITVLDENDNAPSFSNAQTGRELLLQALEGQPSGFLLGTVHAKDPDEGENGTIFYSMSGPRA-ERFTLNPNTGELRSSSALSHSERPEYSFIILASDRGSPPQSSIIALKIQVLSSSKGSPNTNSQPLILKSVEGAKPGSMIGSVRSPDSQALPESGQVTFTVVGGTDFDGTFVVDRQTGDIYLARELDFEKCPRYTLQVEVDDFSMPLPKSDIITLIIDVQDSNDHSPEFPEDPIIIVVPENTDPGSSFYTFQAVDKDGSGPNSEVHYSILQQWPNIPDLLSLDPTTGALSLGMMLD--HEKTSSLLLVVQASDSALDVSQRRRGSVTARIFVTDVNDNEPVFI--SASVVSVMEDQPVGFVVVYVMAVDADQGENGRVTYRIQSGN-VRGKFSINPDTGSLSILRPIDREEEDLYNLTIVAEDHGLQQRSSSQLLSVQVIDVNDEAPYFQESQY 1648          

HSP 9 Score: 108.997 bits (271), Expect = 1.029e-22
Identity = 80/241 (33.20%), Postives = 122/241 (50.62%), Query Frame = 2
Query:  248 VIKVSGLIDREKQNLYSFLIISMNGDTKNVQ------IKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIV--SGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFL----DNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHH 934
            +I V  ++DRE+Q+ Y   +++ +  T  ++      I+++DVNDN P F+   + + IPE    GS V   T  D D+G N      I+   G     F++D       +  V   L Q LDYEI    ++ + A D G PPL ++ +VK+I+Q+ NDN P F    Y ASIKE+      F+ V ATD D G  G + Y L     + +PS   FTVD   G +    SLD ++  +++
Sbjct:  419 LICVDQILDREEQDHYELRVMATDSGTPPLRAESSFTIQVIDVNDNPPLFDQQEYTQVIPEVAFPGSFVVQVTARDKDQGPNGDVQYSILQNEGTHSDWFSVD------AVTGVVTTLTQ-LDYEIDPTPSITVVASDRGRPPLSSTAVVKVILQDINDNEPVFGSKFYNASIKENAPARTCFMEVTATDADGGSFGSISYSLGSGQGSVTPSQ--FTVDKHNGQICTTTSLDRDQGPANY 650          

HSP 10 Score: 102.449 bits (254), Expect = 1.108e-20
Identity = 88/307 (28.66%), Postives = 141/307 (45.93%), Query Frame = 2
Query:  128 IKENVPIGEVVGQI------ESPGFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTK---NVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQ---FNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVD-----------HKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTS 979
            + EN  IG ++ Q+        P  S    +    + KF I +  G + ++  +D E +  Y+  + S +   +   N+ I + DVNDN P F+   +E ++ E+ P GS V   T  D D G+N   + R+VS  ++ +F   Y D SNG  +++       + E  SQ     +VI+A D G PPL A   V++ V + NDN P F  + Y AS+ ED+    T L + A D D       F F   +    + F ++              G + L   LDFE + S++++I V D   P  +S
Sbjct: 2274 VPENTLIGTMITQVTGNDVDSGPALSYTLLLDSDTQGKFGIHRYGGGVSLTTPLDFEIKTWYTLTVSSSDSKQQSHANLTILVEDVNDNAPVFSQDLYEVTLAEHSPAGSSVITVTATDKDSGENGRITYRVVS--TKDMF---YIDPSNGTLFIK------KEVEFDSQRPSILVVIEASDSGTPPLTALSTVQVHVSDVNDNAPVFHQTEYRASVSEDEVPGSTILTLEAADGDLSRDNCGFDFAIASGNIGNTFQIESSVRFLEGHGFQTVGMLILADKLDFEIASSYNLTIVVSDRGIPQRSS 2569          

HSP 11 Score: 97.0561 bits (240), Expect = 4.286e-19
Identity = 76/289 (26.30%), Postives = 127/289 (43.94%), Query Frame = 2
Query:  149 GEVVGQIESPGFSPPFEMH-DFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGD-------TKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISR----YIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTS 979
            G +   + S   S  + +H D     F I   +G + V   +DRE + +Y   +++ +G+       +  V++ ++D NDN P+F       ++ EN P G+     +  D D G N   S R++  D  + F I+ H          +  K SLD E+ S + L++ A DGG PP  A+    I V + NDN P F  ++     +    E Q        V A D D G +G +FY +  + P ++ FT++  TG +    +L   +   +   I   D   P  +S
Sbjct: 1025 GGITTGLSSTSASLAYHLHPDGDAAGFGIVSDSGWLFVKSALDREAKEMYLLTVLATSGNGQLKKTGSATVRVSVMDENDNTPRFTQERAFLAVRENLPAGTGFGRVSASDRDAGLNGRLSYRLLHLD--RHFQINSHTG-------EISTKLSLDRELQSSYQLIVVAQDGGTPPRSATGTAFITVLDENDNAPSFSNAQTGRELLLQALEGQPSGFLLGTVHAKDPDEGENGTIFYSM--SGPRAERFTLNPNTGELRSSSALSHSERPEYSFIILASDRGSPPQSS 1302          

HSP 12 Score: 96.6709 bits (239), Expect = 6.518e-19
Identity = 79/253 (31.23%), Postives = 117/253 (46.25%), Query Frame = 2
Query:  194 FEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLI------ISMNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDG-GHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLD-NTSPSSDFFTVDHKTGNVYLRKSLDFEKSKS 928
             E H FQ        T G++ ++  +D E  + Y+  I      I     +  V I ++D NDN P F+   +   + E    G+++      DPD   N      I SGD  ++F +D    +     VRL  ++SLD E  S    VIQA DG GH  L     V + +++ N+N P F +    ASI+E+Q  N     + A D+D G  GEL YFL  N     D F V+  +G V  R + D+EK+ +
Sbjct: 2528 LEGHGFQ--------TVGMLILADKLDFEIASSYNLTIVVSDRGIPQRSSSVPVLINVMDTNDNPPSFSRAEYSAVVNEGAERGTEILQLFAIDPDSTPNGEVQYSISSGDDSELFTVDQWTGA-----VRL--RRSLDSEKQSSHMFVIQASDGQGHFALAP---VTVEIKDINNNRPYFPLKSLTASIRENQPQNALVTILHAIDHDKGAYGELRYFLTYNAGNGKDSFLVNQTSGEVRTRFTFDYEKTNT 2762          

HSP 13 Score: 94.3597 bits (233), Expect = 3.400e-18
Identity = 79/259 (30.50%), Postives = 123/259 (47.49%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKN------VQIKILDVNDNEPK----FNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFY-FLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            F+I   TGVI ++  +D E + ++  ++ + +  ++       V I++ D NDN+P     F + +    I E    G  V   +V DPD G+ +  +V +  G+ +  FA+   DS   I Y+ + + Q LD E    + L + A D G PPL+A     I V + NDN P FD   Y   I E        ++V A D D G +G++ Y  L N    SD+F+VD  TG V     LD+E   +  I++   D   P
Sbjct:  301 FVIDSRTGVITLNKPLDYEMRRVHELVVQARDNASQPEVTNSFVTIQVRDYNDNQPTMTIIFLSEDGSPRISEGAQPGQYVARISVTDPDYGEYANVNVSLEGGNGK--FALTTKDS---IIYL-ICVDQILDREEQDHYELRVMATDSGTPPLRAESSFTIQVIDVNDNPPLFDQQEYTQVIPEVAFPGSFVVQVTARDKDQGPNGDVQYSILQNEGTHSDWFSVDAVTGVVTTLTQLDYEIDPTPSITVVASDRGRP 553          

HSP 14 Score: 80.1073 bits (196), Expect = 6.344e-14
Identity = 74/299 (24.75%), Postives = 131/299 (43.81%), Query Frame = 2
Query:  122 FSIKENVPIGEVVGQIES----PGFSPPFEMHDFQ-EKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDT------KNVQIKILDVNDNEPKFNATNFEKSIP----ENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDA-GVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPF 970
             +++EN+P G   G++ +     G +          ++ F I+  TG I     +DRE Q+ Y  ++++ +G T          I +LD NDN P F+     + +     E  P G  +      DPDEG+N      + SG   + F ++ +          L    +L +    +++ +I A D G PP  + + +KI V +++   P  +    I    E  +       VR+ D+ A   SG++ + +   +     F VD +TG++YL + LDFEK   + + + V D S P 
Sbjct: 1116 LAVRENLPAGTGFGRVSASDRDAGLNGRLSYRLLHLDRHFQINSHTGEISTKLSLDRELQSSYQLIVVAQDGGTPPRSATGTAFITVLDENDNAPSFSNAQTGRELLLQALEGQPSGFLLGTVHAKDPDEGENGTIFYSM-SGPRAERFTLNPNTG-------ELRSSSALSHSERPEYSFIILASDRGSPPQSSIIALKIQVLSSSKGSPNTNSQPLILKSVEGAKPGSMIGSVRSPDSQALPESGQVTFTVVGGTDFDGTFVVDRQTGDIYLARELDFEKCPRYTLQVEVDDFSMPL 1406          

HSP 15 Score: 77.0258 bits (188), Expect = 5.116e-13
Identity = 76/298 (25.50%), Postives = 140/298 (46.98%), Query Frame = 2
Query:  113 LLIFSIK-ENVPIGEVVGQIESPGFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDT----KNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIV----SGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLR-----KSLDFEKSKSHHISIGVRDNSP 964
            L +F+I  ++ P GEV   I S   S          + F + + TG +++   +D EKQ+ + F+I + +G        V ++I D+N+N P F   +   SI EN P  + V +    D D+G  +   +R      +G+ +  F ++    ++G    R     + DYE  + FN +  A+D G+    A++ V++ V   ++  P F  S +   + E  +   +  +V A D D GV G + Y L N+SP   +F ++  TG + L+     + +   K ++  +++ V  +SP
Sbjct: 2607 LQLFAIDPDSTPNGEVQYSISSGDDS----------ELFTVDQWTGAVRLRRSLDSEKQSSHMFVIQASDGQGHFALAPVTVEIKDINNNRPYFPLKSLTASIRENQPQNALVTILHAIDHDKG--AYGELRYFLTYNAGNGKDSFLVN---QTSGEVRTRF----TFDYEKTNTFNFIAIAMDTGN--YTATVTVQVFVTGEDEYDPVFTESDFAFHVPEGAKKGQSIGQVNANDEDGGVDGIVLYTLANSSP---YFELNTSTGVISLKMDAYHRHVTRSKRETRQMTLDVIAHSP 2880          

HSP 16 Score: 73.1738 bits (178), Expect = 8.272e-12
Identity = 63/265 (23.77%), Postives = 112/265 (42.26%), Query Frame = 2
Query:  218 KKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKNVQ------IKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYH---DSSNGIFYV-----RLILKQSLDYEIISQFNLVIQAIDG-GHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            + F I + +G +++ G +  E    Y   +I+ +     +       I +   N   P F++  +   + E+ P+ ++       + D G        I +G S    ++ YH   D     F +      L +K +LD E    + L + A  G G      S  V++ V + NDN P+F   R   +++E+      F RV A+D DAG++G L Y L +       F ++  TG +  + SLD E   S+ + +  +D   P
Sbjct:  937 RTFSIDRNSGHLRLIGSLSYETMPRYDLQVIAKDSGAPQLSSTFTLVIHVQAENGQGPVFDSLTYRVELKESTPLNTRFLQVRAVNRDGG--------ITTGLSSTSASLAYHLHPDGDAAGFGIVSDSGWLFVKSALDREAKEMYLLTVLATSGNGQLKKTGSATVRVSVMDENDNTPRFTQERAFLAVRENLPAGTGFGRVSASDRDAGLNGRLSYRLLHL---DRHFQINSHTGEISTKLSLDRELQSSYQLIVVAQDGGTP 1190          

HSP 17 Score: 70.8626 bits (172), Expect = 4.000e-11
Identity = 65/256 (25.39%), Postives = 118/256 (46.09%), Query Frame = 2
Query:  218 KKFIISKTTGVIKVSGLIDREKQNLYSFLIISMN-GDTKNVQIKILDVNDNEPKFNATNFEK-----SIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            K F I+  TG I+ +  +    Q+    ++ +M+ G+     + ++ V   E  +    F +     S+ EN   G+ V       PD G  S  +  I SG+ ++ F+I +H    G  +V       LD+E   +  LV++A         A   V +++Q+ NDN+P+F +  Y+A ++E Q  +   ++V A D D G +G++ Y + ++S S   F +D  TG++     +D E     ++ I   D   P
Sbjct: 1999 KGFTINSLTGAIQATEKLQALTQSQRILIVEAMDQGNPSQSSLGVVIVYIREQSYQGVRFSRNTRDVSLQENAAKGTAVVQIHAQYPD-GSTSGINYSIFSGNKQQSFSISHH---TGEIWVED--STGLDFEETPRLRLVVKAETASSSSFMA---VNLLLQDVNDNLPRFQLHNYVAYVREAQGYDHPIIQVLANDLDQGQNGQVTYSIRSSSMSG-LFKIDPITGSISTAAIMDREIWTQTNLVIMATDRGSP 2244          

HSP 18 Score: 70.0922 bits (170), Expect = 7.500e-11
Identity = 78/294 (26.53%), Postives = 123/294 (41.84%), Query Frame = 2
Query:  125 SIKENVPIGEVVGQIESP---GFSPPFEMHDF---QEKKFIISKTTGVIKV--SGLIDREKQNLYSFLIISMNGDTKN---VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFH 973
            S++EN   G  V QI +    G +       F   +++ F IS  TG I V  S  +D E+      ++ +    + +   V + + DVNDN P+F   N+   + E       +      D D+G+N   +  I S     +F ID    S     +       +D EI +Q NLVI A D G P L  S  + +I+ + NDN P   + R +  + E+  I     +V   D D+G +      LD  S +   F +    G V L   LDFE    + +++   D+    H
Sbjct: 2066 SLQENAAKGTAVVQIHAQYPDGSTSGINYSIFSGNKQQSFSISHHTGEIWVEDSTGLDFEETPRLRLVVKAETASSSSFMAVNLLLQDVNDNLPRFQLHNYVAYVREAQGYDHPIIQVLANDLDQGQNGQVTYSIRSSSMSGLFKIDPITGSISTAAI-------MDREIWTQTNLVIMATDRGSPRLAGSATLTVIIVDLNDNSPTIPVPREV-RVPENTLIGTMITQVTGNDVDSGPALSYTLLLD--SDTQGKFGIHRYGGGVSLTTPLDFEIKTWYTLTVSSSDSKQQSH 2349          

HSP 19 Score: 59.3066 bits (142), Expect = 1.102e-7
Identity = 93/435 (21.38%), Postives = 188/435 (43.22%), Query Frame = 2
Query:   89 YQSQQNSNLLIFSIKENVPIGEVVGQI------ESPGFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTK------NVQIKILDVNDNEPKFNATNF-EKSIPENYP---IGSKVDLTTVFDPDEGKNSIQSVRIVSG-DSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKII-VQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDND-AGVSGELFYFLDNTSPS-SDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDAIS---TSFDLEILN-RSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKI 1321
            + + Q    L+    E  P G ++G +      E    +  + M   + ++F ++  TG ++ S  +   ++  YSF+I++ +  +        ++I++L  +   P  N+     KS+    P   IGS     +   P+ G+ +     +V G D +  F +D      G  Y    L + LD+E   ++ L ++  D   P  ++ ++  II VQ++ND+ P+F     I  + E+ +   +F   +A D D +G + E+ Y +    P+  D  ++D  TG + L   LD EK+ S  + +   D++      +   +   I + D   +  +  +  +  +  D     +V +V   D D       ++ ++  N R  F    I P    L ++  I   + +  NLT+ A D+     S++Q L++++
Sbjct: 1212 FSNAQTGRELLLQALEGQPSGFLLGTVHAKDPDEGENGTIFYSMSGPRAERFTLNPNTGELRSSSALSHSERPEYSFIILASDRGSPPQSSIIALKIQVLSSSKGSPNTNSQPLILKSVEGAKPGSMIGSVRSPDSQALPESGQVTFT---VVGGTDFDGTFVVDRQ---TGDIY----LARELDFEKCPRYTLQVEVDDFSMPLPKSDIITLIIDVQDSNDHSPEFPEDPIIIVVPENTDPGSSFYTFQAVDKDGSGPNSEVHYSILQQWPNIPDLLSLDPTTGALSLGMMLDHEKTSSLLLVVQASDSALDVSQRRRGSVTARIFVTDVNDNEPVFISASVVSVMEDQPVGFVVVYVMAVDADQGENGRVTYRIQSGNVRGKF---SINPDTGSLSILRPIDREEEDLYNLTIVAEDHGLQQRSSSQLLSVQV 1633          

HSP 20 Score: 53.1434 bits (126), Expect = 9.133e-6
Identity = 128/563 (22.74%), Postives = 226/563 (40.14%), Query Frame = 2
Query: 6044 IVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIID-----GVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDANG--------DVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFS---STAVIEIDVEDKNNHVP-----ILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDE---PQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDS--DKAIFYKI-DNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQ 7648
            +VP     ++ E    GT +G I       D +A    I      GV+ +L  + ESTG   +  A  +DRE  D+   +  V+  G  +    +V I V+D++D+ PVF + +    + E     T        D D    +   Y I   +  + FL++           D+  N  L+  T+S Y L+++A    SP    +  L V + +IND  P  +    +  +  N   G+ I ++ A D+D G +G+     +R+ ++   +  +   +G I L++ L       HE  +   D       + + + I V D N++ P      L E+G    +S   + G  +  +   D D  +   V   L   +  F L   D +   L  +D+    +E+ H Y L +  TD+   P  R  S F + V+        P L         IPE    GS + +   +D D   +  + Y I  N    S+   +D  +G +     L+Y I P   + V  +  G P   ++  + V ++  N    +  +K+   S++
Sbjct:   39 MVPGTLQLQLDEEQPAGTVVGDIS-AGLPPDMTASHYFISDHQGTGVSTDL-DIDESTG--IIKTARVLDREVRDRY-SFIAVTMTGITV----EVTILVNDINDHAPVFPRKRATFKIPEQTTIGTKFPLEPAVDADEDQLTTQGYIITDGNVGQAFLLETKRGSNKVLYLDLVVNAVLDRETRSSYTLLLEAFDGGSPKRTGQMILDVIVQDINDNAPVFNQSRYHAMISENLQPGNNILQVFASDADEGDNGLVLYDINRRQSDPDHYFVIDSRTGVITLNKPLDYEMRRVHELVVQARDNASQPEVTNSFVTIQVRDYNDNQPTMTIIFLSEDGSP-RISEGAQPGQYVARISVTDPDYGEYANVNVSLEGGNGKFALTTKD-SIIYLICVDQILDREEQDH-YELRVMATDSGT-PPLRAESSFTIQVIDVNDN---PPLFDQQEYTQVIPEVAFPGSFVVQVTARDKDQGPNGDVQYSILQNEGTHSDWFSVDAVTGVVTTLTQLDYEIDPTPSITVVASDRGRPPLSSTAVVKVILQDINDNEPVFGSKFYNASIK 585          
BLAST of Dachsous vs. Ensembl Zebrafish
Match: dchs1b (dachsous cadherin-related 1b [Source:ZFIN;Acc:ZDB-GENE-050208-41])

HSP 1 Score: 273.092 bits (697), Expect = 2.259e-72
Identity = 442/1903 (23.23%), Postives = 804/1903 (42.25%), Query Frame = 2
Query: 2948 SFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLET-EVEISVRIIDANNHSPILISTNVFY-IHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCP--LLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVK--IRIFVSDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPE---NYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNV-VFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLK----NLEVVYSIKQ--PEK--YFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVS-NPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPS-SDGIFMINGDSGEIHLV---SSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCS-PLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVL--GRINIVKPPVNSEIFYVLN-PGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQ-PQKPLTKLSATDSDKTSN--ITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISL-NQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSA-KFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGF--DNNTAALFLID----EPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTE--ITIPESLKSGSKITKF--VCKDLDSDKAIFYKIDNFHPISNNLYLDFE---------------SGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESRIWNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEP--PKTTVLKLPEW----YHDIQYFLTPHENFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIVENPSENFGINNETGAIYIK 8464
            S P   L+YR++   P G    F I P +G L + S+L+    +    I LL +++ +G  +   T    I V + D N+++P      VF  + +    GT  G +   D D G N  +   L   H  + F I   +           E  +SY     +M++  D G+P +S+     I  ++ N N P     +  ++++      L +GS + T+NA DPD+G N    YS  L+    ++ +++  TG + +   L  A+  +    I  SD G P  +SS   L++ +   +        ++T    + ++PG V+G +    +       +  ++    T  +G   +   +  + L ++    K   Y+L + V +    +  +  + + + V       P F +D P  + I EN  +GS V +F          N E+ YS++Q  P+    F ++PVTG L   R  D E  + +   V+ + + +  N +++  +   V + DENDN P   SP++  V    P      +  ++A DAD G N +++Y+I    + G F+++ +SG + ++         +Y L +   D G    S + V SI  Q I    +  +   +           +G  I Q++ S      N  + Y    G     F+++  TG +     + RE     +   I V  +       +   ++ I +   N+N P F    + +++PE+       T+ A D D+G  GR+ Y ++    D    +D S+G LS S PL+   K+ Y+L+++  D    S        V I V +   ++  F+++ +++ V E++  G V+       V    N +I Y L+        ++  TG + T   L  E  +        +A  +S  + + ++A + V I+D+NDN P   ++P+ I + + +    + +  + A D D  +N  + Y+F           + + ++  +G +    ++ +  + +  L V   D G P + +  ++ I +  QD++ ++         ++EN+  GT + Q +  +         +SI  G  +    +  +TG+I+V ++  +D E   ++ L  +     S    +  V + + DV+DN+P F    +V +++E Q    P+I++   D D G N QV Y IE  +    F ID   G + T   ++    +   LVIKA+ + SP +     +TV IV++ND  P I +P R +++  N  +G+ IT +T  D D    +SY ++    T Q  F ++   +G + L+  L   +   ++  I   D++  S A + + VED N++VP   ++   + L      GS ++ + A D+D  +NGKV++ ++S++      GF  D     LF+      +P+E      + I+  D    P   L S   + V L       P     H  E   T+ E    G+ I     V  DL  + + F    +F   S N+   F+                G L L + L++     + L V+ +  G P++ +S    + +   N  P +       ++L   E     A I  +   D +S  Y+    S++        D   F +D       +   L +    N  ++IV+A              +    I V  K I + R    I  LT  I EN+P     TVL   ++    Y  ++Y+L  H +          +   +++K + DFE   ++    L   +     + S T+ V++ +   DEY P F     +  V  G  K GQ +    A D+D G  GIV Y    N S  F +N  TG IY+K
Sbjct: 1037 STPTSTLAYRLR---PDGDAVGFGIAPDSGWLFVKSALDREVKD----IYLLTVLATSGSGQMGRTGSATIRVSVTDENDNAPRFSQERVFLAVRENLPAGTGFGRVSATDRDAGLNSRLTYRLL--HTDRYFQINSQTGEISTRAALDREHQSSY----QLMVVVQDGGTPPRSATGTAHITVLDENDNAPAFSHTQPGREILIQVQEGLPAGSLLGTLNAKDPDEGENGTIFYS--LSGSRAERFSLNPNTGELRSSSPLRRAEKAEYSFTITASDRGAPSQSSSAVLLIQVIGSTRISPKPNTLSMTLNSVEGAKPGSVIGSVRAHDQREVTLNGQVTYLVVGGTDHEGTFMVDRLTGDVYLARELDYEKGSRYTLQIEVDDFSKAYPNTHMIQLEINVQDSNDHAPQFPED-PVTIVIPENTQAGSSVYTFQATDKDGSGPNSEIRYSVQQRWPDNPDLFNLDPVTGVLKLGRELDHEETSSLFLVVQAMDSALDPNQRLWGSVTARVFVTDENDNAPIFSSPTAVSVMEDQPV--GFVLLYVMAWDADQGENGRVSYRIQSGNTAGRFVLSSNSGSLSILKPLDREEQESYNLTIVAEDHGIPQHSTTQVLSI--QVIDVNDEAPWFERNEFEAQIRENQPAGTSIIQVTASDRDHGTNGLVTY---GGVTEDGFTINAETGVISATRVLDREL---QDHYTITVYAKDGGIPPNFAKAKVHITVLDENDNAPAFGLQQYSLEVPENLQPVELFTLKATDRDIGESGRLEYKIKAGDPDGDFRLDGSSGALSTSRPLDRERKSSYSLQVVVQDHG--SPSLNSTASVEISVLDVNDNSPKFSSSSYTVDVSEDAAIGLVVLDATATDVDEGQNGQILYFLSQEAKGAFTVDPNTGRITTAALLDRE--KRASYFFQVYAVDLSPAAPRNSTAQVTVTILDVNDNAPFFIQDPLIINVSSGSVFTHQVVATMRAEDKDFGANGSVFYRF-------AMPVRGFAINSLTGAIQTTENLQTLTQTQRTLIVEAMDQGSPPQSSLGVVIIYVKEQDYKGIRFSRTARDVSLQENADKGTVVAQAQAQHPDGTRDGINYSIFSGNKYHSFSISSNTGEIWVQSSNGLDFEDTPRLRLVVKAETTSSS--SFMAVNLILQDVNDNRPRFQLQNYVTYMHEAQGYDFPIIQVVAEDVDQGQNGQVTYTIESSNQSGLFKIDPQTGSITTTAIMDREIWTQAKLVIKATDRGSPKLVGTATITVIIVDLNDNSPTIPVP-REVRVPENSLIGTEITLVTGNDVDSGPVLSYSLQLDAST-QGKF-DIDRYNGRVSLTAPLDYEERTWYKLTIRASDSKHQSEANLTVVVEDVNDNVPTFTQDLYQVTLPEHSPPGSPVITVTATDRDSGENGKVSYRVLSST----RDGFYVDPKNGTLFIRQKAKFDPEEPS--VSIVIEARDGGSPP---LSSSATVQVQLMDVNDNAPIF---HQLEYKATVSEDQLPGATILTLEAVDGDLSQENSGF----DFAIASGNVGNAFQIESSVRFIEGHGFQTVGTLILAERLDFEALSHYNLTVSVSDRGVPQRSSSVPAIITVTDVNDNPPVFGRAEYIVALS--EGAAAGAEILRVTATDPDSAPYAEVQYSISSGD-----DMKLFSVDQWTGAMKLQRPL-DRESQNSHVVIVQASDGHGR--------FALAPISVEVKDINDNRPYFPIATLTASIRENQPLNSAVTVLHAIDYDTGVYGQLKYYLMDHSSPGKDLFFVDQNSGEVRTKQIFDFEKVNSFNFIALAVDA----GNNSATVTVQVFITGEDEYDPVFTTSDLSFEVPEGAKK-GQSIGLVQAKDEDGGVDGIVLYSF-PNSSPYFDVNKTTGVIYLK 2859          

HSP 2 Score: 189.504 bits (480), Expect = 5.448e-47
Identity = 372/1580 (23.54%), Postives = 646/1580 (40.89%), Query Frame = 2
Query: 3149 VEISVRIIDANNHSPIL--ISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEK-------LSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQ-INIDSWTGLITTKVSLSCAQNVKIRIFV---SDLGFPKMTSSVDTLLKPLY---EPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDG----FLHLRFDSQQLILLKDNL--NVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIR---RLKNLEVVYSI----KQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGI----FMINGDSGEI----HLVSSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDL--QRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCS-PLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHT-LAFNATHFSLKVLENSPGGTVLGRINI--VKPPVNSEIFYVL--NPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAEN---PV------KIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKM--------YLLDGKSGNLFXXXXXXXXXXIRHFLKVIV-SDNGVPSKCTTVLIDISL-NQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVF----------LHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVI-IHXXXXXXNKPVFSQNK----FVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFD-----------SGEIFLSRKLLVSDVGKHEFDIVVDD--ARFSSTAVI--EIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRD-NGKVTFELVSTSPWF-GLRGFDNNTAALFLIDE-PQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDK--AIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQI 7588
            V++S+ + D N+H+P       ++    QTAV GT+       D D  +       +K+ +  Q F +E        L  +  V  V   E  +SY    ++++ A D GSP ++  + L I   + N + P  V  +     I    L  GS I  V A D D+G N +  Y I     + D+   ID  +G+IT   +L         + V    +   P++T++  T+    Y   +P      ++++ +  I + +QPG  V  +++   +YG      SN   S++G    F     DS   ++  D +    +   Y L V+        + +     + V  V  + PLF + + K   I E +  GS V     R   +  N ++ YSI    K    +F I+PVTG + T    D ET  +    ++V+AT    P + +   + + + D NDNEP +   S   V I   T+E     ++ A DAD G    +TY I   S       F IN +SG+I     L       ++   VT  D G    S S    +  + I       +  N      +  QS  G  + +++     +  N  + Y+ ++G  +  F+++  TG +    S+SR   G +  V IP+VI +     +      R+ I++  G+  PP F ++ +   + ED      + VV      G+   + Y++     D    +DP TG L  S PL+   +  ++L+I A      + G    T+V + + +   +  + F ++  SL + E +  GT++ R+         N ++ + L  + G     +  ++GE+R  G L  + V   +L +   AK      +  T +++            I AEN   PV      ++ +  +        ++ A + D   N       S PT+   Y++        + +   SG LF+KS++   +K  + L V+  S +G   +  +  I +S+ +++    +   E+    V+EN   GT  G++       D  A      G+N  L +          ++  TG+I   AA  +DRE      L   V  GG+  R       I V D +DN P FS  +     +  + EG P  + +  L   DPD G N  + Y +   S  E F ++ N G+++++ PL    K+ Y   I AS + +P   +   L + ++      PK +  +  L        GS I  + A D           R   L  Q  +L V              +G+++L+R+L      ++   I VDD    + +T +I  EI+V+D N+H P   E+   I +  + + GS +    A DKD    N ++ + +    P    L   D  T  L L  E   E+    FL +Q  D+A+DP +RL       V +       P  I +  T +++ E    G  +   +  D D  +   + Y+I + +  +    L   SG L + K L+   Q  + L +     G P+  T+  LS+Q+
Sbjct:  128 VKVSITVNDINDHAPTFPKKKASLKIPEQTAV-GTKFSLEPATDADKDQLTVQGYQIKEGNVGQVFRLETKRAANKVLYLDLVVNGVLDREKRSSY----SLVVEAFDGGSPRQNGQMTLDILVQDINDHAP--VFNQSRYNAIISESLPQGSNILQVFASDADEGDNGLVLYEINRRQSDPDRYFVIDPRSGIITLNKALDYEMRKVHELVVQARDNASHPEITNAFVTIHVRDYNDNQPTMTIIFLSEDGSPQISEGAQPGQYVARISVSDPDYGE----YSNVNVSLEGGDGKFALTTKDSIIYLIYVDQILDREERDSYELRVMATDSGTPPLHAESSFTIHVTDVNDNPPLFDQQAYK-QTIPEVVYPGSFVLQVTARDKDQGPNGDIRYSILPDKKTHSSWFTIDPVTGIITTATKLDYETIPKPS--IKVVATDGGRPPLSSTAVVEIDLQDTNDNEP-VFGSSFYNVSIKENTSEGTCFLEVKADDADGGSFGTITYSIGSGSVSAPLSQFSINKESGQICTSTALDRDEGADSFHFTVTATDGGG--LSSSASVLVSLEDINDNRPSFYPLNYAVSLST--QSSPGTSVIRVTAHDPDAGANGRVTYHTVSGGGSSFFTLNKDTGVI----SLSRSLHGKANSV-IPMVISARDGGGLTAPVNARVNISVVGGSVAPPVFEQAQYFFTVSEDVLRGTEVGVVRASSRNGVSKDVTYTISAGDPDGYFMVDPETGALRTSLPLDHESRPFFDLEIQARSGSPPAFGD---TRVRVTIADVNDNAPIFFPSSSESLLLPEATKMGTIVYRVQAEDRDSGPNGQLSFDLISSGGQRTFGVERSSGEVRLIGSLSYDSVPRYDLQV--IAKDSGAPQLSATFSLVVH----------IQAENNQGPVFDTITYRVELKENTPLNTNFLQVRALNRDPNGN----GGSSTPTSTLAYRLRPDGDAVGFGIAPDSGWLFVKSALDREVKDIYLLTVLATSGSGQMGRTGSATIRVSVTDENDNAPRFSQERVFLAVRENLPAGTGFGRVS----ATDRDA------GLNSRLTYRLLHTDRYFQINSQTGEISTRAA--LDREHQSSYQLMVVVQDGGTPPRSATGTAHITVLDENDNAPAFSHTQPGREILIQVQEGLPAGSLLGTLNAKDPDEGENGTIFYSLSG-SRAERFSLNPNTGELRSSSPLRRAEKAEYSFTITASDRGAPSQSSSAVLLIQVIGSTRISPKPNTLSMTLNSVEGAKPGSVIGSVRAHDQ----------REVTLNGQVTYLVVGGTDHEGTFMVDRLTGDVYLARELDYEKGSRYTLQIEVDDFSKAYPNTHMIQLEINVQDSNDHAPQFPEDPVTIVIPENTQAGSSVYTFQATDKDGSGPNSEIRYSVQQRWPDNPDLFNLDPVTGVLKLGRELDHEETSSLFLVVQAMDSALDPNQRLWGSVTARVFVTDENDNAP--IFSSPTAVSVMEDQPVGFVLLYVMAWDADQGENGRVSYRIQSGN-TAGRFVLSSNSGSLSILKPLDREEQESYNLTIVAEDHGIPQHSTTQVLSIQV 1638          

HSP 3 Score: 187.963 bits (476), Expect = 1.337e-46
Identity = 345/1448 (23.83%), Postives = 606/1448 (41.85%), Query Frame = 2
Query: 2927 LKCSDAD-SFPNGNLSYRMKIIKPVGMNNP--FEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNG--PFKPLETEVEISVRIIDANNHSPILISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSL--SCAQNVKIRIFVSDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKC-LFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHV---ASFNIRRLKNLEVVYSIKQPEK-YFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIF--QIVAT----DADSGPNSKLTYQINPSSDGIFMINGDSGEIHLVSSPRV---SAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAIT-NFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCSPLNFMEKNIYN---LKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRI---NIVKPPVNSEIFYVLNPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVI-VSDNGVPSKCTTVLIDISL---NQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVN--YCKDHSA-KFSIIDG-------VNHELVFLH----ESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYK-KVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEF-DIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWF 7117
             + +D D S PN  + Y ++   P   +NP  F ++P TG L +   L+   ++    + L+V   D+   P + L   V   V + D N+++PI  S     + +    G  +  ++  D D GENG +   ++  +    F +   S +  +++    E   SY    N+ ++A D G P  S+   L I  I+ N   P     +   Q+    P  +G+ I  V A D D G N +  Y        ED   I++ TG+I+    L      +  I ++  D G P   +     +  L E  +      +  +  +P++ QP  +   L     + G    L         DG   L   S  L   +     +   YSL VV       S++S   + + V  V  + P FS  S   +++ E+   G  V    + ++   +N +++Y + Q  K  F ++P TG++ T  + DRE      F V  +    + P+  T   + V I D NDN P+ +     I+ +S+      S+F  Q+VAT    D D G N  + Y+      G F IN  +G I    + +    +   L V   D G  P+S   V  I+ +    K  IRF   +  ++L     K G ++ Q + +Q        I Y + +G     FS+   TG +  Q S +  +  ++  +++ V  ++   +S   +  I  ++   N+N PRF    +   + E +      + VVA D D G  G++ Y++E         IDP TG ++ + +  M++ I+    L I ATD             VII   N    T+        ++V ENS  GT +  +   ++   PV S    +         I+   G +    PL  E   + +LTI A      + S   + A + V + D+NDN P   ++  ++ +P  + P  P+  ++ATD D   N    +     T    Y    +D K+G LF++       +      VI   D G P   ++  + + L   N +      +  KA   V E+ + G  I  ++ V+    +++S   F+I  G       +   + F+     ++ G + +A   ++D E +    L   VS  G   R      II V DV+DN PVF + +++  L+EG      ++R+T  DPD    ++V+Y I      + F +D   G +K   PL+  +++ + ++++AS     F  A   ++V + +IND RP   I      +  N+P+ S +T + A D D G  G + Y +       + LF  V  +SGE+   +      V    F  + VD    S+T  +++ +  ++ + P+   +     +    K+G  I  + A D+D   +G V +   ++SP+F
Sbjct: 1455 FQATDKDGSGPNSEIRYSVQQRWP---DNPDLFNLDPVTGVLKLGRELDHEETSS---LFLVVQAMDSALDPNQRLWGSVTARVFVTDENDNAPIFSSPTAVSVMEDQPVGFVLLYVMAWDADQGENGRVSYRIQSGNTAGRFVLSSNSGSLSILKPLDREEQESY----NLTIVAEDHGIPQHSTTQVLSIQVIDVNDEAPWFERNEFEAQIRENQP--AGTSIIQVTASDRDHGTNGLVTYGGV----TEDGFTINAETGVISATRVLDRELQDHYTITVYAKDGGIPPNFAKAKVHITVLDENDNAPAFGLQQYSLEVPENLQPVELF-TLKATDRDIGESGRLEYKIKAGDPDGDFRLDGSSGALSTSRPLDRERKSSYSLQVVVQDHGSPSLNSTASVEISVLDVNDNSPKFSSSS-YTVDVSEDAAIGLVVLDATATDVDEGQNGQILYFLSQEAKGAFTVDPNTGRITTAALLDREKRASYFFQVYAVDLSPAAPRNSTAQ-VTVTILDVNDNAPFFIQ-DPLIINVSS-----GSVFTHQVVATMRAEDKDFGANGSVFYRFAMPVRG-FAINSLTGAIQTTENLQTLTQTQRTLIVEAMDQGSPPQSSLGVVIIYVKEQDYKG-IRFSRTARDVSLQENADK-GTVVAQ-AQAQHPDGTRDGINYSIFSGNKYHSFSISSNTGEIWVQSS-NGLDFEDTPRLRLVVKAETTSSSSFMAVNLILQDV---NDNRPRFQLQNYVTYMHEAQGYDFPIIQVVAEDVDQGQNGQVTYTIESSNQSGLFKIDPQTGSITTTAI--MDREIWTQAKLVIKATDRGSPKLVGTATITVIIVDLNDNSPTIPVPR---EVRVPENSLIGTEITLVTGNDVDSGPVLSYSLQLDASTQGKFDIDRYNGRVSLTAPLDYEERTWYKLTIRA------SDSKHQSEANLTVVVEDVNDNVPTFTQDLYQVTLPEHSPPGSPVITVTATDRDSGENGKVSYRVLSSTRDGFY----VDPKNGTLFIRQKAKFDPEEPSVSIVIEARDGGSPPLSSSATVQVQLMDVNDNAPIFHQLEYKAT--VSEDQLPGATILTLEAVDGDLSQENSGFDFAIASGNVGNAFQIESSVRFIEGHGFQTVGTLILAE--RLDFEALSHYNLTVSVSDRGVPQRSSSVPAIITVTDVNDNPPVFGRAEYIVALSEGAAAGAEILRVTATDPDSAPYAEVQYSISSGDDMKLFSVDQWTGAMKLQRPLDRESQNSHVVIVQASDGHGRFALAP--ISVEVKDINDNRPYFPIATLTASIRENQPLNSAVTVLHAIDYDTGVYGQLKYYLMDHSSPGKDLFF-VDQNSGEVRTKQIFDFEKVNSFNFIALAVDAGNNSATVTVQVFITGEDEYDPVFTTSDLSFEVPEGAKKGQSIGLVQAKDEDGGVDGIVLYSFPNSSPYF 2847          

HSP 4 Score: 179.874 bits (455), Expect = 4.336e-44
Identity = 363/1615 (22.48%), Postives = 668/1615 (41.36%), Query Frame = 2
Query: 2555 HQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSDEYQII------QSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTN---FTFEDLSSL-------GEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNVFYIHQTAVY-GTEVGTLLXXXXXXXXXXXXXXSL---KQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNE--DQINIDSWTGLITTKVSL---SCAQNVKIRIFVSDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSV-DGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSW--PLFSKDSPKFLEIKENLPSGSHVASFNI--RRLKNLEVVYSIK--QPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQ-INPSSDGIFMINGDSGEIHLVSS---PRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFI-IGQLSYSQTSSSGN----LDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQR-----IFINIDYGNENPPRFSRSIFKVKLPED-EAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSC-SPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVL----ENSPGGTVLGRINIVKPP--VNSEIFYVLNPGHS-HIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLY---------KMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVL-IDISLNQDHQYVQIVPEKAI-FRVKENSVDGTFIGQIKMVNYCKDHSA-----KFSIIDGV--NHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGG----SEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFS---STAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAAL 7153
            H P F+ S     I E+   G  I+QVF       D   ++      QS    +  I  ++G I LNK  D E      + VQ ++   +A+     N       + Y  N  T    F  ED S         G+    +  SD D     N++  ++     G +  F +      + +I    I +        L V+ +D+G   PL  E   ++ + D N++ P+             VY G+ V  +  +D+D G NG+I  S+   K+ H    F I+ +   T +I   +     +  +P ++ ++ATD G P  SS   + I+  ++N N P  V       +        G+    V A D D G      YSI     +    Q +I+  +G I T  +L     A +    +  +D G    ++SV   L+ + + +   + +N  ++  +   S PG  V  +     + GA      +T +     F  L  D+  +I L  +L+ K  +  + +V + ++   +++ +   V ++ VG S   P+F + +  F  + E++  G+ V       R   + +V Y+I    P+ YF+++P TG L T    D E+     F+   I     +P  F    + V IAD NDN P     SS  + +   T     ++++ A D DSGPN +L++  I+      F +   SGE+ L+ S     V  Y+L V  +DSG    S +    +H Q+   +  +                 + F+ +  L+     + G+      + Y L     A  F + P +G +  + ++ RE       V+   ++  L  +    + R     I +++   N+N PRFS+    + + E+  A T F  V A D D G+  R+ Y L     D+   I+  TG++S  + L+   ++ Y L ++  D  G +  R       I V +   +  AF+ T    ++L    E  P G++LG +N   P    N  IFY L+   +    +N  TGELR++ PL        E   ++F    S R   + S+   + I  I   +  P  N + + + NS +  KP + + +  +     +T          Q  Y           +++D  +G+++L   +      R+ L++ V D       T ++ ++I++   + +    PE  +   + EN+  G+ +   +  +  KD S      ++S+      N +L  L   TG + +    ++D E+   + L  Q           + G     + V D +DN P+FS    V+ + E QP    ++ +  +D D G N +V Y I+  ++   F++ +N G +    PL+   +  Y+L I A     P       L++ ++++ND+ P         ++  N+P G+ I ++TA D D G +G+   + +  +T     +N   ++G I  +R L       +   +   D       + A + I V D+N++ P        + +  +L+   ++  L A D+D+ ++G++ +++ +  P    R  D ++ AL
Sbjct:  252 HAPVFNQSRYNAIISESLPQGSNILQVFASDADEGDNGLVLYEINRRQSDPDRYFVIDPRSGIITLNKALDYEMRKVHELVVQARD---NASHPEITNAFVTIHVRDYNDNQPTMTIIFLSEDGSPQISEGAQPGQYVARISVSDPDYGEYSNVNVSLE-----GGDGKFALTTKDSIIYLIYVDQILDREERDSYELRVMATDSG-TPPLHAESSFTIHVTDVNDNPPLFDQQAYKQTIPEVVYPGSFVLQVTARDKDQGPNGDIRYSILPDKKTHS-SWFTIDPV---TGIITTATKLDYETIPKP-SIKVVATDGGRPPLSSTAVVEIDLQDTNDNEP--VFGSSFYNVSIKENTSEGTCFLEVKADDADGGSFGTITYSIGSGSVSAPLSQFSINKESGQICTSTALDRDEGADSFHFTVTATDGGGLSSSASVLVSLEDINDNRPSFYPLNYAVS--LSTQSSPGTSVIRVTAHDPDAGANGRVTYHTVSGGGSSFFTLNKDTG-VISLSRSLHGK-ANSVIPMVISARDGGGLTAPVNARVNISVVGGSVAPPVFEQ-AQYFFTVSEDVLRGTEVGVVRASSRNGVSKDVTYTISAGDPDGYFMVDPETGALRTSLPLDHESR---PFFDLEIQARSGSPPAFGDTRVRVTIADVNDNAPIFFPSSSESLLLPEATKMGTIVYRVQAEDRDSGPNGQLSFDLISSGGQRTFGVERSSGEVRLIGSLSYDSVPRYDLQVIAKDSGAPQLSATFSLVVHIQAENNQGPVFDTITYRVELKENTPLNTNFLQVRALNRDPNGNGGSSTPTSTLAYRLRPDGDAVGFGIAPDSGWLFVKSALDRE-------VKDIYLLTVLATSGSGQMGRTGSATIRVSVTDENDNAPRFSQERVFLAVRENLPAGTGFGRVSATDRDAGLNSRLTYRLL--HTDRYFQINSQTGEISTRAALDREHQSSYQLMVVVQD--GGTPPRSATGTAHITVLDENDNAPAFSHTQPGREILIQVQEGLPAGSLLGTLNAKDPDEGENGTIFYSLSGSRAERFSLNPNTGELRSSSPLRR-----AEKAEYSFTITASDRGAPSQSSSAVLLIQVIGSTRISPKPNTLSMTL-NSVEGAKPGSVIGSVRAHDQREVTLN-------GQVTYLVVGGTDHEGTFMVDRLTGDVYLARELDYEKGSRYTLQIEVDDFSKAYPNTHMIQLEINVQDSNDHAPQFPEDPVTIVIPENTQAGSSVYTFQATD--KDGSGPNSEIRYSVQQRWPDNPDLFNLDPVTGVLKL--GRELDHEETSSLFLVVQAMDSALDPNQRLWGSVTARVFVTDENDNAPIFSSPTAVSVM-EDQPVGFVLLYVMAWDADQGENGRVSYRIQSGNTAGRFVLSSNSGSLSILKPLDREEQESYNLTIVAEDHGIPQHSTTQVLSIQVIDVNDEAPWFERNEFEAQIRENQPAGTSIIQVTASDRDHGTNGL---VTYGGVTEDGFTINA--ETGVISATRVLDRELQDHYTITVYAKDGGIPPNFAKAKVHITVLDENDNAPAFGLQQYSLEVPENLQP-VELFTLKATDRDIGESGRLEYKIKAGDPDGDFR-LDGSSGAL 1806          

HSP 5 Score: 163.696 bits (413), Expect = 3.509e-39
Identity = 107/349 (30.66%), Postives = 178/349 (51.00%), Query Frame = 2
Query:  110 NLLIFSIKENVPIGEVVGQIES---PGFSPPFEMHDFQEKKFI-----ISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSD-FFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNS--PPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYD 1123
             +L   + E  P G +VG I +   PG +         E   I     I +TTG+IK +  +DRE+++ YSF+ ++M G T  V I + D+ND+ P F        IPE   +G+K  L    D D+ + ++Q  +I  G+  +VF ++   ++N + Y+ L++   LD E  S ++LV++A DGG P     + + I+VQ+ ND+ P F+ SRY A I E        L+V A+D D G +G + Y ++      D +F +D ++G + L K+LD+E  K H + +  RDN+  P    + V + +   + N    +I  L   G  +I+    P   VA + ++D D
Sbjct:   47 GILELQLDEEQPAGTIVGDISAGLQPGVTASLYFISDHEGTGIGSDLHIDETTGIIKTARRLDREERDHYSFIAVTMTGFTVKVSITVNDINDHAPTFPKKKASLKIPEQTAVGTKFSLEPATDADKDQLTVQGYQIKEGNVGQVFRLETKRAANKVLYLDLVVNGVLDREKRSSYSLVVEAFDGGSPRQNGQMTLDILVQDINDHAPVFNQSRYNAIISESLPQGSNILQVFASDADEGDNGLVLYEINRRQSDPDRYFVIDPRSGIITLNKALDYEMRKVHELVVQARDNASHPEITNAFVTIHVRDYNDNQPTMTIIFLSEDGSPQISEGAQPGQYVARISVSDPD 395          

HSP 6 Score: 140.198 bits (352), Expect = 4.648e-32
Identity = 271/1216 (22.29%), Postives = 492/1216 (40.46%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLIISMNG---------DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNS--PPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYD-AISTSFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEIDSTILNENQHVTFV------KTTKRLPTKPIFIFKIFVLNNLFKINETTGEILSKRSIDCGK---YFFNVSMLSLKTNSLIDQT-KLEIVVKSGRKLPLYFDRGFRKILVTTGK---SQCFSEIAVRNRHCGMRIQYSYDLLLKTDGILRINEHGALCTAENVKHNKLMSTRYLYQIKALDE----TNSSAVCVVLFAIQPSKVFDVLPTEINITLPI-IDSPKFNFSLPIGKIIGTFSKLPPAQFIGFIQYHLVPEELSTGAITVDSQSGEILMKKFPIHKNP-IRLIVKSVIRKPFNVSPLNIV--AINFQKLFFARSLYQFILTKSEIKGNLVKIGQV---SMDSSCTESVSYDLFGVKNDHSHFTIDVATGVIYGK---DLGSISNKTLMFQVSAK-APKSQTSFAQVIIYIEDGIHQPGFDFSDLLVNIWENTTVGIEIMQV----FPKYPSVSDEYQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNV-FYIHQTAVYGTEVGTL-LXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSY-------FEPL---NVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLI 3703
            F +   TGV+K+   +D E+ +    ++ +M+           +   ++ + D NDN P F++     S+ E+ P+G  +     +D D+G+N   S RI SG++   F +  +  S       L + + LD E    +NL I A D G P    + ++ I V + ND  P F+ + + A I+E+Q    + ++V A+D D G +G + Y       + D FT++ +TG +   + LD E    + I++  +D    P F  +KV + +   + N     +Q        E+  ++ P  +   +K TD D   S   + +I    P    ++      L     +   + +S +L +   D+  PSL++T ++ I + +       FS S + V++     +E+  +  V                I  F        F ++  TG I +   +D  K   YFF V  + L   +  + T ++ + +        +F +    I V++G     Q  + +   ++  G      Y   +   G    +  GA+ T EN++   L  T+    ++A+D+     +S  V ++    Q  K      T  +++L    D              GT   +  + F G  +YH      +TG I V S +G            P +RL+VK+      +   +N++   +N  +  F   L  ++    E +G    I QV    +D      V+Y +    N    F ID  TG I      D    +   L+ + + + +PK   +    +I ++   + P        V + EN+ +G EI  V        P +S   Q+  S    +  I    G++ L    D E+ ++  +T++  +    +  +L + + D+NDN P         T  + S  G     +  +D DS  NG +SYR+         + F ++P  G L I          PS  I   VI + +G   PL +   + V+++D N+++PI         + +  + G  + TL  +  +   EN   + ++   +    F IE   +    I     +T+ +        FE L   N+ +  +DRG P +SS +  +I   + N NPP  V  +    +       +G+EI  V A DPD    +   YSI    D+    ++D WTG +
Sbjct: 1484 FNLDPVTGVLKLGRELDHEETSSLFLVVQAMDSALDPNQRLWGSVTARVFVTDENDNAPIFSSPT-AVSVMEDQPVGFVLLYVMAWDADQGENGRVSYRIQSGNTAGRFVLSSNSGS-------LSILKPLDREEQESYNLTIVAEDHGIPQHSTTQVLSIQVIDVNDEAPWFERNEFEAQIRENQPAGTSIIQVTASDRDHGTNGLVTY----GGVTEDGFTINAETGVISATRVLDRELQDHYTITVYAKDGGIPPNFAKAKVHITVLDENDNAPAFGLQQYSL----EVPENLQPVELFT-LKATDRDIGESGRLEYKIKAGDPDGDFRLDGSSGALSTSRPLDRERKSSYSLQVVVQDHGSPSLNSTASVEISVLDVNDNSPKFSSSSYTVDV-----SEDAAIGLVVLDATATDVDEGQNGQILYFLSQEAKGAFTVDPNTGRITTAALLDREKRASYFFQVYAVDLSPAAPRNSTAQVTVTILDVNDNAPFFIQDPLIINVSSGSVFTHQVVATMRAEDKDFGANGSVFYRFAMPVRGFAINSLTGAIQTTENLQ--TLTQTQRTLIVEAMDQGSPPQSSLGVVIIYVKEQDYKGIRFSRTARDVSLQENADKGTVVAQAQAQHPDGTRDGINYSIFSGN-KYHSFSISSNTGEIWVQSSNG------LDFEDTPRLRLVVKAETTSSSSFMAVNLILQDVNDNRPRF--QLQNYVTYMHEAQGYDFPIIQVVAEDVDQGQNGQVTYTIES-SNQSGLFKIDPQTGSITTTAIMDREIWTQAKLVIKATDRGSPKLVGTATITVIIVDLNDNSPTIPVP-REVRVPENSLIGTEITLVTGNDVDSGPVLSYSLQLDASTQGKF-DIDRYNGRVSLTAPLDYEERTWYKLTIRASDSKHQSEANLTVVVEDVNDNVPTFTQDLYQVTLPEHSPPGSPVITVTATDRDSGENGKVSYRVL----SSTRDGFYVDPKNGTLFIRQKAKFDPEEPSVSI---VIEARDGGSPPLSSSATVQVQLMDVNDNAPIFHQLEYKATVSEDQLPGATILTLEAVDGDLSQENSGFDFAIASGNVGNAFQIESSVR---FIEGHGFQTVGTLILAERLDFEALSHYNLTVSVSDRGVPQRSSSVPAIITVTDVNDNPP--VFGRAEYIVALSEGAAAGAEILRVTATDPDSAPYAEVQYSISSG-DDMKLFSVDQWTGAM 2650          

HSP 7 Score: 133.265 bits (334), Expect = 5.312e-30
Identity = 417/1817 (22.95%), Postives = 709/1817 (39.02%), Query Frame = 2
Query:  221 KFIISKTTGVIKVSGLIDR-EKQNLYSFLIISMNGDTKNVQIKIL----DVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP-FHTSKXXXXXXXXXXXX----XXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDAIST---SFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEI-DSTILNENQHVTFVKTTKRLPT--------KPIFIFKIFVLNNL--FKINETTGEILSKRSIDCG-KYFFNVSMLSLKTNSLIDQT-----KLEIVVKSGRKLPLYFDRGFRKILVTTGKSQCFSEIAVRNRHCGMRIQYSYDLLLKTDGILRINEHGALCTAENVKHNKLMSTRYLYQIKALDETNSSA---VCVVLFAIQPSKVFDVLPTEINITLPIIDSPKFNFSLPIGKI-IGTFSKLPPAQFIGFIQYHLVPEELSTGAITVDSQSGEILMKKFPIHKNPIRLIVKSVIRKP------FNVSP-------------LNIVAINFQKLFFARSLYQFILTKSEIKGNLVKIGQVSM----DSSCTESVSYDLFGVKNDHSHFTIDVATGVIYGK---DLGSISNKTLMFQVS--AKAPKSQTSFAQVIIYIEDG-IHQPGFDFSDLLVNIWENTTVGIEI--MQVFPK---YPSVSDEYQIIQS--QYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQL--------KNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNVF--YIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPL-LSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQ--NVKIRIFVSDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNV-VFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGS---HVASFNIRRL-----KNLEVVYSIKQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQI-NPSSDGIFMINGDSGEIHLVSS--------PRVSAYELNVTVRDSGEVPKSVS-VVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDAS---IYDLQRIFINIDYGNENP----PRFSRSIFKVKLPEDEAITNFLTVV-ANDPDLGIFGRIIYSLEGDTFDKKIF-IDPSTGKLS-CSPLNFMEKNIYNLKIIATDSE 5335
            +F I+K +G I  S  +DR E  + + F + + +G   +    +L    D+NDN P F   N+  S+      G+ V   T  DPD G N   +   VSG     F +   +   G+    + L +SL  +  S   +VI A DGG      +  V I V   +   P F+ ++Y  ++ ED         VRA+  + GVS ++ Y +    P   +F VD +TG +     LD E      + I  R  SPP F  ++V V I  ++ N        S  +L    L E  +     TIV  V+  D D+      SFDL  ++    +   +     E++LI  +        +L + A D   P LS T +L + I         F    ++VE+ ++T LN N     V+   R P              +++    +   F I   +G +  K ++D   K  + +++L+   +  + +T     ++ +  ++        +R F  +         F  ++  +R  G+  + +Y  LL TD   +IN      T E       +STR      ALD  + S+   + VV     P +        I +     ++P F+ + P  +I I     LP    +G +     P+E   G I   S SG    ++F ++ N   L   S +R+       F ++              L I  I   ++    +     L   E       IG V      + +    V+Y + G  +    F +D  TG +Y     D    S  TL  +V   +KA    T   Q+ I ++D   H P F    + + I ENT  G  +   Q   K    P+    Y + Q      D  ++   TG + L ++ D E+ S L + VQ         + L GS T    + + D NDN P   +       ED   +G +   +   DAD   NG +SYR++     G    F ++  +G L I+  L+          NL ++  D+G  +   T+V +S+++ID N+ +P     N F   I +    GT   +++       ++G   +          F I   +      RV   E  + Y     + + A D G P   +   + I  ++ N N P   +    +Q     P  L   E+FT+ A D D G +    Y I+ A D +    +D  +G ++T   L   +  +  +++ V D G P + S+    +  L    +     + + T  + + +  G VV D      + G     +   +    G   +  ++ ++         K   Y   V   +       +S   + V +  V  + P F +D P  +    N+ SGS   H     +R        N  V Y    P + F IN +TG + T       T+ Q    VE +    S P+  + L +++    E D +    S ++  V +     +   + Q  A   D G    + Y I + +    F I+ ++GEI + SS        PR     L + V+   E   S S +  ++  Q +   ++ RF   +    +   Q    F I Q+         N  + Y + +   + +F +DP TGS+ T   + RE        Q  +VI++    S   +       I +D  + +P    PR      +V++PE+  I   +T+V  ND D G    + YSL+ D   +  F ID   G++S  +PL++ E+  Y L I A+DS+
Sbjct:  630 QFSINKESGQICTSTALDRDEGADSFHFTVTATDGGGLSSSASVLVSLEDINDNRPSFYPLNYAVSLSTQSSPGTSVIRVTAHDPDAGANGRVTYHTVSGGGSSFFTL---NKDTGV----ISLSRSLHGKANSVIPMVISARDGGGLTAPVNARVNISVVGGSVAPPVFEQAQYFFTVSEDVLRGTEVGVVRASSRN-GVSKDVTYTISAGDPDG-YFMVDPETGALRTSLPLDHESRPFFDLEIQARSGSPPAFGDTRVRVTIADVNDNAPIFFPSSSESLL----LPEATK---MGTIVYRVQAEDRDSGPNGQLSFDL--ISSGGQRTFGVERSSGEVRLIGSLSYDSVPRYDLQVIAKDSGAPQLSATFSLVVHIQAENNQGPVFDTITYRVELKENTPLNTN--FLQVRALNRDPNGNGGSSTPTSTLAYRLRPDGDAVGFGIAPDSGWLFVKSALDREVKDIYLLTVLATSGSGQMGRTGSATIRVSVTDENDNAPRFSQERVFLAVRENLPAGTGFGRVSATDRDAGLNSRLTY-RLLHTDRYFQINSQ----TGE-------ISTR-----AALDREHQSSYQLMVVVQDGGTPPRSA-TGTAHITVLDENDNAPAFSHTQPGREILIQVQEGLPAGSLLGTLNAK-DPDEGENGTIFY-SLSGS-RAERFSLNPNTGELRSSSPLRRAEKAEYSFTITASDRGAPSQSSSAVLLIQVIGSTRISPKPNTLSMTLNSVEGAKPGSVIGSVRAHDQREVTLNGQVTYLVVGGTDHEGTFMVDRLTGDVYLARELDYEKGSRYTLQIEVDDFSKA-YPNTHMIQLEINVQDSNDHAPQFPEDPVTIVIPENTQAGSSVYTFQATDKDGSGPNSEIRYSVQQRWPDNPDLFNLDPVTGVLKLGRELDHEETSSLFLVVQAMDSALDPNQRLWGSVT--ARVFVTDENDNAPIFSSPTAVSVMED-QPVGFVLLYVMAWDADQGENGRVSYRIQSGNTAGR---FVLSSNSGSLSILKPLDREEQES---YNLTIVAEDHGIPQHSTTQV-LSIQVIDVNDEAP-WFERNEFEAQIRENQPAGT---SIIQVTASDRDHGTNGLVTYGGVTEDGFTINAETGVISATRVLDRELQDHY----TITVYAKDGGIPPNFAKAKVHITVLDENDNAPAFGL----QQYSLEVPENLQPVELFTLKATDRDIGESGRLEYKIK-AGDPDGDFRLDGSSGALSTSRPLDRERKSSYSLQVVVQDHGSPSLNSTASVEISVLDVNDNSPKFSSSSYTVDVSEDAAIGLVVLDATATDVDEGQNGQILYFLSQEAKGAFTVDPNTGRITTAALLDREKRASYFFQVYAVDLSPAAPRNSTAQVTVTILDVNDNAPFFIQD-PLII----NVSSGSVFTHQVVATMRAEDKDFGANGSVFYRFAMPVRGFAINSLTGAIQTTENLQTLTQTQRTLIVEAM-DQGSPPQ--SSLGVVIIYVKEQDYKGIRFSRTARDVSLQENADKGTVVAQAQAQHPD-GTRDGINYSIFSGNKYHSFSISSNTGEIWVQSSNGLDFEDTPR-----LRLVVK--AETTSSSSFMAVNLILQDVN-DNRPRFQLQNYVTYMHEAQGYD-FPIIQVVAEDVDQGQNGQVTYTIESSNQSGLFKIDPQTGSITTTAIMDRE-----IWTQAKLVIKATDRGSPKLVGTATITVIIVDLNDNSPTIPVPR------EVRVPENSLIGTEITLVTGNDVDSGPV--LSYSLQLDASTQGKFDIDRYNGRVSLTAPLDYEERTWYKLTIRASDSK 2350          

HSP 8 Score: 121.324 bits (303), Expect = 2.143e-26
Identity = 93/291 (31.96%), Postives = 137/291 (47.08%), Query Frame = 2
Query:  128 IKENVPIGEVVGQIESP----GFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGD------TKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTV--FDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSP 964
            I+EN P G  + Q+ +     G +         E  F I+  TGVI  + ++DRE Q+ Y+  + + +G          V I +LD NDN P F    +   +PEN      V+L T+   D D G++     +I +GD +  F +D    S+G     L   + LD E  S ++L +   D G P L ++  V+I V + NDN PKF  S Y   + ED  I +  L   ATD D G +G++ YFL   +  +  FTVD  TG +     LD EK  S+   +   D SP
Sbjct: 1657 IRENQPAGTSIIQVTASDRDHGTNGLVTYGGVTEDGFTINAETGVISATRVLDRELQDHYTITVYAKDGGIPPNFAKAKVHITVLDENDNAPAFGLQQYSLEVPENL---QPVELFTLKATDRDIGESGRLEYKIKAGDPDGDFRLD---GSSGA----LSTSRPLDRERKSSYSLQVVVQDHGSPSLNSTASVEISVLDVNDNSPKFSSSSYTVDVSEDAAIGLVVLDATATDVDEGQNGQILYFLSQEAKGA--FTVDPNTGRITTAALLDREKRASYFFQVYAVDLSP 1935          

HSP 9 Score: 102.449 bits (254), Expect = 1.046e-20
Identity = 77/249 (30.92%), Postives = 123/249 (49.40%), Query Frame = 2
Query:  248 VIKVSGLIDREKQNLYSFLIISMNGDT------KNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDS--EKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDF--FTVDHKTGNVYLRKSLDF-EKSKSHHISIGVRDNS 961
            +I V  ++DRE+++ Y   +++ +  T       +  I + DVNDN P F+   ++++IPE    GS V   T  D D+G N      I+         F ID      GI    +     LDYE I + ++ + A DGG PPL ++ +V+I +Q+ NDN P F  S Y  SIKE+      FL V+A D D G  G + Y + + S S+    F+++ ++G +    +LD  E + S H ++   D  
Sbjct:  424 LIYVDQILDREERDSYELRVMATDSGTPPLHAESSFTIHVTDVNDNPPLFDQQAYKQTIPEVVYPGSFVLQVTARDKDQGPNGDIRYSILPDKKTHSSWFTID---PVTGI----ITTATKLDYETIPKPSIKVVATDGGRPPLSSTAVVEIDLQDTNDNEPVFGSSFYNVSIKENTSEGTCFLEVKADDADGGSFGTITYSIGSGSVSAPLSQFSINKESGQICTSTALDRDEGADSFHFTVTATDGG 665          

HSP 10 Score: 101.293 bits (251), Expect = 2.674e-20
Identity = 66/197 (33.50%), Postives = 102/197 (51.78%), Query Frame = 2
Query:  341 IKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGEL-FYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKS 928
            I + DVNDN P F    +  ++ E    G+++   T  DPD    +     I SGD  K+F++D    +       + L++ LD E  +   +++QA DG H    A   + + V++ NDN P F I+   ASI+E+Q +N     + A D D GV G+L +Y +D++SP  D F VD  +G V  ++  DFEK  S
Sbjct: 2581 ITVTDVNDNPPVFGRAEYIVALSEGAAAGAEILRVTATDPDSAPYAEVQYSISSGDDMKLFSVDQWTGA-------MKLQRPLDRESQNSHVVIVQASDG-HGRF-ALAPISVEVKDINDNRPYFPIATLTASIRENQPLNSAVTVLHAIDYDTGVYGQLKYYLMDHSSPGKDLFFVDQNSGEVRTKQIFDFEKVNS 2768          

HSP 11 Score: 93.9745 bits (232), Expect = 4.161e-18
Identity = 80/283 (28.27%), Postives = 130/283 (45.94%), Query Frame = 2
Query:  173 SPGFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTK---NVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVD-----------HKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTS 979
             P  S   ++    + KF I +  G + ++  +D E++  Y   I + +   +   N+ + + DVNDN P F    ++ ++PE+ P GS V   T  D D G+N   S R++S   +      Y D  NG  ++R   K   D E  S  ++VI+A DGG PPL +S  V++ + + NDN P F    Y A++ EDQ    T L + A D D       F F   +    + F ++              G + L + LDFE    +++++ V D   P  +S
Sbjct: 2300 GPVLSYSLQLDASTQGKFDIDRYNGRVSLTAPLDYEERTWYKLTIRASDSKHQSEANLTVVVEDVNDNVPTFTQDLYQVTLPEHSPPGSPVITVTATDRDSGENGKVSYRVLSSTRDGF----YVDPKNGTLFIRQ--KAKFDPEEPS-VSIVIEARDGGSPPLSSSATVQVQLMDVNDNAPIFHQLEYKATVSEDQLPGATILTLEAVDGDLSQENSGFDFAIASGNVGNAFQIESSVRFIEGHGFQTVGTLILAERLDFEALSHYNLTVSVSDRGVPQRSS 2575          

HSP 12 Score: 93.5893 bits (231), Expect = 4.799e-18
Identity = 67/220 (30.45%), Postives = 106/220 (48.18%), Query Frame = 2
Query:  326 TKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPD-EGKNSIQSVRIVSGDSEKVFAIDYHD---SSNGIFYV-RLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPF 970
            +  VQ++++DVNDN P F+   ++ ++ E+   G+ +      D D   +NS     I SG+    F I+        +G   V  LIL + LD+E +S +NL +   D G P   +S+   I V + NDN P F  + YI ++ E        LRV ATD D+    E+ Y + ++      F+VD  TG + L++ LD E   SH + +   D    F
Sbjct: 2459 SATVQVQLMDVNDNAPIFHQLEYKATVSEDQLPGATILTLEAVDGDLSQENSGFDFAIASGNVGNAFQIESSVRFIEGHGFQTVGTLILAERLDFEALSHYNLTVSVSDRGVPQRSSSVPAIITVTDVNDNPPVFGRAEYIVALSEGAAAGAEILRVTATDPDSAPYAEVQYSI-SSGDDMKLFSVDQWTGAMKLQRPLDRESQNSHVVIVQASDGHGRF 2677          

HSP 13 Score: 89.3521 bits (220), Expect = 1.059e-16
Identity = 77/262 (29.39%), Postives = 120/262 (45.80%), Query Frame = 2
Query:  215 EKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKN------VQIKILDVNDNEPK----FNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFY-FLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            ++ F+I   +G+I ++  +D E + ++  ++ + +  +        V I + D NDN+P     F + +    I E    G  V   +V DPD G+ S  +V +  GD +  FA+   DS   I Y+ + + Q LD E    + L + A D G PPL A     I V + NDN P FD   Y  +I E        L+V A D D G +G++ Y  L +    S +FT+D  TG +     LD+E      I +   D   P
Sbjct:  303 DRYFVIDPRSGIITLNKALDYEMRKVHELVVQARDNASHPEITNAFVTIHVRDYNDNQPTMTIIFLSEDGSPQISEGAQPGQYVARISVSDPDYGEYSNVNVSLEGGDGK--FALTTKDS---IIYL-IYVDQILDREERDSYELRVMATDSGTPPLHAESSFTIHVTDVNDNPPLFDQQAYKQTIPEVVYPGSFVLQVTARDKDQGPNGDIRYSILPDKKTHSSWFTIDPVTGIITTATKLDYETIPKPSIKVVATDGGRP 558          

HSP 14 Score: 88.5817 bits (218), Expect = 1.888e-16
Identity = 65/236 (27.54%), Postives = 112/236 (47.46%), Query Frame = 2
Query:  218 KKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTK----NVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYV-----RLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLR 898
            K F + + TG +K+   +DRE QN +  ++ + +G  +     + +++ D+NDN P F       SI EN P+ S V +    D D G         V G   K + +D+      +F+V      +  KQ  D+E ++ FN +  A+D G+    A++ V++ +   ++  P F  S     + E  +   +   V+A D D GV G + Y   N+SP   +F V+  TG +YL+
Sbjct: 2639 KLFSVDQWTGAMKLQRPLDRESQNSHVVIVQASDGHGRFALAPISVEVKDINDNRPYFPIATLTASIRENQPLNSAVTVLHAIDYDTG---------VYG-QLKYYLMDHSSPGKDLFFVDQNSGEVRTKQIFDFEKVNSFNFIALAVDAGNN--SATVTVQVFITGEDEYDPVFTTSDLSFEVPEGAKKGQSIGLVQAKDEDGGVDGIVLYSFPNSSP---YFDVNKTTGVIYLK 2859          

HSP 15 Score: 87.8113 bits (216), Expect = 2.799e-16
Identity = 211/937 (22.52%), Postives = 380/937 (40.55%), Query Frame = 2
Query: 5795 ATDSDKTSN--ITYQFDR--SDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISL-----NQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSI-IDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSE-IRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFI--EFYSSQEEFLID-ANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPD--GISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVV---DDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVS--TSPWFGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDS-DKAIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYI-----TLSLQVPEMIQKPAIISNLLQMDKNS---FRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESRIWNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEK---MIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHD-------------IQYFLTPHENFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLL-IKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIVENPSENFGINNETGAIYIK 8464
            A+D+D+  N  + Y+ +R  SDP      + +++D +SG + L  ++   M+  H L V   DN    + T   + I +     NQ    +  + E    ++ E +  G ++ +I + +      +  ++ ++G + +     + +    +     +DRE+ D   L    +  G+  +       IHV DV+DN P+F Q  +   + E   P + V+++T  D D G N  + Y I  +  +    F ID   G + T   L++ T     + + A+    P + +   + + + + ND  P       N+ +  N   G+   ++ A D+DG     I+Y I    ++      ++  +SG+I  S   L  D G   F   V   D    SS+A + + +ED N++ P        ++LS+    G+ ++ + A D D   NG+VT+  VS   S +F L   + +T  + L      K +     I +  +A D       + A   +     S  P +        T+ E +  G+++        +   K + Y I    P      +D E+G L  +  L++  +P F L +  A  GSP       + V I   N      DN  I     + SL +PE  +   I+  +   D++S    + S+ LIS   ++        +F ++ S+    + G L    +    + ++   K   +P  L     L V+I+       +   +   VE+K       EN P  T  L++     D             + Y L P  +  +    +  SG  +  KS LD E  + Y L +L   GS    R+ S TI V  SV D ++  P F  +     V   +P  G       A+D+D G    ++Y+++      F IN++TG I  +
Sbjct:  280 ASDADEGDNGLVLYEINRRQSDPD-----RYFVIDPRSGIITLNKALDYEMRKVHELVVQARDNASHPEITNAFVTIHVRDYNDNQPTMTIIFLSEDGSPQISEGAQPGQYVARISVSDPDYGEYSNVNVSLEGGDGKFALTTKDSIIYLIYVDQILDREERDSYELRVMATDSGTPPLHAESSFTIHVTDVNDNPPLFDQQAYKQTIPEVVYPGSFVLQVTARDKDQGPNGDIRYSILPDKKTHSSWFTIDPVTGIITTATKLDYETIPKPSIKVVATDGGRPPLSSTAVVEIDLQDTNDNEPVFGSSFYNVSIKENTSEGTCFLEVKADDADGGSFGTITYSIGSGSVSAPLSQFSINKESGQICTS-TALDRDEGADSFHFTVTATDGGGLSSSASVLVSLEDINDNRPSFYPLNYAVSLSTQSSPGTSVIRVTAHDPDAGANGRVTYHTVSGGGSSFFTL---NKDTGVISLSRSLHGKANSV---IPMVISARDGGGLTAPVNARVNISVVGGSVAPPVFEQAQYFFTVSEDVLRGTEVGVVRASSRNGVSKDVTYTISAGDP-DGYFMVDPETGALRTSLPLDHESRPFFDLEIQ-ARSGSPPAFGDTRVRVTIADVN------DNAPIFFPSSSESLLLPEATKMGTIVYRVQAEDRDSGPNGQLSFDLISSGGQR--------TFGVERSSGEVRLIGSLSYDSVPRYDLQVIA--KDSGAP-QLSATFSLVVHIQAENNQGPVFDTITYRVELK-------ENTPLNTNFLQVRALNRDPNGNGGSSTPTSTLAYRLRPDGD-AVGFGIAPDSGW-LFVKSALDREVKDIYLLTVLATSGSGQMGRTGSATIRV--SVTDENDNAPRFSQERVFLAVRENLPA-GTGFGRVSATDRDAGLNSRLTYRLLHT-DRYFQINSQTGEISTR 1172          

HSP 16 Score: 85.5001 bits (210), Expect = 1.343e-15
Identity = 78/269 (29.00%), Postives = 128/269 (47.58%), Query Frame = 2
Query:  212 QEKKFIISKTTGVIKVSGLIDREKQNLYSFLI-------ISMNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPD-EGKNS--IQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPP---LQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTS 979
             E  F++ + TG + ++  +D EK + Y+  I          N     ++I + D ND+ P+F        IPEN   GS V      D D  G NS    SV+    D+  +F +   D   G+    L L + LD+E  S   LV+QA+D    P   L  S+  ++ V + NDN P F  S    S+ EDQ +    L V A D D G +G + Y + + + ++  F +   +G++ + K LD E+ +S++++I   D+  P H++
Sbjct: 1371 HEGTFMVDRLTGDVYLARELDYEKGSRYTLQIEVDDFSKAYPNTHMIQLEINVQDSNDHAPQFPEDPVTIVIPENTQAGSSVYTFQATDKDGSGPNSEIRYSVQQRWPDNPDLFNL---DPVTGV----LKLGRELDHEETSSLFLVVQAMDSALDPNQRLWGSVTARVFVTDENDNAPIFS-SPTAVSVMEDQPVGFVLLYVMAWDADQGENGRVSYRIQSGN-TAGRFVLSSNSGSLSILKPLDREEQESYNLTIVAEDHGIPQHST 1630          

HSP 17 Score: 83.5741 bits (205), Expect = 5.630e-15
Identity = 76/296 (25.68%), Postives = 129/296 (43.58%), Query Frame = 2
Query:  116 LIFSIKENVPIGEVVGQIES----PGFSPPFEMHDFQ-EKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDT------KNVQIKILDVNDNEPKFNATNFEKSI----PENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDN-DAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD 955
            +  +++EN+P G   G++ +     G +          ++ F I+  TG I     +DRE Q+ Y  +++  +G T          I +LD NDN P F+ T   + I     E  P GS +      DPDEG+N      + SG   + F+++    + G       L+++   E    ++  I A D G P   +S ++ I V  +    PK +      +  E  +       VRA D  +  ++G++ Y +   +     F VD  TG+VYL + LD+EK   + + I V D
Sbjct: 1119 VFLAVRENLPAGTGFGRVSATDRDAGLNSRLTYRLLHTDRYFQINSQTGEISTRAALDREHQSSYQLMVVVQDGGTPPRSATGTAHITVLDENDNAPAFSHTQPGREILIQVQEGLPAGSLLGTLNAKDPDEGENGTIFYSL-SGSRAERFSLN---PNTGELRSSSPLRRAEKAE----YSFTITASDRGAPSQSSSAVLLIQVIGSTRISPKPNTLSMTLNSVEGAKPGSVIGSVRAHDQREVTLNGQVTYLVVGGTDHEGTFMVDRLTGDVYLARELDYEKGSRYTLQIEVDD 1406          

HSP 18 Score: 78.5666 bits (192), Expect = 2.019e-13
Identity = 85/386 (22.02%), Postives = 162/386 (41.97%), Query Frame = 2
Query:  215 EKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKNVQ------IKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGI---FYVR-----LILKQSLDYEIISQFNLVIQAIDG-GHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQILWTGG--LSEINRDISPNTIVAHVKLTDYDAISTSFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKI 1321
            ++ F + +++G +++ G +  +    Y   +I+ +     +       + I   N+  P F+   +   + EN P+ +        + D   N         G S     + Y    +G    F +      L +K +LD E+   + L + A  G G      S  +++ V + NDN P+F   R   +++E+      F RV ATD DAG++  L Y L +T     +F ++ +TG +  R +LD E   S+ + + V+D   P  ++     I V+D NDN P+      G   L ++   +   +++  +   D D          L+ S  +   + P   EL+  + +   +    + T+ A D   PS S++  L I++
Sbjct:  941 QRTFGVERSSGEVRLIGSLSYDSVPRYDLQVIAKDSGAPQLSATFSLVVHIQAENNQGPVFDTITYRVELKENTPLNTNFLQVRALNRDPNGNG--------GSSTPTSTLAYRLRPDGDAVGFGIAPDSGWLFVKSALDREVKDIYLLTVLATSGSGQMGRTGSATIRVSVTDENDNAPRFSQERVFLAVRENLPAGTGFGRVSATDRDAGLNSRLTYRLLHT---DRYFQINSQTGEISTRAALDREHQSSYQLMVVVQDGGTPPRSATGTAHITVLDENDNAPAFSHTQPGREILIQVQEGLPAGSLLGTLNAKDPDEGENGTIFYSLSGSRAERFSLNPNTGELRSSSPLRRAEKAEYSFTITASDRGAPSQSSSAVLLIQV 1315          

HSP 19 Score: 72.0182 bits (175), Expect = 1.963e-11
Identity = 77/289 (26.64%), Postives = 121/289 (41.87%), Query Frame = 2
Query:  125 SIKENVPIGEVVGQIESP---GFSPPFEMHDFQEKK---FIISKTTGVIKV--SGLIDREKQNLYSFLIISMNGDTKN---VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDN 958
            S++EN   G VV Q ++    G         F   K   F IS  TG I V  S  +D E       ++ +    + +   V + + DVNDN P+F   N+   + E       +      D D+G+N   +  I S +   +F ID    S       +     +D EI +Q  LVI+A D G P L  +  + +I+ + NDN P   + R +  + E+  I      V   D D+G    L Y L   + +   F +D   G V L   LD+E+   + ++I   D+
Sbjct: 2071 SLQENADKGTVVAQAQAQHPDGTRDGINYSIFSGNKYHSFSISSNTGEIWVQSSNGLDFEDTPRLRLVVKAETTSSSSFMAVNLILQDVNDNRPRFQLQNYVTYMHEAQGYDFPIIQVVAEDVDQGQNGQVTYTIESSNQSGLFKIDPQTGS-------ITTTAIMDREIWTQAKLVIKATDRGSPKLVGTATITVIIVDLNDNSPTIPVPREV-RVPENSLIGTEITLVTGNDVDSGPV--LSYSLQLDASTQGKFDIDRYNGRVSLTAPLDYEERTWYKLTIRASDS 2349          
BLAST of Dachsous vs. Ensembl Zebrafish
Match: BX530069.1 (dachsous cadherin-related 1b [Source:NCBI gene;Acc:553300])

HSP 1 Score: 271.166 bits (692), Expect = 7.737e-72
Identity = 442/1903 (23.23%), Postives = 804/1903 (42.25%), Query Frame = 2
Query: 2948 SFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLET-EVEISVRIIDANNHSPILISTNVFY-IHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCP--LLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVK--IRIFVSDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPE---NYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNV-VFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLK----NLEVVYSIKQ--PEK--YFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVS-NPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPS-SDGIFMINGDSGEIHLV---SSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCS-PLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVL--GRINIVKPPVNSEIFYVLN-PGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQ-PQKPLTKLSATDSDKTSN--ITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISL-NQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSA-KFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGF--DNNTAALFLID----EPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTE--ITIPESLKSGSKITKF--VCKDLDSDKAIFYKIDNFHPISNNLYLDFE---------------SGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESRIWNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEP--PKTTVLKLPEW----YHDIQYFLTPHENFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIVENPSENFGINNETGAIYIK 8464
            S P   L+YR++   P G    F I P +G L + S+L+    +    I LL +++ +G  +   T    I V + D N+++P      VF  + +    GT  G +   D D G N  +   L   H  + F I   +           E  +SY     +M++  D G+P +S+     I  ++ N N P     +  ++++      L +GS + T+NA DPD+G N    YS  L+    ++ +++  TG + +   L  A+  +    I  SD G P  +SS   L++ +   +        ++T    + ++PG V+G +    +       +  ++    T  +G   +   +  + L ++    K   Y+L + V +    +  +  + + + V       P F +D P  + I EN  +GS V +F          N E+ YS++Q  P+    F ++PVTG L   R  D E  + +   V+ + + +  N +++  +   V + DENDN P   SP++  V    P      +  ++A DAD G N +++Y+I    + G F+++ +SG + ++         +Y L +   D G    S + V SI  Q I    +  +   +           +G  I Q++ S      N  + Y    G     F+++  TG +     + RE     +   I V  +       +   ++ I +   N+N P F    + +++PE+       T+ A D D+G  GR+ Y ++    D    +D S+G LS S PL+   K+ Y+L+++  D    S        V I V +   ++  F+++ +++ V E++  G V+       V    N +I Y L+        ++  TG + T   L  E  +        +A  +S  + + ++A + V I+D+NDN P   ++P+ I + + +    + +  + A D D  +N  + Y+F           + + ++  +G +    ++ +  + +  L V   D G P + +  ++ I +  QD++ ++         ++EN+  GT + Q +  +         +SI  G  +    +  +TG+I+V ++  +D E   ++ L  +     S    +  V + + DV+DN+P F    +V +++E Q    P+I++   D D G N QV Y IE  +    F ID   G + T   ++    +   LVIKA+ + SP +     +TV IV++ND  P I +P R +++  N  +G+ IT +T  D D    +SY ++    T Q  F ++   +G + L+  L   +   ++  I   D++  S A + + VED N++VP   ++   + L      GS ++ + A D+D  +NGKV++ ++S++      GF  D     LF+      +P+E      + I+  D    P   L S   + V L       P     H  E   T+ E    G+ I     V  DL  + + F    +F   S N+   F+                G L L + L++     + L V+ +  G P++ +S    + +   N  P +       ++L   E     A I  +   D +S  Y+    S++        D   F +D       +   L +    N  ++IV+A              +    I V  K I + R    I  LT  I EN+P     TVL   ++    Y  ++Y+L  H +          +   +++K + DFE   ++    L   +     + S T+ V++ +   DEY P F     +  V  G  K GQ +    A D+D G  GIV Y    N S  F +N  TG IY+K
Sbjct:  450 STPTSTLAYRLR---PDGDAVGFGIAPDSGWLFVKSALDREVKD----IYLLTVLATSGSGQMGRTGSATIRVSVTDENDNAPRFSQERVFLAVRENLPAGTGFGRVSATDRDAGLNSRLTYRLL--HTDRYFQINSQTGEISTRAALDREHQSSY----QLMVVVQDGGTPPRSATGTAHITVLDENDNAPAFSHTQPGREILIQVQEGLPAGSLLGTLNAKDPDEGENGTIFYS--LSGSRAERFSLNPNTGELRSSSPLRRAEKAEYSFTITASDRGAPSQSSSAVLLIQVIGSTRISPKPNTLSMTLNSVEGAKPGSVIGSVRAHDQREVTLNGQVTYLVVGGTDHEGTFMVDRLTGDVYLARELDYEKGSRYTLQIEVDDFSKAYPNTHMIQLEINVQDSNDHAPQFPED-PVTIVIPENTQAGSSVYTFQATDKDGSGPNSEIRYSVQQRWPDNPDLFNLDPVTGVLKLGRELDHEETSSLFLVVQAMDSALDPNQRLWGSVTARVFVTDENDNAPIFSSPTAVSVMEDQPV--GFVLLYVMAWDADQGENGRVSYRIQSGNTAGRFVLSSNSGSLSILKPLDREEQESYNLTIVAEDHGIPQHSTTQVLSI--QVIDVNDEAPWFERNEFEAQIRENQPAGTSIIQVTASDRDHGTNGLVTY---GGVTEDGFTINAETGVISATRVLDREL---QDHYTITVYAKDGGIPPNFAKAKVHITVLDENDNAPAFGLQQYSLEVPENLQPVELFTLKATDRDIGESGRLEYKIKAGDPDGDFRLDGSSGALSTSRPLDRERKSSYSLQVVVQDHG--SPSLNSTASVEISVLDVNDNSPKFSSSSYTVDVSEDAAIGLVVLDATATDVDEGQNGQILYFLSQEAKGAFTVDPNTGRITTAALLDRE--KRASYFFQVYAVDLSPAAPRNSTAQVTVTILDVNDNAPFFIQDPLIINVSSGSVFTHQVVATMRAEDKDFGANGSVFYRF-------AMPVRGFAINSLTGAIQTTENLQTLTQTQRTLIVEAMDQGSPPQSSLGVVIIYVKEQDYKGIRFSRTARDVSLQENADKGTVVAQAQAQHPDGTRDGINYSIFSGNKYHSFSISSNTGEIWVQSSNGLDFEDTPRLRLVVKAETTSSS--SFMAVNLILQDVNDNRPRFQLQNYVTYMHEAQGYDFPIIQVVAEDVDQGQNGQVTYTIESSNQSGLFKIDPQTGSITTTAIMDREIWTQAKLVIKATDRGSPKLVGTATITVIIVDLNDNSPTIPVP-REVRVPENSLIGTEITLVTGNDVDSGPVLSYSLQLDAST-QGKF-DIDRYNGRVSLTAPLDYEERTWYKLTIRASDSKHQSEANLTVVVEDVNDNVPTFTQDLYQVTLPEHSPPGSPVITVTATDRDSGENGKVSYRVLSST----RDGFYVDPKNGTLFIRQKAKFDPEEPS--VSIVIEARDGGSPP---LSSSATVQVQLMDVNDNAPIF---HQLEYKATVSEDQLPGATILTLEAVDGDLSQENSGF----DFAIASGNVGNAFQIESSVRFIEGHGFQTVGTLILAERLDFEALSHYNLTVSVSDRGVPQRSSSVPAIITVTDVNDNPPVFGRAEYIVALS--EGAAAGAEILRVTATDPDSAPYAEVQYSISSGD-----DMKLFSVDQWTGAMKLQRPL-DRESQNSHVVIVQASDGHGR--------FALAPISVEVKDINDNRPYFPIATLTASIRENQPLNSAVTVLHAIDYDTGVYGQLKYYLMDHSSPGKDLFFVDQNSGEVRTKQIFDFEKVNSFNFIALAVDA----GNNSATVTVQVFITGEDEYDPVFTTSDLSFEVPEGAKK-GQSIGLVQAKDEDGGVDGIVLYSF-PNSSPYFDVNKTTGVIYLK 2272          

HSP 2 Score: 186.422 bits (472), Expect = 3.584e-46
Identity = 345/1448 (23.83%), Postives = 606/1448 (41.85%), Query Frame = 2
Query: 2927 LKCSDAD-SFPNGNLSYRMKIIKPVGMNNP--FEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNG--PFKPLETEVEISVRIIDANNHSPILISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSL--SCAQNVKIRIFVSDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKC-LFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHV---ASFNIRRLKNLEVVYSIKQPEK-YFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIF--QIVAT----DADSGPNSKLTYQINPSSDGIFMINGDSGEIHLVSSPRV---SAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAIT-NFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCSPLNFMEKNIYN---LKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRI---NIVKPPVNSEIFYVLNPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVI-VSDNGVPSKCTTVLIDISL---NQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVN--YCKDHSA-KFSIIDG-------VNHELVFLH----ESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYK-KVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEF-DIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWF 7117
             + +D D S PN  + Y ++   P   +NP  F ++P TG L +   L+   ++    + L+V   D+   P + L   V   V + D N+++PI  S     + +    G  +  ++  D D GENG +   ++  +    F +   S +  +++    E   SY    N+ ++A D G P  S+   L I  I+ N   P     +   Q+    P  +G+ I  V A D D G N +  Y        ED   I++ TG+I+    L      +  I ++  D G P   +     +  L E  +      +  +  +P++ QP  +   L     + G    L         DG   L   S  L   +     +   YSL VV       S++S   + + V  V  + P FS  S   +++ E+   G  V    + ++   +N +++Y + Q  K  F ++P TG++ T  + DRE      F V  +    + P+  T   + V I D NDN P+ +     I+ +S+      S+F  Q+VAT    D D G N  + Y+      G F IN  +G I    + +    +   L V   D G  P+S   V  I+ +    K  IRF   +  ++L     K G ++ Q + +Q        I Y + +G     FS+   TG +  Q S +  +  ++  +++ V  ++   +S   +  I  ++   N+N PRF    +   + E +      + VVA D D G  G++ Y++E         IDP TG ++ + +  M++ I+    L I ATD             VII   N    T+        ++V ENS  GT +  +   ++   PV S    +         I+   G +    PL  E   + +LTI A      + S   + A + V + D+NDN P   ++  ++ +P  + P  P+  ++ATD D   N    +     T    Y    +D K+G LF++       +      VI   D G P   ++  + + L   N +      +  KA   V E+ + G  I  ++ V+    +++S   F+I  G       +   + F+     ++ G + +A   ++D E +    L   VS  G   R      II V DV+DN PVF + +++  L+EG      ++R+T  DPD    ++V+Y I      + F +D   G +K   PL+  +++ + ++++AS     F  A   ++V + +IND RP   I      +  N+P+ S +T + A D D G  G + Y +       + LF  V  +SGE+   +      V    F  + VD    S+T  +++ +  ++ + P+   +     +    K+G  I  + A D+D   +G V +   ++SP+F
Sbjct:  868 FQATDKDGSGPNSEIRYSVQQRWP---DNPDLFNLDPVTGVLKLGRELDHEETSS---LFLVVQAMDSALDPNQRLWGSVTARVFVTDENDNAPIFSSPTAVSVMEDQPVGFVLLYVMAWDADQGENGRVSYRIQSGNTAGRFVLSSNSGSLSILKPLDREEQESY----NLTIVAEDHGIPQHSTTQVLSIQVIDVNDEAPWFERNEFEAQIRENQP--AGTSIIQVTASDRDHGTNGLVTYGGV----TEDGFTINAETGVISATRVLDRELQDHYTITVYAKDGGIPPNFAKAKVHITVLDENDNAPAFGLQQYSLEVPENLQPVELF-TLKATDRDIGESGRLEYKIKAGDPDGDFRLDGSSGALSTSRPLDRERKSSYSLQVVVQDHGSPSLNSTASVEISVLDVNDNSPKFSSSS-YTVDVSEDAAIGLVVLDATATDVDEGQNGQILYFLSQEAKGAFTVDPNTGRITTAALLDREKRASYFFQVYAVDLSPAAPRNSTAQ-VTVTILDVNDNAPFFIQ-DPLIINVSS-----GSVFTHQVVATMRAEDKDFGANGSVFYRFAMPVRG-FAINSLTGAIQTTENLQTLTQTQRTLIVEAMDQGSPPQSSLGVVIIYVKEQDYKG-IRFSRTARDVSLQENADK-GTVVAQ-AQAQHPDGTRDGINYSIFSGNKYHSFSISSNTGEIWVQSS-NGLDFEDTPRLRLVVKAETTSSSSFMAVNLILQDV---NDNRPRFQLQNYVTYMHEAQGYDFPIIQVVAEDVDQGQNGQVTYTIESSNQSGLFKIDPQTGSITTTAI--MDREIWTQAKLVIKATDRGSPKLVGTATITVIIVDLNDNSPTIPVPR---EVRVPENSLIGTEITLVTGNDVDSGPVLSYSLQLDASTQGKFDIDRYNGRVSLTAPLDYEERTWYKLTIRA------SDSKHQSEANLTVVVEDVNDNVPTFTQDLYQVTLPEHSPPGSPVITVTATDRDSGENGKVSYRVLSSTRDGFY----VDPKNGTLFIRQKAKFDPEEPSVSIVIEARDGGSPPLSSSATVQVQLMDVNDNAPIFHQLEYKAT--VSEDQLPGATILTLEAVDGDLSQENSGFDFAIASGNVGNAFQIESSVRFIEGHGFQTVGTLILAE--RLDFEALSHYNLTVSVSDRGVPQRSSSVPAIITVTDVNDNPPVFGRAEYIVALSEGAAAGAEILRVTATDPDSAPYAEVQYSISSGDDMKLFSVDQWTGAMKLQRPLDRESQNSHVVIVQASDGHGRFALAP--ISVEVKDINDNRPYFPIATLTASIRENQPLNSAVTVLHAIDYDTGVYGQLKYYLMDHSSPGKDLFF-VDQNSGEVRTKQIFDFEKVNSFNFIALAVDAGNNSATVTVQVFITGEDEYDPVFTTSDLSFEVPEGAKKGQSIGLVQAKDEDGGVDGIVLYSFPNSSPYF 2260          

HSP 3 Score: 164.081 bits (414), Expect = 2.123e-39
Identity = 245/1083 (22.62%), Postives = 454/1083 (41.92%), Query Frame = 2
Query: 4100 NLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNI--RRLKNLEVVYSIK--QPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQ-INPSSDGIFMINGDSGEIHLVSS---PRVSAYELNVTVRDSGEVPKSVSVVFSIHFQS----------------IKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQR-----IFINIDYGNENPPRFSRSIFKVKLPED-EAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSC-SPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVL----ENSPGGTVLGRINIVKP--PVNSEIFYVLNPGHS-HIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLY---------KMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVL-IDISLNQDHQYVQIVPEKAI-FRVKENSVDGTFIGQIKMVNYCKDHSA-----KFSIIDGV--NHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGG----SEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFS---STAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAAL 7153
            N  +N+ V     + P+F + +  F  + E++  G+ V       R   + +V Y+I    P+ YF+++P TG L T    D E+     F+   I     +P  F    + V IAD NDN P     SS  + +   T     ++++ A D DSGPN +L++  I+      F +   SGE+ L+ S     V  Y+L V  +DSG    S +    +H Q+                +K  + +      +      P    G           SS+    + Y L     A  F + P +G +  + ++ RE       V+   ++  L  +    + R     I +++   N+N PRFS+    + + E+  A T F  V A D D G+  R+ Y L     D+   I+  TG++S  + L+   ++ Y L ++  D  G +  R       I V +   +  AF+ T    ++L    E  P G++LG +N   P    N  IFY L+   +    +N  TGELR++ PL        E   ++F    S R   + S+   + I  I   +  P  N + + + NS +  KP + + +  +     +T          Q  Y           +++D  +G+++L   +      R+ L++ V D       T ++ ++I++   + +    PE  +   + EN+  G+ +   +  +  KD S      ++S+      N +L  L   TG + +    ++D E+   + L  Q           + G     + V D +DN P+FS    V+ + E QP    ++ +  +D D G N +V Y I+  ++   F++ +N G +    PL+   +  Y+L I A     P       L++ ++++ND+ P         ++  N+P G+ I ++TA D D G +G+   + +  +T     +N   ++G I  +R L       +   +   D       + A + I V D+N++ P        + +  +L+   ++  L A D+D+ ++G++ +++ +  P    R  D ++ AL
Sbjct:  188 NARVNISVVGGSVAPPVFEQ-AQYFFTVSEDVLRGTEVGVVRASSRNGVSKDVTYTISAGDPDGYFMVDPETGALRTSLPLDHESR---PFFDLEIQARSGSPPAFGDTRVRVTIADVNDNAPIFFPSSSESLLLPEATKMGTIVYRVQAEDRDSGPNGQLSFDLISSGGQRTFGVERSSGEVRLIGSLSYDSVPRYDLQVIAKDSGAPQLSATFSLVVHIQAENNQGPVFDTITYRVELKENTPLNTNFLQVRALNRDPNGNGG-----------SSTPTSTLAYRLRPDGDAVGFGIAPDSGWLFVKSALDRE-------VKDIYLLTVLATSGSGQMGRTGSATIRVSVTDENDNAPRFSQERVFLAVRENLPAGTGFGRVSATDRDAGLNSRLTYRLL--HTDRYFQINSQTGEISTRAALDREHQSSYQLMVVVQD--GGTPPRSATGTAHITVLDENDNAPAFSHTQPGREILIQVQEGLPAGSLLGTLNAKDPDEGENGTIFYSLSGSRAERFSLNPNTGELRSSSPLRR-----AEKAEYSFTITASDRGAPSQSSSAVLLIQVIGSTRISPKPNTLSMTL-NSVEGAKPGSVIGSVRAHDQREVTLN-------GQVTYLVVGGTDHEGTFMVDRLTGDVYLARELDYEKGSRYTLQIEVDDFSKAYPNTHMIQLEINVQDSNDHAPQFPEDPVTIVIPENTQAGSSVYTFQATD--KDGSGPNSEIRYSVQQRWPDNPDLFNLDPVTGVLKL--GRELDHEETSSLFLVVQAMDSALDPNQRLWGSVTARVFVTDENDNAPIFSSPTAVSVM-EDQPVGFVLLYVMAWDADQGENGRVSYRIQSGNTAGRFVLSSNSGSLSILKPLDREEQESYNLTIVAEDHGIPQHSTTQVLSIQVIDVNDEAPWFERNEFEAQIRENQPAGTSIIQVTASDRDHGTNGL---VTYGGVTEDGFTINA--ETGVISATRVLDRELQDHYTITVYAKDGGIPPNFAKAKVHITVLDENDNAPAFGLQQYSLEVPENLQP-VELFTLKATDRDIGESGRLEYKIKAGDPDGDFR-LDGSSGAL 1219          

HSP 4 Score: 138.658 bits (348), Expect = 1.064e-31
Identity = 271/1216 (22.29%), Postives = 492/1216 (40.46%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLIISMNG---------DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNS--PPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYD-AISTSFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEIDSTILNENQHVTFV------KTTKRLPTKPIFIFKIFVLNNLFKINETTGEILSKRSIDCGK---YFFNVSMLSLKTNSLIDQT-KLEIVVKSGRKLPLYFDRGFRKILVTTGK---SQCFSEIAVRNRHCGMRIQYSYDLLLKTDGILRINEHGALCTAENVKHNKLMSTRYLYQIKALDE----TNSSAVCVVLFAIQPSKVFDVLPTEINITLPI-IDSPKFNFSLPIGKIIGTFSKLPPAQFIGFIQYHLVPEELSTGAITVDSQSGEILMKKFPIHKNP-IRLIVKSVIRKPFNVSPLNIV--AINFQKLFFARSLYQFILTKSEIKGNLVKIGQV---SMDSSCTESVSYDLFGVKNDHSHFTIDVATGVIYGK---DLGSISNKTLMFQVSAK-APKSQTSFAQVIIYIEDGIHQPGFDFSDLLVNIWENTTVGIEIMQV----FPKYPSVSDEYQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNV-FYIHQTAVYGTEVGTL-LXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSY-------FEPL---NVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLI 3703
            F +   TGV+K+   +D E+ +    ++ +M+           +   ++ + D NDN P F++     S+ E+ P+G  +     +D D+G+N   S RI SG++   F +  +  S       L + + LD E    +NL I A D G P    + ++ I V + ND  P F+ + + A I+E+Q    + ++V A+D D G +G + Y       + D FT++ +TG +   + LD E    + I++  +D    P F  +KV + +   + N     +Q        E+  ++ P  +   +K TD D   S   + +I    P    ++      L     +   + +S +L +   D+  PSL++T ++ I + +       FS S + V++     +E+  +  V                I  F        F ++  TG I +   +D  K   YFF V  + L   +  + T ++ + +        +F +    I V++G     Q  + +   ++  G      Y   +   G    +  GA+ T EN++   L  T+    ++A+D+     +S  V ++    Q  K      T  +++L    D              GT   +  + F G  +YH      +TG I V S +G            P +RL+VK+      +   +N++   +N  +  F   L  ++    E +G    I QV    +D      V+Y +    N    F ID  TG I      D    +   L+ + + + +PK   +    +I ++   + P        V + EN+ +G EI  V        P +S   Q+  S    +  I    G++ L    D E+ ++  +T++  +    +  +L + + D+NDN P         T  + S  G     +  +D DS  NG +SYR+         + F ++P  G L I          PS  I   VI + +G   PL +   + V+++D N+++PI         + +  + G  + TL  +  +   EN   + ++   +    F IE   +    I     +T+ +        FE L   N+ +  +DRG P +SS +  +I   + N NPP  V  +    +       +G+EI  V A DPD    +   YSI    D+    ++D WTG +
Sbjct:  897 FNLDPVTGVLKLGRELDHEETSSLFLVVQAMDSALDPNQRLWGSVTARVFVTDENDNAPIFSSPT-AVSVMEDQPVGFVLLYVMAWDADQGENGRVSYRIQSGNTAGRFVLSSNSGS-------LSILKPLDREEQESYNLTIVAEDHGIPQHSTTQVLSIQVIDVNDEAPWFERNEFEAQIRENQPAGTSIIQVTASDRDHGTNGLVTY----GGVTEDGFTINAETGVISATRVLDRELQDHYTITVYAKDGGIPPNFAKAKVHITVLDENDNAPAFGLQQYSL----EVPENLQPVELFT-LKATDRDIGESGRLEYKIKAGDPDGDFRLDGSSGALSTSRPLDRERKSSYSLQVVVQDHGSPSLNSTASVEISVLDVNDNSPKFSSSSYTVDV-----SEDAAIGLVVLDATATDVDEGQNGQILYFLSQEAKGAFTVDPNTGRITTAALLDREKRASYFFQVYAVDLSPAAPRNSTAQVTVTILDVNDNAPFFIQDPLIINVSSGSVFTHQVVATMRAEDKDFGANGSVFYRFAMPVRGFAINSLTGAIQTTENLQ--TLTQTQRTLIVEAMDQGSPPQSSLGVVIIYVKEQDYKGIRFSRTARDVSLQENADKGTVVAQAQAQHPDGTRDGINYSIFSGN-KYHSFSISSNTGEIWVQSSNG------LDFEDTPRLRLVVKAETTSSSSFMAVNLILQDVNDNRPRF--QLQNYVTYMHEAQGYDFPIIQVVAEDVDQGQNGQVTYTIES-SNQSGLFKIDPQTGSITTTAIMDREIWTQAKLVIKATDRGSPKLVGTATITVIIVDLNDNSPTIPVP-REVRVPENSLIGTEITLVTGNDVDSGPVLSYSLQLDASTQGKF-DIDRYNGRVSLTAPLDYEERTWYKLTIRASDSKHQSEANLTVVVEDVNDNVPTFTQDLYQVTLPEHSPPGSPVITVTATDRDSGENGKVSYRVL----SSTRDGFYVDPKNGTLFIRQKAKFDPEEPSVSI---VIEARDGGSPPLSSSATVQVQLMDVNDNAPIFHQLEYKATVSEDQLPGATILTLEAVDGDLSQENSGFDFAIASGNVGNAFQIESSVR---FIEGHGFQTVGTLILAERLDFEALSHYNLTVSVSDRGVPQRSSSVPAIITVTDVNDNPP--VFGRAEYIVALSEGAAAGAEILRVTATDPDSAPYAEVQYSISSG-DDMKLFSVDQWTGAM 2063          

HSP 5 Score: 131.724 bits (330), Expect = 1.431e-29
Identity = 417/1817 (22.95%), Postives = 709/1817 (39.02%), Query Frame = 2
Query:  221 KFIISKTTGVIKVSGLIDR-EKQNLYSFLIISMNGDTKNVQIKIL----DVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP-FHTSKXXXXXXXXXXXX----XXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDAIST---SFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEI-DSTILNENQHVTFVKTTKRLPT--------KPIFIFKIFVLNNL--FKINETTGEILSKRSIDCG-KYFFNVSMLSLKTNSLIDQT-----KLEIVVKSGRKLPLYFDRGFRKILVTTGKSQCFSEIAVRNRHCGMRIQYSYDLLLKTDGILRINEHGALCTAENVKHNKLMSTRYLYQIKALDETNSSA---VCVVLFAIQPSKVFDVLPTEINITLPIIDSPKFNFSLPIGKI-IGTFSKLPPAQFIGFIQYHLVPEELSTGAITVDSQSGEILMKKFPIHKNPIRLIVKSVIRKP------FNVSP-------------LNIVAINFQKLFFARSLYQFILTKSEIKGNLVKIGQVSM----DSSCTESVSYDLFGVKNDHSHFTIDVATGVIYGK---DLGSISNKTLMFQVS--AKAPKSQTSFAQVIIYIEDG-IHQPGFDFSDLLVNIWENTTVGIEI--MQVFPK---YPSVSDEYQIIQS--QYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQL--------KNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNVF--YIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPL-LSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQ--NVKIRIFVSDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNV-VFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGS---HVASFNIRRL-----KNLEVVYSIKQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQI-NPSSDGIFMINGDSGEIHLVSS--------PRVSAYELNVTVRDSGEVPKSVS-VVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDAS---IYDLQRIFINIDYGNENP----PRFSRSIFKVKLPEDEAITNFLTVV-ANDPDLGIFGRIIYSLEGDTFDKKIF-IDPSTGKLS-CSPLNFMEKNIYNLKIIATDSE 5335
            +F I+K +G I  S  +DR E  + + F + + +G   +    +L    D+NDN P F   N+  S+      G+ V   T  DPD G N   +   VSG     F +   +   G+    + L +SL  +  S   +VI A DGG      +  V I V   +   P F+ ++Y  ++ ED         VRA+  + GVS ++ Y +    P   +F VD +TG +     LD E      + I  R  SPP F  ++V V I  ++ N        S  +L    L E  +     TIV  V+  D D+      SFDL  ++    +   +     E++LI  +        +L + A D   P LS T +L + I         F    ++VE+ ++T LN N     V+   R P              +++    +   F I   +G +  K ++D   K  + +++L+   +  + +T     ++ +  ++        +R F  +         F  ++  +R  G+  + +Y  LL TD   +IN      T E       +STR      ALD  + S+   + VV     P +        I +     ++P F+ + P  +I I     LP    +G +     P+E   G I   S SG    ++F ++ N   L   S +R+       F ++              L I  I   ++    +     L   E       IG V      + +    V+Y + G  +    F +D  TG +Y     D    S  TL  +V   +KA    T   Q+ I ++D   H P F    + + I ENT  G  +   Q   K    P+    Y + Q      D  ++   TG + L ++ D E+ S L + VQ         + L GS T    + + D NDN P   +       ED   +G +   +   DAD   NG +SYR++     G    F ++  +G L I+  L+          NL ++  D+G  +   T+V +S+++ID N+ +P     N F   I +    GT   +++       ++G   +          F I   +      RV   E  + Y     + + A D G P   +   + I  ++ N N P   +    +Q     P  L   E+FT+ A D D G +    Y I+ A D +    +D  +G ++T   L   +  +  +++ V D G P + S+    +  L    +     + + T  + + +  G VV D      + G     +   +    G   +  ++ ++         K   Y   V   +       +S   + V +  V  + P F +D P  +    N+ SGS   H     +R        N  V Y    P + F IN +TG + T       T+ Q    VE +    S P+  + L +++    E D +    S ++  V +     +   + Q  A   D G    + Y I + +    F I+ ++GEI + SS        PR     L + V+   E   S S +  ++  Q +   ++ RF   +    +   Q    F I Q+         N  + Y + +   + +F +DP TGS+ T   + RE        Q  +VI++    S   +       I +D  + +P    PR      +V++PE+  I   +T+V  ND D G    + YSL+ D   +  F ID   G++S  +PL++ E+  Y L I A+DS+
Sbjct:   43 QFSINKESGQICTSTALDRDEGADSFHFTVTATDGGGLSSSASVLVSLEDINDNRPSFYPLNYAVSLSTQSSPGTSVIRVTAHDPDAGANGRVTYHTVSGGGSSFFTL---NKDTGV----ISLSRSLHGKANSVIPMVISARDGGGLTAPVNARVNISVVGGSVAPPVFEQAQYFFTVSEDVLRGTEVGVVRASSRN-GVSKDVTYTISAGDPDG-YFMVDPETGALRTSLPLDHESRPFFDLEIQARSGSPPAFGDTRVRVTIADVNDNAPIFFPSSSESLL----LPEATK---MGTIVYRVQAEDRDSGPNGQLSFDL--ISSGGQRTFGVERSSGEVRLIGSLSYDSVPRYDLQVIAKDSGAPQLSATFSLVVHIQAENNQGPVFDTITYRVELKENTPLNTN--FLQVRALNRDPNGNGGSSTPTSTLAYRLRPDGDAVGFGIAPDSGWLFVKSALDREVKDIYLLTVLATSGSGQMGRTGSATIRVSVTDENDNAPRFSQERVFLAVRENLPAGTGFGRVSATDRDAGLNSRLTY-RLLHTDRYFQINSQ----TGE-------ISTR-----AALDREHQSSYQLMVVVQDGGTPPRSA-TGTAHITVLDENDNAPAFSHTQPGREILIQVQEGLPAGSLLGTLNAK-DPDEGENGTIFY-SLSGS-RAERFSLNPNTGELRSSSPLRRAEKAEYSFTITASDRGAPSQSSSAVLLIQVIGSTRISPKPNTLSMTLNSVEGAKPGSVIGSVRAHDQREVTLNGQVTYLVVGGTDHEGTFMVDRLTGDVYLARELDYEKGSRYTLQIEVDDFSKA-YPNTHMIQLEINVQDSNDHAPQFPEDPVTIVIPENTQAGSSVYTFQATDKDGSGPNSEIRYSVQQRWPDNPDLFNLDPVTGVLKLGRELDHEETSSLFLVVQAMDSALDPNQRLWGSVT--ARVFVTDENDNAPIFSSPTAVSVMED-QPVGFVLLYVMAWDADQGENGRVSYRIQSGNTAGR---FVLSSNSGSLSILKPLDREEQES---YNLTIVAEDHGIPQHSTTQV-LSIQVIDVNDEAP-WFERNEFEAQIRENQPAGT---SIIQVTASDRDHGTNGLVTYGGVTEDGFTINAETGVISATRVLDRELQDHY----TITVYAKDGGIPPNFAKAKVHITVLDENDNAPAFGL----QQYSLEVPENLQPVELFTLKATDRDIGESGRLEYKIK-AGDPDGDFRLDGSSGALSTSRPLDRERKSSYSLQVVVQDHGSPSLNSTASVEISVLDVNDNSPKFSSSSYTVDVSEDAAIGLVVLDATATDVDEGQNGQILYFLSQEAKGAFTVDPNTGRITTAALLDREKRASYFFQVYAVDLSPAAPRNSTAQVTVTILDVNDNAPFFIQD-PLII----NVSSGSVFTHQVVATMRAEDKDFGANGSVFYRFAMPVRGFAINSLTGAIQTTENLQTLTQTQRTLIVEAM-DQGSPPQ--SSLGVVIIYVKEQDYKGIRFSRTARDVSLQENADKGTVVAQAQAQHPD-GTRDGINYSIFSGNKYHSFSISSNTGEIWVQSSNGLDFEDTPR-----LRLVVK--AETTSSSSFMAVNLILQDVN-DNRPRFQLQNYVTYMHEAQGYD-FPIIQVVAEDVDQGQNGQVTYTIESSNQSGLFKIDPQTGSITTTAIMDRE-----IWTQAKLVIKATDRGSPKLVGTATITVIIVDLNDNSPTIPVPR------EVRVPENSLIGTEITLVTGNDVDSGPV--LSYSLQLDASTQGKFDIDRYNGRVSLTAPLDYEERTWYKLTIRASDSK 1763          

HSP 6 Score: 121.324 bits (303), Expect = 1.886e-26
Identity = 93/291 (31.96%), Postives = 137/291 (47.08%), Query Frame = 2
Query:  128 IKENVPIGEVVGQIESP----GFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGD------TKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTV--FDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSP 964
            I+EN P G  + Q+ +     G +         E  F I+  TGVI  + ++DRE Q+ Y+  + + +G          V I +LD NDN P F    +   +PEN      V+L T+   D D G++     +I +GD +  F +D    S+G     L   + LD E  S ++L +   D G P L ++  V+I V + NDN PKF  S Y   + ED  I +  L   ATD D G +G++ YFL   +  +  FTVD  TG +     LD EK  S+   +   D SP
Sbjct: 1070 IRENQPAGTSIIQVTASDRDHGTNGLVTYGGVTEDGFTINAETGVISATRVLDRELQDHYTITVYAKDGGIPPNFAKAKVHITVLDENDNAPAFGLQQYSLEVPENL---QPVELFTLKATDRDIGESGRLEYKIKAGDPDGDFRLD---GSSGA----LSTSRPLDRERKSSYSLQVVVQDHGSPSLNSTASVEISVLDVNDNSPKFSSSSYTVDVSEDAAIGLVVLDATATDVDEGQNGQILYFLSQEAKGA--FTVDPNTGRITTAALLDREKRASYFFQVYAVDLSP 1348          

HSP 7 Score: 101.293 bits (251), Expect = 2.278e-20
Identity = 66/197 (33.50%), Postives = 102/197 (51.78%), Query Frame = 2
Query:  341 IKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGEL-FYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKS 928
            I + DVNDN P F    +  ++ E    G+++   T  DPD    +     I SGD  K+F++D    +       + L++ LD E  +   +++QA DG H    A   + + V++ NDN P F I+   ASI+E+Q +N     + A D D GV G+L +Y +D++SP  D F VD  +G V  ++  DFEK  S
Sbjct: 1994 ITVTDVNDNPPVFGRAEYIVALSEGAAAGAEILRVTATDPDSAPYAEVQYSISSGDDMKLFSVDQWTGA-------MKLQRPLDRESQNSHVVIVQASDG-HGRF-ALAPISVEVKDINDNRPYFPIATLTASIRENQPLNSAVTVLHAIDYDTGVYGQLKYYLMDHSSPGKDLFFVDQNSGEVRTKQIFDFEKVNS 2181          

HSP 8 Score: 93.9745 bits (232), Expect = 4.033e-18
Identity = 80/282 (28.37%), Postives = 130/282 (46.10%), Query Frame = 2
Query:  176 PGFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTK---NVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVD-----------HKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTS 979
            P  S   ++    + KF I +  G + ++  +D E++  Y   I + +   +   N+ + + DVNDN P F    ++ ++PE+ P GS V   T  D D G+N   S R++S   +      Y D  NG  ++R   K   D E  S  ++VI+A DGG PPL +S  V++ + + NDN P F    Y A++ EDQ    T L + A D D       F F   +    + F ++              G + L + LDFE    +++++ V D   P  +S
Sbjct: 1714 PVLSYSLQLDASTQGKFDIDRYNGRVSLTAPLDYEERTWYKLTIRASDSKHQSEANLTVVVEDVNDNVPTFTQDLYQVTLPEHSPPGSPVITVTATDRDSGENGKVSYRVLSSTRDGF----YVDPKNGTLFIRQ--KAKFDPEEPS-VSIVIEARDGGSPPLSSSATVQVQLMDVNDNAPIFHQLEYKATVSEDQLPGATILTLEAVDGDLSQENSGFDFAIASGNVGNAFQIESSVRFIEGHGFQTVGTLILAERLDFEALSHYNLTVSVSDRGVPQRSS 1988          

HSP 9 Score: 93.5893 bits (231), Expect = 4.613e-18
Identity = 67/220 (30.45%), Postives = 106/220 (48.18%), Query Frame = 2
Query:  326 TKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPD-EGKNSIQSVRIVSGDSEKVFAIDYHD---SSNGIFYV-RLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPF 970
            +  VQ++++DVNDN P F+   ++ ++ E+   G+ +      D D   +NS     I SG+    F I+        +G   V  LIL + LD+E +S +NL +   D G P   +S+   I V + NDN P F  + YI ++ E        LRV ATD D+    E+ Y + ++      F+VD  TG + L++ LD E   SH + +   D    F
Sbjct: 1872 SATVQVQLMDVNDNAPIFHQLEYKATVSEDQLPGATILTLEAVDGDLSQENSGFDFAIASGNVGNAFQIESSVRFIEGHGFQTVGTLILAERLDFEALSHYNLTVSVSDRGVPQRSSSVPAIITVTDVNDNPPVFGRAEYIVALSEGAAAGAEILRVTATDPDSAPYAEVQYSI-SSGDDMKLFSVDQWTGAMKLQRPLDRESQNSHVVIVQASDGHGRF 2090          

HSP 10 Score: 88.5817 bits (218), Expect = 1.729e-16
Identity = 65/236 (27.54%), Postives = 112/236 (47.46%), Query Frame = 2
Query:  218 KKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTK----NVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYV-----RLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLR 898
            K F + + TG +K+   +DRE QN +  ++ + +G  +     + +++ D+NDN P F       SI EN P+ S V +    D D G         V G   K + +D+      +F+V      +  KQ  D+E ++ FN +  A+D G+    A++ V++ +   ++  P F  S     + E  +   +   V+A D D GV G + Y   N+SP   +F V+  TG +YL+
Sbjct: 2052 KLFSVDQWTGAMKLQRPLDRESQNSHVVIVQASDGHGRFALAPISVEVKDINDNRPYFPIATLTASIRENQPLNSAVTVLHAIDYDTG---------VYG-QLKYYLMDHSSPGKDLFFVDQNSGEVRTKQIFDFEKVNSFNFIALAVDAGNN--SATVTVQVFITGEDEYDPVFTTSDLSFEVPEGAKKGQSIGLVQAKDEDGGVDGIVLYSFPNSSP---YFDVNKTTGVIYLK 2272          

HSP 11 Score: 85.5001 bits (210), Expect = 1.373e-15
Identity = 78/269 (29.00%), Postives = 128/269 (47.58%), Query Frame = 2
Query:  212 QEKKFIISKTTGVIKVSGLIDREKQNLYSFLI-------ISMNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPD-EGKNS--IQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPP---LQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTS 979
             E  F++ + TG + ++  +D EK + Y+  I          N     ++I + D ND+ P+F        IPEN   GS V      D D  G NS    SV+    D+  +F +   D   G+    L L + LD+E  S   LV+QA+D    P   L  S+  ++ V + NDN P F  S    S+ EDQ +    L V A D D G +G + Y + + + ++  F +   +G++ + K LD E+ +S++++I   D+  P H++
Sbjct:  784 HEGTFMVDRLTGDVYLARELDYEKGSRYTLQIEVDDFSKAYPNTHMIQLEINVQDSNDHAPQFPEDPVTIVIPENTQAGSSVYTFQATDKDGSGPNSEIRYSVQQRWPDNPDLFNL---DPVTGV----LKLGRELDHEETSSLFLVVQAMDSALDPNQRLWGSVTARVFVTDENDNAPIFS-SPTAVSVMEDQPVGFVLLYVMAWDADQGENGRVSYRIQSGN-TAGRFVLSSNSGSLSILKPLDREEQESYNLTIVAEDHGIPQHST 1043          

HSP 12 Score: 83.9593 bits (206), Expect = 4.297e-15
Identity = 118/529 (22.31%), Postives = 217/529 (41.02%), Query Frame = 2
Query: 6065 FRVKENSVDGTFIGQIKMVNY---CKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVF-SQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLID-ANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITA--KDSDGPDG-------ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKL--LVSDVGKHEFDIVVDDARFSST--AVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQS-YFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDK--AIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQI 7588
            F V E+ + GT +G ++  +     KD    ++I  G       +   TG +    +  +D E      L  Q   G     G  +V + + DV+DN P+F   +     L E     T V R+   D D G N Q+ + +     Q  F ++ ++G+V+    L++ +   YDL + A    +P + A   L V+I   N+Q P        ++L  N P+ +   ++ A  +D +G  G       ++YR+R        +   +A DSG +F+   L   V D+            +   T  A I + V D+N++ P   +    + +  +L  G+    + A D+D   N ++T+ L+ T  +F +       +    +D  +E    Y L + + D    P +       +TVL +   +  F          I + E L +GS +     KD D  +   IFY +      +    L+  +G+L  +  L  + +  +   +T +  G+P + +S  L +Q+
Sbjct:  212 FTVSEDVLRGTEVGVVRASSRNGVSKD--VTYTISAGDPDGYFMVDPETGAL--RTSLPLDHESRPFFDLEIQARSGSPPAFGDTRVRVTIADVNDNAPIFFPSSSESLLLPEATKMGTIVYRVQAEDRDSGPNGQLSFDLISSGGQRTFGVERSSGEVRLIGSLSYDSVPRYDLQVIAKDSGAPQLSATFSLVVHIQAENNQGPVFDTITYRVELKENTPLNTNFLQVRALNRDPNGNGGSSTPTSTLAYRLRP---DGDAVGFGIAPDSGWLFVKSALDREVKDIYLLTVLATSGSGQMGRTGSATIRVSVTDENDNAPRFSQERVFLAVRENLPAGTGFGRVSATDRDAGLNSRLTYRLLHTDRYFQINSQTGEISTRAALD--REHQSSYQLMVVVQDGGT-PPRSATGTAHITVLDENDNAPAFSHTQPGREILIQVQEGLPAGSLLGTLNAKDPDEGENGTIFYSLSGSR--AERFSLNPNTGELRSSSPLRRAEKAEYSFTITASDRGAPSQSSSAVLLIQV 728          

HSP 13 Score: 83.5741 bits (205), Expect = 4.956e-15
Identity = 76/296 (25.68%), Postives = 129/296 (43.58%), Query Frame = 2
Query:  116 LIFSIKENVPIGEVVGQIES----PGFSPPFEMHDFQ-EKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDT------KNVQIKILDVNDNEPKFNATNFEKSI----PENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDN-DAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD 955
            +  +++EN+P G   G++ +     G +          ++ F I+  TG I     +DRE Q+ Y  +++  +G T          I +LD NDN P F+ T   + I     E  P GS +      DPDEG+N      + SG   + F+++    + G       L+++   E    ++  I A D G P   +S ++ I V  +    PK +      +  E  +       VRA D  +  ++G++ Y +   +     F VD  TG+VYL + LD+EK   + + I V D
Sbjct:  532 VFLAVRENLPAGTGFGRVSATDRDAGLNSRLTYRLLHTDRYFQINSQTGEISTRAALDREHQSSYQLMVVVQDGGTPPRSATGTAHITVLDENDNAPAFSHTQPGREILIQVQEGLPAGSLLGTLNAKDPDEGENGTIFYSL-SGSRAERFSLN---PNTGELRSSSPLRRAEKAE----YSFTITASDRGAPSQSSSAVLLIQVIGSTRISPKPNTLSMTLNSVEGAKPGSVIGSVRAHDQREVTLNGQVTYLVVGGTDHEGTFMVDRLTGDVYLARELDYEKGSRYTLQIEVDD 819          

HSP 14 Score: 78.5666 bits (192), Expect = 1.584e-13
Identity = 85/386 (22.02%), Postives = 162/386 (41.97%), Query Frame = 2
Query:  215 EKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKNVQ------IKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNG---IFYVR-----LILKQSLDYEIISQFNLVIQAIDG-GHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQILWTGG--LSEINRDISPNTIVAHVKLTDYDAISTSFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKI 1321
            ++ F + +++G +++ G +  +    Y   +I+ +     +       + I   N+  P F+   +   + EN P+ +        + D   N         G S     + Y    +G    F +      L +K +LD E+   + L + A  G G      S  +++ V + NDN P+F   R   +++E+      F RV ATD DAG++  L Y L +T     +F ++ +TG +  R +LD E   S+ + + V+D   P  ++     I V+D NDN P+      G   L ++   +   +++  +   D D          L+ S  +   + P   EL+  + +   +    + T+ A D   PS S++  L I++
Sbjct:  354 QRTFGVERSSGEVRLIGSLSYDSVPRYDLQVIAKDSGAPQLSATFSLVVHIQAENNQGPVFDTITYRVELKENTPLNTNFLQVRALNRDPNGNG--------GSSTPTSTLAYRLRPDGDAVGFGIAPDSGWLFVKSALDREVKDIYLLTVLATSGSGQMGRTGSATIRVSVTDENDNAPRFSQERVFLAVRENLPAGTGFGRVSATDRDAGLNSRLTYRLLHT---DRYFQINSQTGEISTRAALDREHQSSYQLMVVVQDGGTPPRSATGTAHITVLDENDNAPAFSHTQPGREILIQVQEGLPAGSLLGTLNAKDPDEGENGTIFYSLSGSRAERFSLNPNTGELRSSSPLRRAEKAEYSFTITASDRGAPSQSSSAVLLIQV 728          

HSP 15 Score: 72.0182 bits (175), Expect = 1.857e-11
Identity = 77/289 (26.64%), Postives = 121/289 (41.87%), Query Frame = 2
Query:  125 SIKENVPIGEVVGQIESP---GFSPPFEMHDFQEKK---FIISKTTGVIKV--SGLIDREKQNLYSFLIISMNGDTKN---VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDN 958
            S++EN   G VV Q ++    G         F   K   F IS  TG I V  S  +D E       ++ +    + +   V + + DVNDN P+F   N+   + E       +      D D+G+N   +  I S +   +F ID    S       +     +D EI +Q  LVI+A D G P L  +  + +I+ + NDN P   + R +  + E+  I      V   D D+G    L Y L   + +   F +D   G V L   LD+E+   + ++I   D+
Sbjct: 1484 SLQENADKGTVVAQAQAQHPDGTRDGINYSIFSGNKYHSFSISSNTGEIWVQSSNGLDFEDTPRLRLVVKAETTSSSSFMAVNLILQDVNDNRPRFQLQNYVTYMHEAQGYDFPIIQVVAEDVDQGQNGQVTYTIESSNQSGLFKIDPQTGS-------ITTTAIMDREIWTQAKLVIKATDRGSPKLVGTATITVIIVDLNDNSPTIPVPREV-RVPENSLIGTEITLVTGNDVDSGPV--LSYSLQLDASTQGKFDIDRYNGRVSLTAPLDYEERTWYKLTIRASDS 1762          
BLAST of Dachsous vs. Ensembl Zebrafish
Match: LO018022.1 (FAT atypical cadherin 4 [Source:NCBI gene;Acc:101882648])

HSP 1 Score: 216.468 bits (550), Expect = 3.007e-55
Identity = 367/1529 (24.00%), Postives = 636/1529 (41.60%), Query Frame = 2
Query: 4145 PLFSKDSPKFLEIKENLPSGSHV---ASFNIRRLKNLEVVYSIK--QPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLI-VKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINP---SSDGIFMINGDSGEIHLVSSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINI---DYGNENPPRFSRSIFKVKLPEDEA--ITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSC-SPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPV--NSEIFYVLNPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTT----SAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFD---------RSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGG-SEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLID-ANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDE---PQEKGH------PYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSY-FPRLIGNHSTEITIPESLKSGS---KITKFVCKDLDSDKAIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENK-GPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESRIWNLTIMIVKAQKYQNSPSN-----------LYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHD-----IQYFLTPHENFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIV-ENPSENFGINNETGAIYIKNQFIIEKKDKQRVKRSETNEEALKS 8539
            PLF+  S     I E+L +G+ V   ++ +     N ++ YSI    P+  F I   TG L T +  DRET++     + V    +     FT    I + + D ND  P   SP ++ ++ + P   +  +F   A+DADSGPNS + Y ++    S  GI MI+G    +  +    +  Y L +   D G+ P S S+   +    +         S ++        + +G  I Q+  S      N  IR+ +  G     F +D +TG +     + RE   +  +      +Q+    S   + R  +NI   D  N+  P F  S + + + E+      N L VVA D DLG  G+I YSL     D   F   ++G+L+    L+   ++ + L I A D+ GL +     T V + V +   +  +F++  F   + E++P GT +  +N     V  N  I Y L+ G     IN +TG + T+  L  E     +L +      +++   Q T    SA + V + DINDN P    +P    IP S      +  ++ TD D  SN    +          + DP    +     L G S   F                V V D G   K  +  + +       +  I  +   F   EN    T + ++   +  +     + I  G       + + +G++ +     +D E I+K +LW +    G      Y+KV I V DV+DN PVF Q  F A + E   P+  V+ ++  D D G N Q+EY I   + +  F I+ A G+++T  PL+    + Y L +KA+ +  P      ++ + ++++ND  P+ S    +  +  N PVG  +T++T  D D G + IS       +T+ +L   +   +G+I +SR L   D   +   +   D+ ++ +  + I V D N++ P   +    ++     + GS +  + A D D   NGK+ + + S + +F +   ++++  +F+  +       GH       +   +  +D  I P   LMS    TV++    S   P    + S    + +S+K G+   K+T +  KD   +  I Y I   +  SN   LD ++G + +  SL       +LL +T +  G+P       + + + +EN   P    N+   +++ V E +     I  L   DK+  +    LI+              + I S N     +  LF        + + K   Y+    +           + +  Y+ VNI+V +  + +     +      V+ EN P  TTV+K+     D     +  ++    + +L      +    I ++  LD+E  + Y L +         R CS    V I +   +EY P FV + +   +    PK G ++   +ASD+D G  G+V Y I   +    F IN +TG IY+      EK++K  +K    N  +++ 
Sbjct:   96 PLFNS-SVYTTSILESLSAGASVLTVSAADRDHGPNADLHYSIASGDPQSQFSIT-NTGVLHTTKTLDRETQSFYNLVITVNDLALPPSTRFTSTAQISIILLDVNDCAPVFTSPRTAYIQENTPV--DMRVFTAQASDADSGPNSYVEYSLSGAFGSKFGIGMIDGGVTLLGELDREEMENYTLTIVATDKGDPPLSSSM--EVIMMVLDVNDNTPSFSQNIYDIEIQENTLTGTDILQVFASDADEGTNGQIRFSITGGNLNSDFRMDSVTGVISVAKLLDRESRSSYSLQ-----VQAADRGSSPRVDRATVNIVLLDV-NDCAPVFELSPYTISVQENLGNLPKNILQVVARDDDLGTNGQISYSLSSGN-DAGAFSLSASGQLNLIHTLDRETQDTHTLIITAHDA-GLPSLSGSGT-VTVLVGDVNDNIPSFSSMSFHTTIPEDAPTGTDVLLLNSSDSDVGLNGVISYSLSGGDGQFSINPSTGLIITSSLLDRETRASYQLLV------VASDGGQPTPLSSSATVSVVVADINDNPPRFHHHPYVTHIPASTSTGSLVFAVTVTDEDSGSNSQLHYSLTGRNSEKFKIDPIRGAITASEKLTGSSEVTFT---------------VHVKDGGTNPKTDSTTVTVRFVTGGDFPHIKLKDKAFTFPENQPTNTIVTKVTGSSP-RAGPLSYYIASGNLDNAFHIDQLSGELSIRK--PLDYENIEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVFEQEPFHAEILENLSPQR-VLVVSALDQDSGPNGQLEYAIIDGNKENSFNINRATGEIRTTRPLDREKVAQYSLRVKATDRGMPPKSTAVKVLISVLDVNDNAPRFS-KIFSATVPENAPVGFTVTRVTTTDEDAGANAIS----RYSITDASLPFIIHPSTGDITISRPLNREDTDHYIAKVSAHDSGWTVSTDVTIFVTDINDNAPRFSKPSYYLDYPELTEIGSIVTQVSATDPDEGFNGKIFYFIRSQTEYFRI---NSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIVTASDRGIKP---LMS--ETTVMINVVDSNDNPPTFESPSYFTPVTKSVKVGTRLLKVTAYDKKDFGLNSEIEYAISGGNS-SNKFRLDKQTGSVTVASSLAADTNKVYLLEITASDKGNPPLSDRTTVKIAVTEENHHTPEFSQNQ---VTVTVSEALTVGTAIRTLSARDKDKDKQMNGLIT--------------YNISSGN-----DDGLFSVHSQTGVLSLAKTLDYETKQKHELRVSATDGGWIAKTSYVTVNIQVTD--VNDNPPVFDPVEYFPVVQENVPSGTTVVKMNATDKDSGSNALMAYVIQSSDSDLFIIDPNTG--IITTQGFLDYEAKQVYHLTVKAFNVPDEER-CSFA-YVNIQLKGANEYVPRFVSKQYYFEISEAAPK-GTVVGEVFASDRDLGEDGVVYYLIFGRSRKRGFSINKKTGQIYVSGSLDREKEEKISLKVLAKNAGSIRG 1541          

HSP 2 Score: 184.882 bits (468), Expect = 1.204e-45
Identity = 400/1656 (24.15%), Postives = 688/1656 (41.55%), Query Frame = 2
Query: 2345 DSSCTESVSYDLFGVKNDHSHFTIDVATG--VIYGK-DLGSISNKTLMFQVSAKAPKSQTSFAQVIIYIED-GIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSDE-------YQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCK-----NSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNVFY-IHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSK-SSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLS--GSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVKIRIFVSDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVH-YSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSH--VASFNIRRLKNLEVVYSI--KQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEIHLVSSP----RVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQ-SKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVS-REEIGNSEI-VQIPVVIQSLHDASIYDLQR---IFINIDYGNENPPRF-SRSIFKVKLPEDEAITNFLTVVANDP-DLGIFGRIIYSLEGDTFDKKIFIDPSTGKLS-CSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVL----GRINIVKPPVNSEIFYVLNPGHSH--IQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIF-IPNSNQPQ-KPLTKLSATDSDKTSN--ITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYV-QIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVF---------LHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYK--KVIIHXXXXXXNKP-VFSQNKFVAFLNEGQPPKTPVIRLTVYDPD-IGFNSQVEYFIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDA---RFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSP 7111
            DS     V Y L G     S F I +  G   + G+ D   + N TL    + K     +S  +VI+ + D   + P F  +   + I ENT  G +I+QVF    S +DE       + I     +    + S TG I + K  DRE  S   + VQ  +  GS+       +  +  +   C      +  T    E+L +L +    +   D D   NG +SY +      G    F ++  +G L +I +L+    +     + L+I + +     L     ++V + D N++ P   S +    I + A  GT+V  LL+   D        IS         F I   +       +   ET  SY     ++++A+D G P+  SS   + +   + N NPP       H   +   P  +  GS +F V   D D G NS  +YS  L   N ++  ID   G IT    L+ +  V   + V D G    T S    ++ +         + K+  F  P++     +V  +       G    +I+  + ++D   H+   S +L + K  L+ +N+  Y L +    +     S+   + + V  V  + P+F ++ P   EI ENL       V++ +     N ++ Y+I     E  F IN  TG++ T R  DRE     Q+ + V AT    P   T + +++ + D NDN P      S+ V  +AP     ++ ++  TD D+G N+   Y I  +S   F+I+  +G+I  +S P        Y   V+  DSG    +VS   +I    I   +  RF   S  ++   P+ ++ G I+ Q+S +      N  I Y++ +    + F ++  +G +  +  +  +   G++ I V     I +  D  I  L     + IN+   N+NPP F S S F       +  T  L V A D  D G+   I Y++ G     K  +D  TG ++  S L      +Y L+I A+D    +    D T V I V     HT  F+    ++ V E    GT +     R       +N  I Y ++ G+      +++ TG L     L  E  +  EL + A         I  TS +     +   ++ P P  +PV+ F +   N P    + K++ATD D  SN  + Y    SD        ++++D  +G +  +  +    K  + L V   +     +C+   ++I L   ++YV + V ++  F + E +  GT +G++    +  D        DGV + L+F         +++ TG+I+V+ +  +DREK +KI L       GS IRG    +V++++  +D N P VF+Q  +   +NEG  P   V  ++  D D +   S+  Y I     +  F I+   G V     L+  T  VY+L I A    SP       L V + +IND  P +      +    N+  G+ +  ++++D D  P+   +          + +  ++  +GE+  SR++    +      +++ D+   + SST  + I V D+N++    +     ++   ++  G  +  +   D D++D    TF+   T P
Sbjct:  232 DSGPNSYVEYSLSGAFG--SKFGIGMIDGGVTLLGELDREEMENYTLTIVATDKGDPPLSSSMEVIMMVLDVNDNTPSFSQNIYDIEIQENTLTGTDILQVFA---SDADEGTNGQIRFSITGGNLNSDFRMDSVTGVISVAKLLDRESRSSYSLQVQAADR-GSSPRVDRATVNIVLLDVNDCAPVFELSPYTISVQENLGNLPKNILQVVARDDDLGTNGQISYSLSSGNDAGA---FSLS-ASGQLNLIHTLDRETQD----THTLIITAHDAGLPSLSGSGTVTVLVGDVNDNIPSFSSMSFHTTIPEDAPTGTDV--LLLNSSDSDVGLNGVISYSLSGGDGQFSINPSTGLIITSSLLDRETRASY----QLLVVASDGGQPTPLSSSATVSVVVADINDNPPRF----HHHPYVTHIPASTSTGSLVFAVTVTDEDSGSNSQLHYS--LTGRNSEKFKIDPIRGAITASEKLTGSSEVTFTVHVKDGGTNPKTDSTTVTVRFVTGGDFPHIKL-KDKAFTFPENQPTNTIVTKVTGSSPRAGPLSYYIA--SGNLDNAFHIDQLSGELSIRKP-LDYENIEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVFEQE-PFHAEILENLSPQRVLVVSALDQDSGPNGQLEYAIIDGNKENSFNINRATGEIRTTRPLDRE--KVAQYSLRVKATDRGMPPKSTAVKVLISVLDVNDNAPRFSKIFSATVPENAPV--GFTVTRVTTTDEDAGANAISRYSITDASL-PFIIHPSTGDI-TISRPLNREDTDHYIAKVSAHDSG---WTVSTDVTIFVTDINDNAP-RFSKPSYYLDY--PELTEIGSIVTQVSATDPDEGFNGKIFYFIRSQ--TEYFRINSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIVTASDRGIKPLMSETTVMINVVDSNDNPPTFESPSYFTPVTKSVKVGTRLLKVTAYDKKDFGLNSEIEYAISGGNSSNKFRLDKQTGSVTVASSLAADTNKVYLLEITASDKG--NPPLSDRTTVKIAVTEENHHTPEFSQNQVTVTVSEALTVGTAIRTLSARDKDKDKQMNGLITYNISSGNDDGLFSVHSQTGVLSLAKTLDYETKQKHELRVSA----TDGGWIAKTSYVTVNIQVTDVNDNP-PVFDPVEYFPVVQENVPSGTTVVKMNATDKDSGSNALMAYVIQSSD------SDLFIIDPNTGIITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFAYVNIQLKGANEYVPRFVSKQYYFEISEAAPKGTVVGEV----FASDRDLGE---DGVVYYLIFGRSRKRGFSINKKTGQIYVSGS--LDREKEEKISLKVLAKNAGS-IRGADIDEVLVNITVLDANDPPVFTQELYDVQVNEGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHERNTFTINPQTGQVSVASELDRETVPVYNLTILAVDSGSPAATGSAILIVTLEDINDNGPTLVTTYGEVM--ENQRAGTPVMTLSSRDPDLAPNQGPFTYSLVSTGAASSYFTIS-PTGELTTSREVDREQISDFYLSVLIKDSGIPQMSSTGTVHIKVNDQNDNPSESRSVEIYVHYFGNMFPGGSLGVVKPQDPDIQD----TFQCSLTPP 1812          

HSP 3 Score: 181.03 bits (458), Expect = 1.611e-44
Identity = 393/1696 (23.17%), Postives = 702/1696 (41.39%), Query Frame = 2
Query: 2717 TGQIFLNKQFDREQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSK--TNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNG--PFKPLETEVEISVRIIDANNHSPILISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPL----LSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSL--SCAQNVKIRIFVSDLG-FPKM-TSSVDTLL------KPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLK---NLEVVYSIKQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPK-IFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEI----HLVSSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKL-SCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPVNSEIF--YVLNPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNIT-YQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXI--------RHFLKVIVSDNGVPS--KCTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCK-----DHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIG--FNSQVEYFIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDG--ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVD-----DARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNN--TAALFLIDE-PQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKA---IFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKEN-KGPNLI 7618
            TG   + +  D E   + ++TV+  +  G ++       L   ++ P   NS   T    E LS+ G     +  +D D  PN +L Y +    P    + F I   TG L    +L+    +     NL++ V+D    P     +  +IS+ ++D N+ +P+  S    YI +       V T    D D G N  +E SL    +   F I  +     ++     E + +Y     + ++ATD+G P  SS + +++  ++ N N P         Q I+   +    L+G++I  V A D D+G N    +SI     N D   +DS TG+I+    L      +  +++  +D G  P++  ++V+ +L       P++E       + +NL  +  +  Q   V  D ++      +  L   N      G   L    Q  ++   +   ++ H +L +  +   L S+S +  + V+V  V  + P FS  S     I E+ P+G+ V   N        N  + YS+   +  F INP TG ++T  + DRET    Q    V+A+    P  + +   + V +AD NDN P        +  I A T+  + +F +  TD DSG NS+L Y +   +   F I+   G I     L  S  V+     V V+D G  PK+ S   ++ F +      I+    + +   + P +    I+ +++ S   +     + YY+ +G     F +D ++G +  +  +  E I    ++ I    Q     S Y  +++ I +   N+N P F +  F  ++ E+ +    L V A D D G  G++ Y++     +    I+ +TG++ +  PL+  +   Y+L++ ATD  G+   +    KV+I V +   +   F+   FS  V EN+P G  + R+        +     Y +        I+ +TG++  + PL+ E  +      H  AK  +  S  T S  + + + DINDN P  ++    +  P   +    +T++SATD D+  N   + F RS    QT Y  + ++  SG +F+K  +              RH   V  SD G+      TTV+I++  + D+      P       K   V GT +  +K+  Y K     +   +++I  G +     L + TG + VA++   D  K+  ++  T    G   +     V I V + + + P FSQN+    ++E     T +  L+  D D     N  + Y I   +    F + +  G +     L++ TK  ++L + A+        +   + + + ++ND  P          +  N P G+ + K+ A D D      ++Y I+    ++  LF+    D     ++ +  +    K  + + V      D    S A + I ++  N +VP          +S +  +G+ +  + A D+DL ++G V + +   S     RGF  N  T  +++     +EK     L + L  NA     R   I  + V +    +  P +      ++ + E L  G  +T    +D DS  +     Y I   H   N   ++ ++G + +   L+    P + L +     GSP    S  L V +E  N  GP L+
Sbjct:   49 TGVFNVTRALDFETQPFFILTVRAADGGGRSSSVRVYFNLLDVNDHPPLFNSSVYTTSILESLSA-GASVLTVSAADRDHGPNADLHYSIASGDP---QSQFSIT-NTGVLHTTKTLDRETQS---FYNLVITVNDLALPPSTRFTSTAQISIILLDVNDCAPVFTSPRTAYIQENTPVDMRVFTAQASDADSGPNSYVEYSLSGA-FGSKFGIGMIDGGVTLLGELDREEMENY----TLTIVATDKGDPPLSSSMEVIMMVLDVNDNTPSF------SQNIYDIEIQENTLTGTDILQVFASDADEGTNGQIRFSITGGNLNSD-FRMDSVTGVISVAKLLDRESRSSYSLQVQAADRGSSPRVDRATVNIVLLDVNDCAPVFELSPYTISVQENLGNLPKNILQ--VVARDDDLGTNGQISYSLSSGNDA----GAFSLSASGQLNLIHTLDRETQDTH-TLIITAHDAGLPSLSGSGTVTVLVGDVNDNIPSFSSMS-FHTTIPEDAPTGTDVLLLNSSDSDVGLNGVISYSLSGGDGQFSINPSTGLIITSSLLDRETRASYQLL--VVASDGGQPTPLSSSATVSVVVADINDNPPR-FHHHPYVTHIPASTSTGSLVFAVTVTDEDSGSNSQLHYSLTGRNSEKFKIDPIRGAITASEKLTGSSEVT---FTVHVKDGGTNPKTDSTTVTVRFVTGGDFPHIKLKDKAFTFPENQPTNT---IVTKVTGSSPRAG---PLSYYIASGNLDNAFHIDQLSGELSIRKPLDYENI-EKYVLWIEARDQGFPPYSAY--EKVEIAVLDVNDNHPVFEQEPFHAEILENLSPQRVLVVSALDQDSGPNGQLEYAIIDGNKENSFNINRATGEIRTTRPLDREKVAQYSLRVKATD-RGMPP-KSTAVKVLISVLDVNDNAPRFSKI-FSATVPENAPVGFTVTRVTTTDEDAGANAISRYSITDASLPFIIHPSTGDITISRPLNREDTD------HYIAKVSAHDSGWTVSTDVTIFVTDINDNAPRFSKPSYYLDYPELTEIGSIVTQVSATDPDEGFNGKIFYFIRS----QTEY--FRINSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIVTASDRGIKPLMSETTVMINVVDSNDNPPTFESPSYFTPVTKSVKV-GTRL--LKVTAYDKKDFGLNSEIEYAISGGNSSNKFRLDKQTGSVTVASSLAADTNKV-YLLEITASDKGNPPLSDRTTVKIAVTEENHHTPEFSQNQVTVTVSEALTVGTAIRTLSARDKDKDKQMNGLITYNISSGNDDGLFSVHSQTGVLSLAKTLDYETKQKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVFDPVEYFPVVQENVPSGTTVVKMNATDKDSGSNALMAYVIQS---SDSDLFI---IDPNTGIITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFAYVNIQLKGANEYVPRFVSKQYYFEISEAAPKGTVVGEVFASDRDLGEDGVVYYLIFGRSRK---RGFSINKKTGQIYVSGSLDREKEEKISLKV-LAKNA--GSIRGADIDEVLVNITVLDANDPPVFTQELYDVQVNEGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHE-RNTFTINPQTGQVSVASELDRETVPVYNLTILAVDSGSPAATGSAILIVTLEDINDNGPTLV 1669          

HSP 4 Score: 120.168 bits (300), Expect = 4.869e-26
Identity = 196/808 (24.26%), Postives = 349/808 (43.19%), Query Frame = 2
Query: 6146 KFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYK-KVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLID-ANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVS--------DVGKHEFDIVVDDARFS---STAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAID-KDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDE-PQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKA----IFYKIDNFHPISNNLY-LDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDN-KYITLSLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPEN---IYDPPSFQIDSSNILWWINGDLFESRIWNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHDIQ-----YFLTPHENFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIVENPSEN-FGINNETGAIYIKNQF 8473
            +++IIDG       ++ +TG+I       +DREK+ +  L  + +  G   +    KV+I V DV+DN P FS+  F A + E  P    V R+T  D D G N+   Y I    +   F+I  + GD+  + PLN      Y  + K S+  S +  +   +T+++ +IND  P+ S P+  L       +GS +T+++A D D G +G I Y IR     +QT +  +   SGEIF+ ++L           +V +H F +   D       S   + I+V D N++ P  +       ++ S+K G+++L + A D KD   N ++ + +   +     R  D  T ++ +      +    Y L I  +D    P   L     + + +     + P    N  T +T+ E+L  G+ I     +D D DK     I Y I + +   + L+ +  ++G L L K+L+Y  + +  L V+    G   K +   +++Q+   N  P + D  +Y  +   V E +     +  +   DK+S   S  L++   +  ++   I DP +  I +   L     D    ++++LT+      K  N P       + +VNI++  K           K+    I+E  P  T V ++     D+      Y+L    + +   S ++ +G  I     LD E  E   L++L K +     +    ++V I+VLD ++  P F  + +   V  G+   G + F +         +   +Y I  N   N F IN +TG + + ++ 
Sbjct:  860 EYAIIDGNKENSFNINRATGEI--RTTRPLDREKVAQYSLRVKATDRGMPPKSTAVKVLISVLDVNDNAPRFSK-IFSATVPENAPVGFTVTRVTTTDEDAGANAISRYSIT--DASLPFIIHPSTGDITISRPLNREDTDHY--IAKVSAHDSGWTVST-DVTIFVTDINDNAPRFSKPSYYLDYPELTEIGSIVTQVSATDPDEGFNGKIFYFIR-----SQTEYFRINSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIVTASDRGIKPLMSETTVMINVVDSNDNPPTFESPSYFTPVTKSVKVGTRLLKVTAYDKKDFGLNSEIEYAISGGNSSNKFR-LDKQTGSVTVASSLAADTNKVYLLEITASDKGNPP---LSDRTTVKIAVTEENHHTPEFSQNQVT-VTVSEALTVGTAIRTLSARDKDKDKQMNGLITYNISSGN--DDGLFSVHSQTGVLSLAKTLDYETKQKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVFDPVEYFPV---VQENVPSGTTVVKMNATDKDSG--SNALMAYVIQSSDSDLFIIDPNTGIITTQGFL-----DYEAKQVYHLTV------KAFNVPDE-ERCSFAYVNIQL--KGANEYVPRFVSKQYYFEISEAAPKGTVVGEVFASDRDLGEDGVVYYLIFGRSRKRGFSINKKTG-QIYVSGSLDREKEEKISLKVLAKNAGSIRGADIDEVLVNITVLDANDP-PVFTQELYDVQVNEGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHERNTFTINPQTGQVSVASEL 1626          

HSP 5 Score: 108.997 bits (271), Expect = 1.083e-22
Identity = 76/247 (30.77%), Postives = 121/247 (48.99%), Query Frame = 2
Query:  212 QEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMN------GDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHH 934
            +E  F I++ TG I+ +  +DREK   YS  + + +           V I +LDVNDN P+F+   F  ++PEN P+G  V   T  D D G N+I    I   D+   F I  H S+  I   R + ++  D+ I       + A D G      S  V I V + NDN P+F    Y     E  EI     +V ATD D G +G++FYF+ +    +++F ++  +G +++++ L ++ S  H+
Sbjct:  868 KENSFNINRATGEIRTTRPLDREKVAQYSLRVKATDRGMPPKSTAVKVLISVLDVNDNAPRFSKI-FSATVPENAPVGFTVTRVTTTDEDAGANAISRYSIT--DASLPFII--HPSTGDITISRPLNREDTDHYIAK-----VSAHDSG---WTVSTDVTIFVTDINDNAPRFSKPSYYLDYPELTEIGSIVTQVSATDPDEGFNGKIFYFIRS---QTEYFRINSSSGEIFIKQQLRYQNSSGHN 1098          

HSP 6 Score: 97.8265 bits (242), Expect = 2.920e-19
Identity = 88/301 (29.24%), Postives = 140/301 (46.51%), Query Frame = 2
Query:  104 NSNLLIFSIKENVPIGEVVGQIESPG--FSPPFEMH-----DFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNG----------DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD 955
            NS++   SI E++  G  V  + +      P  ++H        + +F I+ T GV+  +  +DRE Q+ Y+ L+I++N            T  + I +LDVND  P F +      I EN P+  +V      D D G NS     + SG     F I       G+    + L   LD E +  + L I A D G PPL +S+ V ++V + NDN P F  + Y   I+E+       L+V A+D D G +G++ + +   + +SD F +D  TG + + K LD E   S+ + +   D
Sbjct:   99 NSSVYTTSILESLSAGASVLTVSAADRDHGPNADLHYSIASGDPQSQFSITNT-GVLHTTKTLDRETQSFYN-LVITVNDLALPPSTRFTSTAQISIILLDVNDCAPVFTSPR-TAYIQENTPVDMRVFTAQASDADSGPNSYVEYSL-SGAFGSKFGI-------GMIDGGVTLLGELDREEMENYTLTIVATDKGDPPLSSSMEVIMMVLDVNDNTPSFSQNIYDIEIQENTLTGTDILQVFASDADEGTNGQIRFSITGGNLNSD-FRMDSVTGVISVAKLLDRESRSSYSLQVQAAD 387          

HSP 7 Score: 97.0561 bits (240), Expect = 4.830e-19
Identity = 78/255 (30.59%), Postives = 119/255 (46.67%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLIISMNG------DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVF-DPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            F +   TGVI V+ L+DRE ++ YS  + + +       D   V I +LDVND  P F  + +  S+ EN     K  L  V  D D G N   S  + SG+    F++    S++G    +L L  +LD E      L+I A D G P L  S  V ++V + NDN+P F    +  +I ED       L + ++D+D G++G + Y L   S     F+++  TG +     LD E   S+ + +   D   P
Sbjct:  356 FRMDSVTGVISVAKLLDRESRSSYSLQVQAADRGSSPRVDRATVNIVLLDVNDCAPVFELSPYTISVQENLGNLPKNILQVVARDDDLGTNGQISYSLSSGNDAGAFSL----SASG----QLNLIHTLDRETQDTHTLIITAHDAGLPSLSGSGTVTVLVGDVNDNIPSFSSMSFHTTIPEDAPTGTDVLLLNSSDSDVGLNGVISYSL---SGGDGQFSINPSTGLIITSSLLDRETRASYQLLVVASDGGQP 599          

HSP 8 Score: 95.1301 bits (235), Expect = 1.713e-18
Identity = 66/249 (26.51%), Postives = 121/249 (48.59%), Query Frame = 2
Query:  221 KFIISKTTGVIKVSGLIDREKQNLYSFLIISMN------GDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGK--NSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISI 943
            KF + K TG + V+  +  +   +Y   I + +       D   V+I + + N + P+F+      ++ E   +G+ +   +  D D+ K  N + +  I SG+ + +F++    S  G+    L L ++LDYE   +  L + A DGG     + + V I V + NDN P FD   Y   ++E+     T +++ ATD D+G +  + Y +   S  SD F +D  TG +  +  LD+E  + +H+++
Sbjct: 1187 KFRLDKQTGSVTVASSLAADTNKVYLLEITASDKGNPPLSDRTTVKIAVTEENHHTPEFSQNQVTVTVSEALTVGTAIRTLSARDKDKDKQMNGLITYNISSGNDDGLFSVH---SQTGV----LSLAKTLDYETKQKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVFDPVEYFPVVQENVPSGTTVVKMNATDKDSGSNALMAYVIQ--SSDSDLFIIDPNTGIITTQGFLDYEAKQVYHLTV 1426          

HSP 9 Score: 93.9745 bits (232), Expect = 4.202e-18
Identity = 74/266 (27.82%), Postives = 130/266 (48.87%), Query Frame = 2
Query:  206 DFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKNVQIKI----LDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPP---LQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD-NSPPFHTS 979
            D ++  F+++  TGV  V+  +D E Q  +   + + +G  ++  +++    LDVND+ P FN++ +  SI E+   G+ V   +  D D G N+     I SGD +  F+I    ++ G+ +      ++LD E  S +NLVI   D   PP     ++  + II+ + ND  P F   R  A I+E+  +++     +A+D D+G +  + Y L     S   F +    G V L   LD E+ +++ ++I   D   PP  +S
Sbjct:   37 DDEDSTFLLNPITGVFNVTRALDFETQPFFILTVRAADGGGRSSSVRVYFNLLDVNDHPPLFNSSVYTTSILESLSAGASVLTVSAADRDHGPNADLHYSIASGDPQSQFSI----TNTGVLHT----TKTLDRETQSFYNLVITVNDLALPPSTRFTSTAQISIILLDVNDCAPVFTSPR-TAYIQENTPVDMRVFTAQASDADSGPNSYVEYSLSGAFGSK--FGIGMIDGGVTLLGELDREEMENYTLTIVATDKGDPPLSSS 291          

HSP 10 Score: 93.5893 bits (231), Expect = 5.542e-18
Identity = 189/823 (22.96%), Postives = 351/823 (42.65%), Query Frame = 2
Query: 5156 TVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCS-PLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLEN-SPGGTVL--GRINIVKPPVNSEIFYVLNPGHSHIQIN-TTTGELRTNGPLHLELVEFIEL--TIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVP---SKCTTVLIDISLNQDH-QYVQIVPEKAIFRVKENSVDGTFIGQI--KMVNYCKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVI-IHXXXXXXNKPVFSQNKFVAFLNE--GQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDAR----FSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVS-TSPWFGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKY-PQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKAIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSP 7552
             ++A+D D G+ G I YS+E D  D    ++P TG  + +  L+F  +  + L + A D      GR    +V   + +   H   FN++ ++  +LE+ S G +VL     +    P N+++ Y +  G    Q + T TG L T   L  E   F  L  T++  A   STR   T++A I + ++D+ND  P+   +P   +I  +      +    A+D+D   N   ++  S     + + + ++DG    + L   +       + L ++ +D G P   S    +++ + +N +   + Q + +     ++EN++ GT I Q+     +   +   +FSI  G  +    +   TG I VA    +DRE      L  Q +  GS  R  +  + I + DV+D  PVF  + +   + E  G  PK  ++++   D D+G N Q+ Y +   +    F + A+G +     L+  T+  + L+I A     P +     +TV + ++ND  P  S  + +  +  + P G+ +  + + DSD G +G ISY      L+      ++   +G I  S  L       ++  +V  D       SS+A + + V D N++ P    +  V ++ +S   GS +  +   D+D   N ++ + L    S  F +        A   +    E        + + D   +P+       + TV +++     FP  I       T PE+  + + +TK       +    +Y       + N  ++D  SG+L + K L+Y    +++L +     G P
Sbjct:   16 AILASDGDSGVNGEITYSVEEDDEDSTFLLNPITGVFNVTRALDFETQPFFILTVRAADG----GGRSSSVRVYFNLLDVNDHPPLFNSSVYTTSILESLSAGASVLTVSAADRDHGP-NADLHYSIASGDPQSQFSITNTGVLHTTKTLDRETQSFYNLVITVNDLALPPSTRF--TSTAQISIILLDVNDCAPV-FTSPRTAYIQENTPVDMRVFTAQASDADSGPNSYVEYSLSG-AFGSKFGIGMIDG---GVTLLGELDREEMENYTLTIVATDKGDPPLSSSMEVIMMVLDVNDNTPSFSQNIYD---IEIQENTLTGTDILQVFASDADEGTNGQIRFSITGGNLNSDFRMDSVTGVISVAKL--LDRESRSSYSLQVQAADRGSSPRVDRATVNIVLLDVNDCAPVFELSPYTISVQENLGNLPKN-ILQVVARDDDLGTNGQISYSLSSGNDAGAFSLSASGQLNLIHTLDRETQDTHTLIITAHDAGLPSLSGSGTVTVLVGDVNDNIPSFSSMSFHTTIPEDAPTGTDVLLLNSSDSDVGLNGVISY-----SLSGGDGQFSINPSTGLIITSSLLDRETRASYQLLVVASDGGQPTPLSSSATVSVVVADINDNPPRFHHHPYVTHIPASTSTGSLVFAVTVTDEDSGSNSQLHYSLTGRNSEKFKIDPIRGAITASEKLTGSSE----VTFTVHVKDGGTNPKTD-----STTVTVRFVTGGDFPH-IKLKDKAFTFPENQPTNTIVTKVTGSSPRAGPLSYYIASGN--LDNAFHIDQLSGELSIRKPLDYENIEKYVLWIEARDQGFP 803          

HSP 11 Score: 92.4337 bits (228), Expect = 1.326e-17
Identity = 98/385 (25.45%), Postives = 171/385 (44.42%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDT------KNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQIL-------WTGGL--SEINRDISPNTIVAHVKLTDYDAIS--TSFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHE 1327
            F +   TGV+ ++  +D E +  +   + + +G          V I++ DVNDN P F+   +   + EN P G+ V      D D G N++ +  I S DS+ +F ID    + GI    +  +  LDYE    ++L ++A +       +   V I ++ AN+ VP+F   +Y   I E          V A+D D G  G ++Y +   S     F+++ KTG +Y+  SLD EK +   IS+ V         +K    I   DI++   +I +L       +T  L   ++N  +SP  +V  V   D D++   + F   I          I P+  ++ + +++        NLT+ AVD   P+ + +  L + + +
Sbjct: 1295 FSVHSQTGVLSLAKTLDYETKQKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVFDPVEYFPVVQENVPSGTTVVKMNATDKDSGSNALMAYVIQSSDSD-LFIID---PNTGI----ITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFAYVNIQLKGANEYVPRFVSKQYYFEISEAAPKGTVVGEVFASDRDLGEDGVVYYLIFGRSRKRG-FSINKKTGQIYVSGSLDREKEE--KISLKV--------LAKNAGSIRGADIDEVLVNITVLDANDPPVFTQELYDVQVNEGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHERNTFTINPQTGQVSVASELDRETVPVYNLTILAVDSGSPAATGSAILIVTLED 1660          

HSP 12 Score: 90.1225 bits (222), Expect = 6.466e-17
Identity = 314/1429 (21.97%), Postives = 573/1429 (40.10%), Query Frame = 2
Query: 4520 IFQIVATDADSGPNSKLTYQINP-SSDGIFMINGDSGEIHLVSSPRVSAYE------LNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREE-------IGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFS--RSIF-KVKLPEDEAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLS-CSPLNFMEKNIYNLKIIATDSEG--LSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRI--NIVKPPVNSEIFYVLNPG--HSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFI-PNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVP----SKCTTVLI-DISLN----QDHQYVQIVPEKAIFRVKE---NSVDGTFIGQIKMVNYC-KDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGG--SEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKD-SDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARF---SSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEP-----------QEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKAIF--YKIDN------FHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKEN-KGPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKN-SFRYS-YYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESRIWNLTIMIVKAQKYQNSPS--NLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHDI-----------QYFLTPHENFELTCS-QSQSSGCNIKSKSVLDFETHE-----------NYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRF--GIVSYQIVENPSEN-FGINNETGAIYIKNQFIIEKKDKQRVKRSETN 8521
            +  I+A+D DSG N ++TY +     D  F++N  +G  ++    R   +E      L V   D G    SV V F++    +         ++S+     L    +G  +  +S +      N D+ Y + +G     FS+   TG + T  ++ RE        I  +++   P    S    S   +  I +++   N+  P F+  R+ + +   P D  +    T  A+D D G    + YSL G  F  K  I    G ++    L+  E   Y L I+ATD     LS+      +VI+ V +   +T +F+   + +++ EN+  GT + ++  +      N +I + +  G  +S  ++++ TG +     L  E      L + A  +  S R      A +++ ++D+ND  P+   +P  I +  N     K + ++ A D D  +N    +  S       + +      SG L L  ++    +  H L +   D G+P    S   TVL+ D++ N        +   +PE A         NS D + +G   +++Y       +FSI           + STG I  ++   +DRE      L    S GG  + +     V + V D++DN P F  + +V  +       + V  +TV D D G NSQ+ Y +   +S E+F ID   G +  +  L   ++  + + +K     +P   +   +TV  V   D  P I + ++      N+P  + +TK+T      GP  +SY I    L N     ++   SGE+ + + L   ++ K+   I   D  F   S+   +EI V D N++ P+ ++      +  +L    ++L + A+D+D   NG++ + ++           D N    F I+             +EK   Y L ++ TD  + P+   + +    + +      F ++        T+PE+   G  +T+    D D+       Y I +       HP          +GD+ +++ LN      ++  V+    G      S ++++ +   N   P      Y    L  PE+ +  +I++ +   D +  F    +Y I    E          F+I+SS      +G++F          I +  +YQNS    N+  N + F+ +   ++ I  L    E   +  V++ N+ P T   + P ++  +           +      ++F L    +   SG N  +K  LD +T             N    L I  S       S    V+I+V + + + PEF     T  V   +  +G  + T  A DKD+ +   G+++Y I     +  F ++++TG + +      E K K  ++ S T+
Sbjct:   14 VAAILASDGDSGVNGEITYSVEEDDEDSTFLLNPITGVFNVT---RALDFETQPFFILTVRAADGGGRSSSVRVYFNL----LDVNDHPPLFNSSVYTTSILESLSAGASVLTVSAADRDHGPNADLHYSIASGDPQSQFSITN-TGVLHTTKTLDRETQSFYNLVITVNDLALPP----STRFTSTAQISIILLDV---NDCAPVFTSPRTAYIQENTPVDMRV---FTAQASDADSGPNSYVEYSLSG-AFGSKFGIGMIDGGVTLLGELDREEMENYTLTIVATDKGDPPLSSS----MEVIMMVLDVNDNTPSFSQNIYDIEIQENTLTGTDILQVFASDADEGTNGQIRFSITGGNLNSDFRMDSVTGVISVAKLLDRESRSSYSLQVQAADRGSSPR---VDRATVNIVLLDVNDCAPVFELSPYTISVQENLGNLPKNILQVVARDDDLGTNGQISYSLSSGNDAGAFSL----SASGQLNLIHTLDRETQDTHTLIITAHDAGLPSLSGSGTVTVLVGDVNDNIPSFSSMSFHTTIPEDAPTGTDVLLLNSSD-SDVGLNGVISYSLSGGDGQFSI-----------NPSTGLIITSSL--LDRETRASYQLLVVASDGGQPTPLSSSATVSVVVADINDNPPRFHHHPYVTHIPASTSTGSLVFAVTVTDEDSGSNSQLHYSLTGRNS-EKFKIDPIRGAITASEKLTGSSEVTFTVHVK-DGGTNPKTDST-TVTVRFVTGGD-FPHIKLKDKAFTFPENQPTNTIVTKVTGSSPRAGP--LSYYIASGNLDNA---FHIDQLSGELSIRKPLDYENIEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVFEQEPFHAEILENLSP-QRVLVVSALDQDSGPNGQLEYAII-----------DGNKENSFNINRATGEIRTTRPLDREKVAQYSLRVKATDRGMPPKSTAVKVLISVLDVNDNAPRFSKIF-----SATVPENAPVGFTVTRVTTTDEDAGANAISRYSITDASLPFIIHP---------STGDITISRPLNREDTDHYIAKVSAHDSG---WTVSTDVTIFVTDINDNAPRFSKPSYY---LDYPELTEIGSIVTQVSATDPDEGFNGKIFYFIRSQTEY---------FRINSS------SGEIF----------IKQQLRYQNSSGHNNINVNRHSFI-VTASDRGIKPLMS--ETTVMINVVDSNDNPPT--FESPSYFTPVTKSVKVGTRLLKVTAYDKKDFGLNSEIEYAISGGNSSNKFRLDKQTGSVTVASSLAADTNKVYLLEITASDKGNPPLSDRTTVKIAVTEENHHTPEFSQNQVTVTVSEAL-TVGTAIRTLSARDKDKDKQMNGLITYNISSGNDDGLFSVHSQTGVLSLAKTLDYETKQKHELRVSATD 1326          

HSP 13 Score: 88.9669 bits (219), Expect = 1.330e-16
Identity = 69/230 (30.00%), Postives = 113/230 (49.13%), Query Frame = 2
Query:  239 TTGVIKVSGLIDREKQNLYSFLIISMNGD------TKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHP-PLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSL 907
             +G + +   +DRE Q+ ++ +I + +        +  V + + DVNDN P F++ +F  +IPE+ P G+ V L    D D G N + S  +  GD +  F+I+    S G+    +I    LD E  + + L++ A DGG P PL +S  V ++V + NDN P+F    Y+  I            V  TD D+G + +L Y L  T  +S+ F +D   G +   + L
Sbjct:  466 ASGQLNLIHTLDRETQDTHTLIITAHDAGLPSLSGSGTVTVLVGDVNDNIPSFSSMSFHTTIPEDAPTGTDVLLLNSSDSDVGLNGVISYSLSGGDGQ--FSIN---PSTGL----IITSSLLDRETRASYQLLVVASDGGQPTPLSSSATVSVVVADINDNPPRFHHHPYVTHIPASTSTGSLVFAVTVTDEDSGSNSQLHYSL--TGRNSEKFKIDPIRGAITASEKL 684          

HSP 14 Score: 88.5817 bits (218), Expect = 1.923e-16
Identity = 87/305 (28.52%), Postives = 144/305 (47.21%), Query Frame = 2
Query:  107 SNLLIFSIKENVPIGEVVGQI----ESPGFSP--PFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGD---TKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFN--------LVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATD-NDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            S +   ++ EN P+G  V ++    E  G +    + + D     FII  +TG I +S  ++RE  + Y   + + +     + +V I + D+NDN P+F+  ++    PE   IGS V   +  DPDEG N      I S    + F I+   SS+G     + +KQ L Y+  S  N         ++ A D G  PL +   V I V ++NDN P F+   Y   + +  ++    L+V A D  D G++ E+ Y +   + SS+ F +D +TG+V +  SL  + +K + + I   D   P
Sbjct:  930 SKIFSATVPENAPVGFTVTRVTTTDEDAGANAISRYSITD-ASLPFIIHPSTGDITISRPLNREDTDHYIAKVSAHDSGWTVSTDVTIFVTDINDNAPRFSKPSYYLDYPELTEIGSIVTQVSATDPDEGFNGKIFYFIRS--QTEYFRIN---SSSG----EIFIKQQLRYQNSSGHNNINVNRHSFIVTASDRGIKPLMSETTVMINVVDSNDNPPTFESPSYFTPVTKSVKVGTRLLKVTAYDKKDFGLNSEIEYAISGGN-SSNKFRLDKQTGSVTVASSLAADTNKVYLLEITASDKGNP 1223          

HSP 15 Score: 84.3445 bits (207), Expect = 3.470e-15
Identity = 105/419 (25.06%), Postives = 187/419 (44.63%), Query Frame = 2
Query: 4241 NLEVVYSIKQPEK--YFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQI---NPSSDGIFMINGDSGEIHLVSS---PRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQS----KSGFIIGQLSYSQTSSSGNLDIRY--YLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAI-TNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCSPLNFME-KNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLEN 5449
            N E+ YS+++ ++   F++NP+TG     R  D ET+    F++  +       +  +V  +   + D ND+ P + + S     I    +  AS+  + A D D GPN+ L Y I   +P S   F I  ++G +H   +      S Y L +TV D    P       S  F S    S I    N  +   + P++    ++  +  ++  +Q S + +    Y  Y ++G F   F +  I G V     + REE+ N  +    +V     D  +     + + +   N+N P FS++I+ +++ E+    T+ L V A+D D G  G+I +S+ G   +    +D  TG +S + L   E ++ Y+L++ A D    S+ R D   V I + +       F  + +++ V EN
Sbjct:   27 NGEITYSVEEDDEDSTFLLNPITGVFNVTRALDFETQ---PFFILTVRAADGGGRSSSVR-VYFNLLDVNDHPP-LFNSSVYTTSILESLSAGASVLTVSAADRDHGPNADLHYSIASGDPQSQ--FSIT-NTGVLHTTKTLDRETQSFYNLVITVNDLALPP-------STRFTSTAQISIILLDVNDCAPVFTSPRTAYIQENTPVDMRVFTAQASDADSGPNSYVEYSLSGAFGSKFGIGMIDGGVTLLGELDREEMENYTLT---IVATDKGDPPLSSSMEVIMMVLDVNDNTPSFSQNIYDIEIQENTLTGTDILQVFASDADEGTNGQIRFSITGGNLNSDFRMDSVTGVISVAKLLDRESRSSYSLQVQAADRG--SSPRVDRATVNIVLLDVNDCAPVFELSPYTISVQEN 425          

HSP 16 Score: 83.9593 bits (206), Expect = 4.853e-15
Identity = 76/303 (25.08%), Postives = 136/303 (44.88%), Query Frame = 2
Query:  122 FSIKENVPIGEVVGQIESPGFSPPFEMHD-----------FQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNG--------DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEK-VFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDND-AGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            F I E  P G VVG++    F+   ++ +            +++ F I+K TG I VSG +DREK+   S  +++ N         D   V I +LD ND  P F    ++  + E    G  V   +  D D   +  +    ++ + E+  F I+           ++ +   LD E +  +NL I A+D G P    S ++ + +++ NDN P   ++ Y   + E+Q      + + + D D A   G   Y L +T  +S +FT+   TG +   + +D E+    ++S+ ++D+  P
Sbjct: 1463 FEISEAAPKGTVVGEV----FASDRDLGEDGVVYYLIFGRSRKRGFSINKKTGQIYVSGSLDREKEEKISLKVLAKNAGSIRGADIDEVLVNITVLDAND-PPVFTQELYDVQVNEGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHERNTFTINPQTG-------QVSVASELDRETVPVYNLTILAVDSGSPAATGSAILIVTLEDINDNGPTL-VTTY-GEVMENQRAGTPVMTLSSRDPDLAPNQGPFTYSLVSTGAASSYFTIS-PTGELTTSREVDREQISDFYLSVLIKDSGIP 1750          

HSP 17 Score: 80.1073 bits (196), Expect = 6.751e-14
Identity = 109/433 (25.17%), Postives = 188/433 (43.42%), Query Frame = 2
Query:  287 NLYSFLIISMNGDTK------NVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDP-DEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEIN--ITFLRVRATDNDAGVSGELFYFLDNTSPSSD--FFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDAISTSFDLEILNRSPFQLIKILPKMWELKLINDIG--NYKSNSI-NLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEIDSTILNENQHVTFVKTTKRLPTKPIFIFKIFVLNNL--FKINETTGEILSKRSID 1537
            N +SF++ + +   K       V I ++D NDN P F + ++   + ++  +G+++   T +D  D G NS     I  G+S   F +D    S       + +  SL  +    + L I A D G+PPL     VKI V   N + P+F  ++   ++ E   +   I  L  R  D D  ++G + Y   N S  +D   F+V  +TG + L K+LD+E  + H + +   D      TS V V I V D+NDNPP    +       +  ++   T V  +  TD D+ S +    ++  S   L  I P      +I   G  +Y++  + +LT+KA + P+    +   + I++  +  +   F   ++  EI               + + L    +  + IF  +    F IN+ TG+I    S+D
Sbjct: 1103 NRHSFIVTASDRGIKPLMSETTVMINVVDSNDNPPTFESPSYFTPVTKSVKVGTRLLKVTAYDKKDFGLNSEIEYAISGGNSSNKFRLDKQTGS-------VTVASSLAADTNKVYLLEITASDKGNPPLSDRTTVKIAVTEENHHTPEFSQNQVTVTVSEALTVGTAIRTLSARDKDKDKQMNGLITY---NISSGNDDGLFSVHSQTGVLSLAKTLDYETKQKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVFDPVEY--FPVVQENVPSGTTVVKMNATDKDSGSNALMAYVIQSSDSDLFIIDPNT---GIITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFAYVNIQLKGANEYVPRFVSKQYYFEISEAAPKGTVVGEVFASDRDLGEDGVVYYLIFGRSRKRGFSINKKTGQIYVSGSLD 1520          

HSP 18 Score: 78.9518 bits (193), Expect = 1.245e-13
Identity = 117/471 (24.84%), Postives = 192/471 (40.76%), Query Frame = 2
Query:  215 EKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGD-------TKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYF-----LDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNS-PPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDAISTSFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEIDSTILNENQHVTF-----VKTTKRLPTKPIFIFKIFVLNNLFKINETTGEILSKRSI---DCGKYFFNVS 1564
            + +F I+ +TG+I  S L+DRE +  Y  L+++ +G        +  V + + D+NDN P+F+   +   IP +   GS V   TV D D G NS     +   +SEK F ID          +R  +  S      S+    +   DGG  P   S  V +      D  P   +     +  E+Q  N    +V  +   A   G L Y+     LDN       F +D  +G + +RK LD+E  + + + I  RD   PP+   +   I  +   +++P   Q  +    +EI  ++SP  ++    L      +   +  I++ +      I     E++    +   K    +L +KA D   P  ST     +K+  S+L  N  +  RF  +I S  + EN  V F       T +      I  + I   +  F I+ +TG+I   R +   D   Y   VS
Sbjct:  561 DGQFSINPSTGLIITSSLLDRETRASYQLLVVASDGGQPTPLSSSATVSVVVADINDNPPRFHHHPYVTHIPASTSTGSLVFAVTVTDEDSGSNSQLHYSLTGRNSEK-FKID---------PIRGAITASEKLTGSSEVTFTVHVKDGGTNPKTDSTTVTVRFVTGGD-FPHIKLKDKAFTFPENQPTNTIVTKVTGSSPRA---GPLSYYIASGNLDNA------FHIDQLSGELSIRKPLDYENIEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVFEQEPFH---AEILENLSPQRVLVVSALDQDSGPNGQLEYAIIDGNKENSFNINRATGEIRTTRPLDREKVAQYSLRVKATDRGMPPKST----AVKVLISVLDVND-NAPRFS-KIFSATVPENAPVGFTVTRVTTTDEDAGANAISRYSITDASLPFIIHPSTGDITISRPLNREDTDHYIAKVS 1002          

HSP 19 Score: 60.077 bits (144), Expect = 6.699e-8
Identity = 72/300 (24.00%), Postives = 124/300 (41.33%), Query Frame = 2
Query:  128 IKENVPIGEVVGQIESPGFSP------PFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKN------VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQAS----LLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTS 979
            ++ENVP G  V ++ +            + +       FII   TG+I   G +D E + +Y   + + N   +       V I++   N+  P+F +  +   I E  P G+ V      D D G++ +    I     ++ F+I+      G  YV      SLD E   + +L + A + G   ++ +    +LV I V +AND  P F    Y   + E          V A D+D+  S   F +    +   + FT++ +TG V +   LD E    ++++I   D+  P  T 
Sbjct: 1361 VQENVPSGTTVVKMNATDKDSGSNALMAYVIQSSDSDLFIIDPNTGIITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFAYVNIQLKGANEYVPRFVSKQYYFEISEAAPKGTVVGEVFASDRDLGEDGVVYYLIFGRSRKRGFSIN---KKTGQIYV----SGSLDREKEEKISLKVLAKNAGS--IRGADIDEVLVNITVLDAND-PPVFTQELYDVQVNEGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHERNTFTINPQTGQVSVASELDRETVPVYNLTILAVDSGSPAATG 1650          
BLAST of Dachsous vs. Ensembl Xenopus
Match: ENSXETT00000014916.1 (dachsous cadherin-related 1 [Source:NCBI gene;Acc:100494036])

HSP 1 Score: 251.521 bits (641), Expect = 1.030e-65
Identity = 381/1593 (23.92%), Postives = 666/1593 (41.81%), Query Frame = 2
Query: 4103 LYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLK----NLEVVYSI-----KQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVI--ATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSD-GIFMIN---GDSGEIHLVSS---PRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQT-SSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNEN--PPRFSRSIFKVKLPEDEAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCS-PLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKP---PVNSEIFYVLNPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPA--ENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAI-FRVKENSVDGTFIGQIKMVNYCKDHSA-KFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEY-FIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDS--------GEIFLSRKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTE-----ITIPESLKSGSKITKFVCKDLD---SDKAIFYKI-----DNFHPISNNLYL---DFES-GDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQM-----DKNSFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESRIWNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHDI----QYFLTPHENFELTCSQS------------QSSGCNIKSKSVLDFETHE--NYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIVENPSENFGINNETGAIYIKNQFIIEKKDKQRVKRSETNEEALKSYRKSFQFRISASSGVKTSYAYVELTMLIPGIKPSM 8644
            ++I V V       P F +D P  L + E+   GS V +F          N +V YS+       P   F ++  TG L   +  DRE  +     VE    A +VS  +  +V   +  I+D ND+ P  ++P   +V +       ++   +VA D D G N K+ YQ+   +D G F ++   G SG + +V +        Y L V   D G    S +   S+    +  ++   F        +   Q     ++  ++  +    SG   + Y  ++G     F++DP TG + T+  + RE     E+ ++ V  +     S   L  + + +  G+EN  PP F R +  +++PE++   +   + A DPD G  GR+ Y L GD       +D + GKLS S PL+      Y L +  +D  G +        V I V +   +T AF+A+ FS +V E++P G+++  ++ V P   P     +++ N       I+  TG + T   L  E        + A    I +  +   SA   V ++  + N   PA   +P  + +  +   ++ +  + A D D  +N +  + R  P + T    + +D  +G + L   +         + V  +D G P   +T ++ + L ++       P++AI   + ENS +G+ +G     +         +S + G  +  + +H +TG+I VA AA +D E+  +  L  Q      +   +  + I + D++DN P F   ++ A+  E QP  +P+I++   DPD G N QV Y F +  + ++ F ID   G + T   L+    S   LV+ A+ + SP + +   LTV + ++ND  P   +    L +  +  +GS I ++T  D D    +SY          TL ++ A +         G+I+LSR+L   D   +   +   D +  + A + + ++D N++ P   ++   +++      G+ +  + A D+D  DNG+V++ ++S                 F I       HP        DN      R + +F           YFP L      E      ++PE L  GS +      D D    + A+ Y I     DN   + + +      F+  G + LT SL++     + L +  +  G P++  S  + + +   N  P +      ++ L      ++  + S +L++     D  S    +Y I+   E          FQI+ +     +   L   R   L  ++V A   Q   +N     +  V + +  + I + +    ++ LT  I EN+P  T + K+     D     Q F T     +L  + S            ++SG  ++SK   D+E  +  N  ++ +  G++      S T+ V++ V   DEY P F+   F   V  G  K G+ L    A+D+D G  G+V Y     PS  FGIN  TG IY+K     ++    R KR ET E  L+ +  S       SS V T+   V++T    G+ P +
Sbjct:  739 VHIEVEVQDRNDHSPAFPED-PLTLVVPEDAHVGSSVFTFQASDHDGPGPNSQVRYSLLRQDPGSPGSTFRLDAETGVLYVAQALDREEVSSYLLVVEASDQAVNVSQQRSTSVTARVF-ISDRNDHAPQFITPL--VVWLPEDLPVGSTAIYMVAQDPDLGDNGKVGYQLVGGNDEGKFQLHPSSGMSGALTVVRTLDRETTEGYNLTVVAMDHGSPRLSSTQTLSVSLLDVNDEAP-SFEKPQYDAQVQENQPVGTTVLRVVALDRDLGQSGR--VTYGGVSGDE---FALDPETGVLTTKVPLDREA---KELYKLTVYARD--GGSPPRLSEVGVQVRVGDENDHPPTFERDLVLLEVPENQEPMDLCVLSAWDPDGGENGRLKYRLIGDP-SGDFTLDSANGKLSTSRPLDRETTPKYQLVVSVSD--GGAPPLSATAMVNINVLDLNDNTPAFSASAFSAEVPEDAPVGSLVLHLSAVDPDDGPSGQTTYHLSNGTQGAFYIDPLTGRITTATQLDRERRASYTFLVWA----IDSDPVGPRSAEATVTVLVRDVNDNAPAFLRSPFHLNLSRNTPTKRAIAAMKAEDKDAGANASILY-RLAPASAT--GGFSVDPYTGEVRLLEPLSGMSPKERTVFVQATDLGEPPLSSTAVLVVHLREEAPQGPRFPQEAIEISLPENSPEGSVVGTATAAHTGGSTGRISYSFLSGNENGALRIHPTTGQITVAQAAMLDYEQNPRHKLVLQAET--QQHLSFATLTISLLDLNDNAPRFKLPRYTAYTQEAQPDGSPLIQVLAEDPDQGLNGQVTYSFDQSQAMKDLFRIDPQTGAITTAAILDREIWSQAHLVVIATDRGSPPLTSSATLTVLVTDVNDNSPTTPL-QLELSVPEDAVIGSEILQVTGNDVDSGPALSY----------TLLVDGAMEGAFTMLRYGGQIWLSRQLDYEDRKSYSLTVQTSDGKHLTHAELTLTLQDVNDNSPEFGKSLYQVSILEHAAAGTPLFTVRATDRDSGDNGRVSYRVLSP------------VGGAFHI-------HP--------DNG-----RYICLFL----------YFPPLTLRCHFEPLPLSASVPEDLPLGSTVLILEVTDADFTQENAALDYTILSGNTDNAFQVQSGMRFWNGRFQQIGSIILTDSLDFEAISFYNLTLGASDRGVPQRSHSVPVLINVLDINDNPPVFPRPLYSVLLS-----EEAPVGSEVLRVLAQDSDSGSNGLVHYSITSGDES-------RLFQINEATGAIRLARHLDRER-QALHALVVLALDGQGGQAN-----FALVPVTIEVRDINDNKPYFPVQILTTSIRENQPANTPLTKIHAIDLDTGVYGQLFYT---MLDLAVAGSGMLMGKDMFVVNRTSG-ELRSKQSFDYERIKVFNMVVKAMDAGNF------SATVTVQVLVTGEDEYNPVFISPFFNFEVPEGAVK-GESLGHVQATDEDEGADGVVLYSF-SKPSPYFGINETTGNIYLKTDS--QRHRSGRSKR-ETREMTLEVHAHS----PLPSSRVATAQVTVDVTHTSFGLAPDL 2214          

HSP 2 Score: 169.474 bits (428), Expect = 7.190e-41
Identity = 110/348 (31.61%), Postives = 181/348 (52.01%), Query Frame = 2
Query:  116 LIFSIKENVPIGEVVGQIESPGFSPPFEMHDF----QEKKFI-----ISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLD-NTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNS--PPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYD 1123
            L   I E  P G ++G I S G  P    + F    QE   +     I + TG+IK + ++DREK+N YSF+ ++  G T  V I + D+ND+ P F+    E SIPE+ P+G++  +    D D G  S Q   I SGD  + F ++    SNG+  V L++   +D E  S ++LV++A DGG P   + + + I++ + ND+ P F+ SRY A I E      + L+V ATD D G +G++ Y ++   S    +FT++ ++G + + K LD+E  K H + +  +D +  P   T+ V + +   + N    +I  L   G   ++   +P   VA + ++D D
Sbjct:   24 LELHIDEEQPAGTIIGDI-SAGLPPGSTGYMFFISAQEGSGVSTDLDIDENTGIIKTAKVLDREKRNHYSFIAVTPEGTTVEVDIHVDDINDHSPTFSKGRTELSIPEHTPLGTRYPVDPAMDSDSGVLSTQGYLIRSGDPLQKFRLETRRVSNGVLEVELVVSSDIDRENQSSYSLVLEAYDGGSPTRSSQMRLDIVILDINDHAPVFNQSRYQALISESLLPGASVLQVYATDADQGPNGDVRYEINRRQSDPEGYFTINAQSGLIQINKPLDYETRKVHELVVQAKDGAEQPEVGTAFVSIQVRDSNDNQPSMTIIFLSEDGAPRVSEGANPGQYVARISVSDPD 370          

HSP 3 Score: 143.28 bits (360), Expect = 5.702e-33
Identity = 242/1026 (23.59%), Postives = 420/1026 (40.94%), Query Frame = 2
Query: 4556 PNSKLTYQINPSSDGIFMINGDSGEIHLV------SSPRVSAYELNVT-VRDS--GEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLI---AGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSL---HDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAI-TNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSC----SPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVI-IFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPV--NSEIFYVLNPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDR-SDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDIS-LNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAK--FSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLT-NQTLFLNVAFDSGEIFLSRKLLV--SDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAAL----FLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKAIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIV 7528
            P+    Y +     GIFM++G +G I LV      S PR S + ++V  VR++  G VP  V V   +  Q     S          +        S     Q S        N  +RY L+    G     F +D  TG +    ++ REE+ +S ++ +    Q++      S     R+FI+    N++ P+F   +  V LPED  + +  + +VA DPDLG  G++ Y L G   + K  + PS+G          L+      YNL ++A D     + R   T+ + + + +      +F    +  +V EN P GT + R+  +   +  +  + Y    G     ++  TG L T  PL  E  E  +LT++A       R    +   + VR+ D ND+ P    + V + +P + +P   L  LSA D D   N   ++    DP+       + LD  +G L     +      ++ L V VSD G P    T +++I+ L+ +              V E++  G+ +  +  V+     S +  + + +G      ++   TG+I  A     +R      ++W   S           V + V DV+DN P F ++ F   L+   P K  +  +   D D G N+ + Y +   S+   F +D   G+V+   PL+  +     + ++A+    P + +   L V++     Q P+       + L  N P GS +   TA  + G  G   RI +  L+ N+   L +   +G+I +++  ++      +H+  +  +  +  S A + I + D N++ P  K          +   GS ++ + A D D   NG+VT+    +     L   D  T A+     L  E   + H   L +  TD    P   L S   LTVL+       P        E+++PE    GS+I +    D+DS  A+ Y +     +     +    G ++L++ L+Y  +  + L V
Sbjct:  678 PHGSRIYTLLDEPHGIFMVDGQTGSIFLVGELDFESQPRFS-FRVSVEEVREASLGYVPPHV-VHIEVEVQDRNDHSPAFPEDPLTLVVPEDAHVGSSVFTFQAS-DHDGPGPNSQVRYSLLRQDPGSPGSTFRLDAETGVLYVAQALDREEV-SSYLLVVEASDQAVNVSQQRSTSVTARVFISDR--NDHAPQFITPLV-VWLPEDLPVGSTAIYMVAQDPDLGDNGKVGYQLVGGNDEGKFQLHPSSGMSGALTVVRTLDRETTEGYNLTVVAMDH---GSPRLSSTQTLSVSLLDVNDEAPSFEKPQYDAQVQENQPVGTTVLRVVALDRDLGQSGRVTYGGVSG-DEFALDPETGVLTTKVPLDREAKELYKLTVYARDGGSPPR---LSEVGVQVRVGDENDHPPTFERDLVLLEVPENQEPMD-LCVLSAWDPDGGENGRLKYRLIGDPSGD-----FTLDSANGKLSTSRPLDRETTPKYQLVVSVSDGGAPPLSATAMVNINVLDLNDNTPAFSASAFSAEVPEDAPVGSLVLHLSAVDPDDGPSGQTTYHLSNGTQGAF-YIDPLTGRITTATQLDRERRASYTFLVWAIDSDPVGPRSAEATVTVLVRDVNDNAPAFLRSPFHLNLSRNTPTKRAIAAMKAEDKDAGANASILYRLAPASATGGFSVDPYTGEVRLLEPLSGMSPKERTVFVQATDLGEPPLSSTAVLVVHLREEAPQGPRFPQEAIEISLPENSPEGSVVGTATAAHTGGSTG---RISYSFLSGNENGALRIHPTTGQITVAQAAMLDYEQNPRHKLVLQAETQQHLSFATLTISLLDLNDNAPRFKLPRYTAYTQEAQPDGSPLIQVLAEDPDQGLNGQVTYSFDQSQAMKDLFRIDPQTGAITTAAILDREIWSQAH---LVVIATDRGSPP---LTSSATLTVLVTDVNDNSPTT--PLQLELSVPEDAVIGSEILQVTGNDVDSGPALSYTLLVDGAMEGAFTMLRYGGQIWLSRQLDYEDRKSYSLTV 1671          

HSP 4 Score: 141.354 bits (355), Expect = 2.259e-32
Identity = 225/963 (23.36%), Postives = 410/963 (42.58%), Query Frame = 2
Query: 2576 SDLLVNIWENTTVGIEIMQVFPKYPSVSDEYQIIQSQYSDWLSIHSKTGQIFLNKQFDRE---QVSYLVVTVQLKNL----IGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADS-FPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRII--DANNHSPILISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSL---KQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSL--SCAQNVKIRIFVSDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFI-IPDHSQPGYVVGDLNIFP-------ENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGS---HVASFNIRRLKNLEVVYSIKQ-PEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINP-SSDGIFMINGDSGEIHLVSS-PRVSAYELNVTVR--DSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHS--VSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITN--------FLTVVANDPDLGIFGRIIYSLEGDTFDKKIF-IDPSTGKLSCSPLNFMEKNIY---NLKIIATD 5329
            S L+++  E    G  +  + P+ P  S  Y ++   +  ++ +  +TG IFL  + D E   + S+ V   +++      +    + + + + D ND+ P            + + +G      + SD D   PN  + Y +    P    + F ++  TG L +  +L+      S  + L+V  SD       +    ++ R+   D N+H+P  I+  V ++ +    G+    ++ +D D+G+NG++   L        +Q      +S    V+R    ET   Y    N+ ++A D GSP  SS   L ++ ++ N   P    P+   Q+    P+  G+ +  V A+D D G +    Y       + D+  +D  TG++TTKV L     +  K+ ++  D G P   S V   ++ + +         ++L  + +P++ +P     DL +         EN   K   I + +    G   L   + +L   +         Y L V  +      +S+   +N+ V  +  + P FS  S    E+ E+ P GS   H+++ +     + +  Y +    +  F I+P+TG++ T    DRE      F V  I +    P+      + V + D NDN P  L  S   + +S  T    +I  + A D D+G N+ + Y++ P S+ G F ++  +GE+ L+     +S  E  V V+  D GE P S + V  +H +  +     RF   ++ ++L    S  G ++G  + + T  S    I Y  ++G       + P TG +    +  +  E+    ++V      Q L  A++       I++   N+N PRF       KLP   A T          + V+A DPD G+ G++ YS +     K +F IDP TG ++ + +  +++ I+   +L +IATD
Sbjct:  654 SSLVLSPMEGLAPGSLLGSLAPRMPHGSRIYTLLDEPHGIFM-VDGQTGSIFLVGELDFESQPRFSFRVSVEEVREASLGYVPPHVVHIEVEVQDRNDHSPAFPEDPLTLVVPEDAHVGSSVFTFQASDHDGPGPNSQVRYSLLRQDPGSPGSTFRLDAETGVLYVAQALD--REEVSSYL-LVVEASDQAVNVSQQRSTSVTARVFISDRNDHAPQFITPLVVWLPEDLPVGSTAIYMVAQDPDLGDNGKVGYQLVGGNDEGKFQLHPSSGMSGALTVVRTLDRETTEGY----NLTVVAMDHGSPRLSSTQTLSVSLLDVNDEAPSFEKPQYDAQVQENQPV--GTTVLRVVALDRDLGQSGRVTYGGV----SGDEFALDPETGVLTTKVPLDREAKELYKLTVYARDGGSPPRLSEVGVQVR-VGDENDHPPTFERDLVLLEVPENQEP----MDLCVLSAWDPDGGENGRLKYRLIGDPS----GDFTLDSANGKLSTSRPLDRETTPKYQLVVSVSDGGAPPLSATAMVNINVLDLNDNTPAFSA-SAFSAEVPEDAPVGSLVLHLSAVDPDDGPSGQTTYHLSNGTQGAFYIDPLTGRITTATQLDRERRASYTFLVWAIDSDPVGPRSAEAT-VTVLVRDVNDNAPAFLR-SPFHLNLSRNTPTKRAIAAMKAEDKDAGANASILYRLAPASATGGFSVDPYTGEVRLLEPLSGMSPKERTVFVQATDLGEPPLSSTAVLVVHLRE-EAPQGPRFPQEAIEISLPE-NSPEGSVVGTATAAHTGGSTGR-ISYSFLSGNENGALRIHPTTGQITVAQAAMLDYEQNPRHKLVLQAETQQHLSFATLT------ISLLDLNDNAPRF-------KLPRYTAYTQEAQPDGSPLIQVLAEDPDQGLNGQVTYSFDQSQAMKDLFRIDPQTGAITTAAI--LDREIWSQAHLVVIATD 1572          

HSP 5 Score: 131.724 bits (330), Expect = 2.116e-29
Identity = 310/1464 (21.17%), Postives = 572/1464 (39.07%), Query Frame = 2
Query: 4307 QLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQIN---PSSDGIFMINGDSGEIHL---VSSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTK--SKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIA--GKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNF-LTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKL-SCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIV-------KPPVNSEIFYVLNPGHSHIQINTTTGELRTNGPLHL---ELVEFIELT--IHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSD------NGVPSKCTTVLIDISLNQDHQ-------YVQIVPEKA-----IFRVKENSVDGTFIGQIKMVNYC---KDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNK----PVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLI----DANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVV------DDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVST-SPWFGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDP--QKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKA--IFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQI---EKENKGPNLIDNKY-ITLSLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIY--DPPSFQIDSSNILWWINGDLFESRIWNLTIMIVKAQKYQNSPSNLYENGYLFVNI--EVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHD------IQY-FLTPHENFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIVENPS--ENFGINNETGAI 8455
            +LV     DRE  NQ  + + + A    +P   + + L + I D ND+ P + + S     IS      AS+ Q+ ATDAD GPN  + Y+IN      +G F IN  SG I +   +       +EL V  +D  E P+  +   SI  +       S      +          +  G  + ++S S      + D+   L    GKFA + + D I   +     + REE    +  ++ V+        +       + +   N+NPP F R  +   +PE     +F L V A D D G+ G + YSL    +     I+P TG + + +PL++ ++    + ++A+D    S       ++ +   N  +    F++  ++  + E +  G+   ++++           V         P HS  +   +   L  +GPL     E V F+  T  +  F  F     +   S              P+    P  +    S  P+ P            S I    D         + ++++DG++G++FL   +    + R   +V V +        VP     + +++    DH           +VPE A     +F  + +  DG   G    V Y    +D  +  S           L   TG ++VA A  +DRE++   +L  + S     +   +   +       ++    P F     V +L E  P  +  I +   DPD+G N +V Y +   + + +F +      +G +     L+  T   Y+L + A    SP + +   L+V ++++ND+ P    P  + ++  N+PVG+ + ++ A D D   G S R+ +  ++        A D     L+ K+ +    K  + + V         R S   V ++ V D+N+H P  + +  ++ +  + +    +  L A D D  +NG++ + L+   S  F L   +   +    +D  +E    Y L + ++D    P     +++I  L +    P           +    +PE    GS +      D D   +    Y + N        Y+D  +G +     L+   +  +  +V  AI   P    S   +V +   +  +  P  + + + + LS   P        I+ +   DK++   +  L  +AP      +  DP + ++    +L  ++G   + R      + V+A      P  L     L V++  E P+      ++ +EI      + EN  P+ +V+      H       I Y FL+ +EN  L    + +    +   ++LD+E  +N R +L+++       S +    + IS+LD+++  P F    +T   +   P  G  L    A D D+G  G V+Y   ++ +  + F I+ +TGAI
Sbjct:  182 ELVVSSDIDRE--NQSSYSLVLEAYDGGSPTRSSQMRLDIVILDINDHAP-VFNQSRYQALISESLLPGASVLQVYATDADQGPNGDVRYEINRRQSDPEGYFTINAQSGLIQINKPLDYETRKVHELVVQAKDGAEQPEVGTAFVSIQVRDSNDNQPSMTIIFLSEDGAPRVSEGANPGQYVARISVSDPDYGEHPDVDVSLEGGEGKFA-LTTKDSIIYLICVDKLLDREE---RDSYRLRVLATDAGTPPLRAESSFVLEVTDVNDNPPVFDRQEYSHTVPEAVHPGSFLLQVTARDRDQGVNGEVRYSLLPTPW---FNINPDTGVITTAAPLDYEQEPHPKITVVASDQGQPSLSSTALVRIHLLDVNDNEPI--FSSPVYNATLSEGTARGSCFLQVSVTWGCFLLFSNSVTRWTDCAPPPIHSMRRCMISAPPLLPHGPLMFLMKEQVYFMHFTLLVTPFTAF----QVIPASRYPSKSNPSSLVLSPMEGLAPGSLL--GSLAPRMP----------HGSRIYTLLDEP-------HGIFMVDGQTGSIFLVGELDFESQPRFSFRVSVEEVREASLGYVPPHVVHIEVEVQDRNDHSPAFPEDPLTLVVPEDAHVGSSVFTFQASDHDGP--GPNSQVRYSLLRQDPGSPGSTFR--------LDAETGVLYVAQA--LDREEVSSYLLVVEASDQAVNVSQQRSTSVTARVFISDRNDHAPQFI-TPLVVWLPEDLPVGSTAIYMVAQDPDLGDNGKVGYQLVGGNDEGKFQLHPSSGMSGALTVVRTLDRETTEGYNLTVVAMDHGSPRLSSTQTLSVSLLDVNDEAPSFEKPQYDAQVQENQPVGTTVLRVVALDRDL--GQSGRVTYGGVSGDEF----ALDPETGVLTTKVPLDREAKELYKLTVYARDGGSPPRLSEVGV-QVRVGDENDHPPTFERDLVLLEVPEN-QEPMDLCVLSAWDPDGGENGRLKYRLIGDPSGDFTLDSANGKLSTSRPLD--RETTPKYQLVVSVSDGGAPPLSATAMVNINVLDLNDNTPA------FSASAFSAEVPEDAPVGSLVLHLSAVDPDDGPSGQTTYHLSNG--TQGAFYIDPLTGRITTATQLDRERRASYTFLV-WAIDSDPVGPRSAEATVTVLVRDVNDNAPAFLRSPFHLNLSRNTPTK----RAIAAMKAEDKDAGANASILYRLAPASATGGFSVDPYTGEV---RLLEPLSGMSPKER-----TVFVQATDLGEPP--LSSTAVLVVHLREEAPQGPRFP-QEAIEIS-----LPENS-PEGSVVGTATAAHTGGSTGRISYSFLSGNENGALRIHPT-TGQITVAQAAMLDYE--QNPRHKLVLQAETQQHLSFA---TLTISLLDLNDNAPRFKLPRYTAYTQEAQPD-GSPLIQVLAEDPDQGLNGQVTYSFDQSQAMKDLFRIDPQTGAI 1550          

HSP 6 Score: 124.79 bits (312), Expect = 2.596e-27
Identity = 111/413 (26.88%), Postives = 181/413 (43.83%), Query Frame = 2
Query:  128 IKENVPIGEVVGQI----ESPGFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTK------NVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLT--TVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDA-ISTSFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHE 1327
            ++EN P+G  V ++       G S           +F +   TGV+     +DRE + LY   + + +G +        VQ+++ D ND+ P F        +PEN      +DL   + +DPD G+N     R++ GD    F +D   S+NG    +L   + LD E   ++ LV+   DGG PPL A+ +V I V + NDN P F  S + A + ED  +    L + A D D G SG+  Y L N +  +  F +D  TG +     LD E+  S+   +   D S P         + V+  + N  +   L +     ++R+      +A +K  D DA  + S    +   S      + P   E++L+  +         + ++A D  EP LS+T  L + + E
Sbjct:  983 VQENQPVGTTVLRVVALDRDLGQSGRVTYGGVSGDEFALDPETGVLTTKVPLDREAKELYKLTVYARDGGSPPRLSEVGVQVRVGDENDHPPTFERDLVLLEVPENQ---EPMDLCVLSAWDPDGGENGRLKYRLI-GDPSGDFTLD---SANG----KLSTSRPLDRETTPKYQLVVSVSDGGAPPLSATAMVNINVLDLNDNTPAFSASAFSAEVPEDAPVGSLVLHLSAVDPDDGPSGQTTYHLSNGTQGA--FYIDPLTGRITTATQLDRERRASYTFLVWAID-SDPVGPRSAEATVTVLVRDVNDNAPAFLRSPFHLNLSRNTPTKRAIAAMKAEDKDAGANASILYRLAPASATGGFSVDPYTGEVRLLEPLSGMSPKERTVFVQATDLGEPPLSSTAVLVVHLRE 1381          

HSP 7 Score: 109.768 bits (273), Expect = 9.665e-23
Identity = 78/259 (30.12%), Postives = 127/259 (49.03%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKNV----------QIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD-NSPP 967
            F +   TGV+ V+  +DRE+ + Y  L++  +    NV          ++ I D ND+ P+F  T     +PE+ P+GS        DPD G N     ++V G+ E  F +      +G     L + ++LD E    +NL + A+D G P L ++  + + + + ND  P F+  +Y A ++E+Q +  T LRV A D D G SG + Y       S D F +D +TG +  +  LD E  + + +++  RD  SPP
Sbjct:  807 FRLDAETGVLYVAQALDREEVSSY-LLVVEASDQAVNVSQQRSTSVTARVFISDRNDHAPQF-ITPLVVWLPEDLPVGSTAIYMVAQDPDLGDNGKVGYQLVGGNDEGKFQLHPSSGMSGA----LTVVRTLDRETTEGYNLTVVAMDHGSPRLSSTQTLSVSLLDVNDEAPSFEKPQYDAQVQENQPVGTTVLRVVALDRDLGQSGRVTY----GGVSGDEFALDPETGVLTTKVPLDREAKELYKLTVYARDGGSPP 1055          

HSP 8 Score: 96.6709 bits (239), Expect = 8.625e-19
Identity = 69/215 (32.09%), Postives = 105/215 (48.84%), Query Frame = 2
Query:  335 VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLL-VKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFY-FLDNTSPSS------DFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD 955
            V I +LD+NDN P F    +   + E  P+GS+V      D D G N +    I SGD  ++F I+  +++  I   R      LD E  +   LV+ A+DG       +L+ V I V++ NDN P F +     SI+E+Q  N    ++ A D D GV G+LFY  LD     S      D F V+  +G +  ++S D+E+ K  ++ +   D
Sbjct: 1872 VLINVLDINDNPPVFPRPLYSVLLSEEAPVGSEVLRVLAQDSDSGSNGLVHYSITSGDESRLFQIN--EATGAIRLAR-----HLDRERQALHALVVLALDGQGGQANFALVPVTIEVRDINDNKPYFPVQILTTSIRENQPANTPLTKIHAIDLDTGVYGQLFYTMLDLAVAGSGMLMGKDMFVVNRTSGELRSKQSFDYERIKVFNMVVKAMD 2079          

HSP 9 Score: 92.4337 bits (228), Expect = 1.799e-17
Identity = 70/268 (26.12%), Postives = 129/268 (48.13%), Query Frame = 2
Query:  212 QEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKN-------VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEG---KNSIQSVRIVSGDSEKVFAIDYH--DSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKS-----KSHHISIGVRDNSP 964
            + + F I++ TG I+++  +DRE+Q L++ ++++++G           V I++ D+NDN+P F       SI EN P  + +      D D G   +     + +    S  +   D    + ++G     L  KQS DYE I  FN+V++A+D G+    A++ V+++V   ++  P F    +   + E      +   V+ATD D G  G + Y     SP   +F ++  TGN+YL+      +S     ++  +++ V  +SP
Sbjct: 1930 ESRLFQINEATGAIRLARHLDRERQALHALVVLALDGQGGQANFALVPVTIEVRDINDNKPYFPVQILTTSIRENQPANTPLTKIHAIDLDTGVYGQLFYTMLDLAVAGSGMLMGKDMFVVNRTSG----ELRSKQSFDYERIKVFNMVVKAMDAGN--FSATVTVQVLVTGEDEYNPVFISPFFNFEVPEGAVKGESLGHVQATDEDEGADGVVLYSFSKPSP---YFGINETTGNIYLKTDSQRHRSGRSKRETREMTLEVHAHSP 2188          

HSP 10 Score: 92.4337 bits (228), Expect = 1.829e-17
Identity = 75/265 (28.30%), Postives = 125/265 (47.17%), Query Frame = 2
Query:  215 EKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNG------DTKNVQIKILDVNDNEPK----FNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTS 979
            E  F I+  +G+I+++  +D E + ++  ++ + +G       T  V I++ D NDN+P     F + +    + E    G  V   +V DPD G++    V +  G+ +  FA+   DS   I Y+ + + + LD E    + L + A D G PPL+A     + V + NDN P FD   Y  ++ E        L+V A D D GV+GE+ Y L  T     +F ++  TG +     LD+E+     I++   D   P  +S
Sbjct:  278 EGYFTINAQSGLIQINKPLDYETRKVHELVVQAKDGAEQPEVGTAFVSIQVRDSNDNQPSMTIIFLSEDGAPRVSEGANPGQYVARISVSDPDYGEHPDVDVSLEGGEGK--FALTTKDS---IIYL-ICVDKLLDREERDSYRLRVLATDAGTPPLRAESSFVLEVTDVNDNPPVFDRQEYSHTVPEAVHPGSFLLQVTARDRDQGVNGEVRYSLLPTP----WFNINPDTGVITTAAPLDYEQEPHPKITVVASDQGQPSLSS 532          

HSP 11 Score: 90.5077 bits (223), Expect = 6.944e-17
Identity = 86/315 (27.30%), Postives = 134/315 (42.54%), Query Frame = 2
Query:  125 SIKENVPIGEVVGQIESP--GFSPPFEMHDF----QEKKFIISKTTGVIKVS--GLIDREKQNLYSFLI---ISMNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEK-VFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISI------------------GVRDNSPPFHTS 979
            S+ EN P G VVG   +   G S     + F    +     I  TTG I V+   ++D E+   +  ++      +     + I +LD+NDN P+F    +     E  P GS +      DPD+G N   +       + K +F ID    +       +     LD EI SQ +LV+ A D G PPL +S  + ++V + NDN P   +   + S+ ED  I    L+V   D D+G +      +D     +  FT+    G ++L + LD+E  KS+ +++                   V DNSP F  S
Sbjct: 1397 SLPENSPEGSVVGTATAAHTGGSTGRISYSFLSGNENGALRIHPTTGQITVAQAAMLDYEQNPRHKLVLQAETQQHLSFATLTISLLDLNDNAPRFKLPRYTAYTQEAQPDGSPLIQVLAEDPDQGLNGQVTYSFDQSQAMKDLFRIDPQTGA-------ITTAAILDREIWSQAHLVVIATDRGSPPLTSSATLTVLVTDVNDNSPTTPLQLEL-SVPEDAVIGSEILQVTGNDVDSGPALSYTLLVDGAMEGA--FTMLRYGGQIWLSRQLDYEDRKSYSLTVQTSDGKHLTHAELTLTLQDVNDNSPEFGKS 1701          

HSP 12 Score: 84.3445 bits (207), Expect = 4.765e-15
Identity = 62/193 (32.12%), Postives = 95/193 (49.22%), Query Frame = 2
Query:  377 FNATNFEKSIPENYPIGSKVDLTTVFDPD-EGKNSIQSVRIVSGDSEKVFAIDYHDSS-NGIFYV--RLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISI 943
            F       S+PE+ P+GS V +  V D D   +N+     I+SG+++  F +       NG F     +IL  SLD+E IS +NL + A D G P    S+ V I V + NDN P F    Y   + E+  +    LRV A D+D+G +G + Y +  +   S  F ++  TG + L + LD E+   H + +
Sbjct: 1770 FEPLPLSASVPEDLPLGSTVLILEVTDADFTQENAALDYTILSGNTDNAFQVQSGMRFWNGRFQQIGSIILTDSLDFEAISFYNLTLGASDRGVPQRSHSVPVLINVLDINDNPPVFPRPLYSVLLSEEAPVGSEVLRVLAQDSDSGSNGLVHYSI-TSGDESRLFQINEATGAIRLARHLDRERQALHALVV 1961          

HSP 13 Score: 81.6481 bits (200), Expect = 2.918e-14
Identity = 63/204 (30.88%), Postives = 95/204 (46.57%), Query Frame = 2
Query:  371 PKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEK-SKSHHISIGVRDNSPPFHTS 979
            P+F     E S+PEN P GS V   T          I S   +SG+      I  H ++  I   +  +   LDYE   +  LV+QA    H    A+L + ++  + NDN P+F + RY A  +E Q      ++V A D D G++G++ Y  D +    D F +D +TG +     LD E  S++H + I     SPP  +S
Sbjct: 1387 PRFPQEAIEISLPENSPEGSVVGTATAAHTGGSTGRI-SYSFLSGNENGALRI--HPTTGQITVAQAAM---LDYEQNPRHKLVLQAETQQHLSF-ATLTISLL--DLNDNAPRFKLPRYTAYTQEAQPDGSPLIQVLAEDPDQGLNGQVTYSFDQSQAMKDLFRIDPQTGAITTAAILDREIWSQAHLVVIATDRGSPPLTSS 1581          

HSP 14 Score: 81.2629 bits (199), Expect = 4.328e-14
Identity = 89/351 (25.36%), Postives = 159/351 (45.30%), Query Frame = 2
Query: 6206 KIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYK-KVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEE--FLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISI----PNRNLKLDTNRPVGSFITKITAKDSD---GPD-GISYRIRHRKL---TNQTLFLNVAFDSGEIFLSR--------KLLVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLR---GFDNNTAALFLIDEPQEK 7180
            ++ +  ++ IDRE      L  +   GGS  R  + ++ I + D++D+ PVF+Q+++ A ++E   P   V+++   D D G N  V Y I    S  E  F I+A +G ++ N PL++ T+ V++LV++A   A         +++ + + ND +P ++I     +   ++      G ++ +I+  D D    PD  +S      K    T  ++   +  D     L R        ++L +D G           R  S+ V+E  V D N++ P+         +  ++  GS +L + A D+D   NG+V + L+ T PWF +    G     A L    EP  K
Sbjct:  180 EVELVVSSDIDRENQSSYSLVLEAYDGGSPTRSSQMRLDIVILDINDHAPVFNQSRYQALISESLLPGASVLQVYATDADQGPNGDVRYEINRRQSDPEGYFTINAQSGLIQINKPLDYETRKVHELVVQAKDGAEQPEVGTAFVSIQVRDSNDNQPSMTIIFLSEDGAPRVSEGANPGQYVARISVSDPDYGEHPDVDVSLEGGEGKFALTTKDSIIYLICVDK---LLDREERDSYRLRVLATDAGTPPL-------RAESSFVLE--VTDVNDNPPVFDRQEYSHTVPEAVHPGSFLLQVTARDRDQGVNGEVRYSLLPT-PWFNINPDTGVITTAAPLDYEQEPHPK 517          

HSP 15 Score: 80.1073 bits (196), Expect = 9.767e-14
Identity = 63/217 (29.03%), Postives = 100/217 (46.08%), Query Frame = 2
Query:  194 FEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMN------GDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFY 826
            F+     +  F I   TG I  + ++DRE  +    ++I+ +        +  + + + DVNDN P       E S+PE+  IGS++   T  D D G  ++    +V G  E  F +  +         ++ L + LDYE    ++L +Q  DG H  L  + L  + +Q+ NDN P+F  S Y  SI E          VRATD D+G +G + Y
Sbjct: 1531 FDQSQAMKDLFRIDPQTGAITTAAILDREIWSQAHLVVIATDRGSPPLTSSATLTVLVTDVNDNSPT-TPLQLELSVPEDAVIGSEILQVTGNDVDSGP-ALSYTLLVDGAMEGAFTMLRYGG-------QIWLSRQLDYEDRKSYSLTVQTSDGKH--LTHAELT-LTLQDVNDNSPEFGKSLYQVSILEHAAAGTPLFTVRATDRDSGDNGRVSY 1735          

HSP 16 Score: 79.7221 bits (195), Expect = 1.246e-13
Identity = 193/872 (22.13%), Postives = 340/872 (38.99%), Query Frame = 2
Query: 2243 INFQKLFFARSLYQFILTK-SEIKGNLVKIGQVSMDSSCTESVSYDLFGVKNDHSHFTIDVATG-VIYGKDLGSISNK--TLMFQVSAKAPKSQTSFAQVIIYI-EDGIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSD---EYQIIQSQYSDWLSIHSKTGQIFLNKQ--FDREQ--VSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLN--IWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVKIRIFVSDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTT------TSVDGFLHLRFDSQQLILLKDNLNVKNVH-YSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLK-------NLEVVYSIKQPE--KYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPY----ILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTY---QINPSSDG------IFMINGDSGEIHLVSS---PRVSAYELNVTVRDSGEVPKSVSV 4720
            +N     F RS +   L++ +  K  +  +     D+    S+ Y L    +    F++D  TG V   + L  +S K  T+  Q +       +S A +++++ E+    P F    + +++ EN+  G  +      +   S     Y  +    +  L IH  TGQI + +    D EQ     LV+  + +  +  ATL + L  L+ N   P  K  +     ++    G     +   D D   NG ++Y     +   M + F I+P TG +   + L+  IW+       +L+VI +D G   PL +   ++V + D N++SP         + + AV G+E+   +  ++           L        F + +     ++ R    E   SY      + + T  G     + + L +  +  N N PE    K   Q+       +G+ +FTV A D D G N   +Y +   +     I+ D+                   R     L FP +T        PL     E+  +   +  +          V D +   EN       +S  T       S   F + RF     I+L D+L+ + +  Y+L +  + + +   S ++ + + V  +  + P+F +     L + E  P GS V    +R L        N  V YSI   +  + F IN  TG +   R  DRE +      V  +         F ++P+ +++ D NDN+PY    IL+ S   +R + P   N  + +I A D D+G   +L Y    +  +  G      +F++N  SGE+    S    R+  + + V   D+G    +V+V
Sbjct: 1277 VNDNAPAFLRSPFHLNLSRNTPTKRAIAAMKAEDKDAGANASILYRL-APASATGGFSVDPYTGEVRLLEPLSGMSPKERTVFVQATDLGEPPLSSTAVLVVHLREEAPQGPRFPQEAIEISLPENSPEGSVVGTATAAHTGGSTGRISYSFLSGNENGALRIHPTTGQITVAQAAMLDYEQNPRHKLVLQAETQQHLSFATLTISLLDLNDN--APRFKLPRYTAYTQEAQPDGSPLIQVLAEDPDQGLNGQVTYSFD--QSQAMKDLFRIDPQTGAITTAAILDREIWSQ-----AHLVVIATDRG-SPPLTSSATLTVLVTDVNDNSPTTPLQLELSVPEDAVIGSEI-LQVTGNDVDSGPALSYTLLVDGAMEGAFTMLRYGGQIWLSRQLDYEDRKSY-----SLTVQTSDGKHLTHAELTLTLQDV--NDNSPEFG--KSLYQVSILEHAAAGTPLFTVRATDRDSGDNGRVSYRVLSPVGGAFHIHPDNG------------------RYICLFLYFPPLTLRCHFEPLPLSASVPEDLPLGSTVLIL---------EVTDADFTQENAALDYTILSGNTDNAFQVQSGMRFWNGRFQQIGSIILTDSLDFEAISFYNLTLGASDRGVPQRSHSVPVLINVLDINDNPPVFPRPLYSVL-LSEEAPVGSEV----LRVLAQDSDSGSNGLVHYSITSGDESRLFQINEATGAIRLARHLDRERQALHALVVLALDGQGGQAN-FALVPVTIEVRDINDNKPYFPVQILTTS---IRENQPA--NTPLTKIHAIDLDTGVYGQLFYTMLDLAVAGSGMLMGKDMFVVNRTSGELRSKQSFDYERIKVFNMVVKAMDAGNFSATVTV 2089          

HSP 17 Score: 76.6406 bits (187), Expect = 9.174e-13
Identity = 74/311 (23.79%), Postives = 140/311 (45.02%), Query Frame = 2
Query:   89 YQSQQNSNLLIFSIKENVPIGEVVGQI--ESPGFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIIS----------MNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPD-EGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQ---ASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDF--FTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            Y S+ N + L+ S  E +  G ++G +    P  S  + + D     F++   TG I + G +D E Q  +SF +            +     ++++++ D ND+ P F        +PE+  +GS V      D D  G NS     ++  D     +    D+  G+ YV     Q+LD E +S + LV++A D      Q    S+  ++ + + ND+ P+F I+  +  + ED  +  T + + A D D G +G++ Y L   +    F        +G + + ++LD E ++ +++++   D+  P
Sbjct:  647 YPSKSNPSSLVLSPMEGLAPGSLLGSLAPRMPHGSRIYTLLDEPHGIFMVDGQTGSIFLVGELDFESQPRFSFRVSVEEVREASLGYVPPHVVHIEVEVQDRNDHSPAFPEDPLTLVVPEDAHVGSSVFTFQASDHDGPGPNSQVRYSLLRQDPGSPGSTFRLDAETGVLYV----AQALDREEVSSYLLVVEASDQAVNVSQQRSTSVTARVFISDRNDHAPQF-ITPLVVWLPEDLPVGSTAIYMVAQDPDLGDNGKVGYQLVGGNDEGKFQLHPSSGMSGALTVVRTLDRETTEGYNLTVVAMDHGSP 952          

HSP 18 Score: 70.0922 bits (170), Expect = 9.814e-11
Identity = 123/543 (22.65%), Postives = 233/543 (42.91%), Query Frame = 2
Query: 5201 IYSLEGDTFDKKIFIDPSTGKLSCSP-LNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPVNSEIF------YVLNPGHSHIQINTTTGELRTNGPLHLELV----------EFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSN--ITYQFDR--SDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISL-----NQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVN--YCKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSE-IRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKIT 6739
            I + EG      + ID +TG +  +  L+  ++N Y+   IA   EG +       +V I V +   H+  F+     L + E++P    LG    V P ++S+        Y++  G    +    T  + +NG L +ELV              L + A+     TRS Q     +D+ I+DIND+ P+  ++  +  I  S  P   + ++ ATD+D+  N  + Y+ +R  SDP        + ++ +SG + +   +    +  H L V   D     +  T  + I +     NQ    +  + E    RV E +  G ++ +I + +  Y +      S+ +G   +     + +    +     +DRE+ D   L    +  G+  +R     ++ V DV+DN PVF + ++   + E   P + ++++T  D D G N +V Y +        F I+ + G + T  PL++  +    + + AS +  P + +   + ++++++ND  P  S P  N  L      GS   +++
Sbjct:   56 ISAQEGSGVSTDLDIDENTGIIKTAKVLDREKRNHYSF--IAVTPEGTTV------EVDIHVDDINDHSPTFSKGRTELSIPEHTP----LGTRYPVDPAMDSDSGVLSTQGYLIRSGDPLQKFRLETRRV-SNGVLEVELVVSSDIDRENQSSYSLVLEAYDGGSPTRSSQM---RLDIVILDINDHAPVFNQSRYQALISESLLPGASVLQVYATDADQGPNGDVRYEINRRQSDPE-----GYFTINAQSGLIQINKPLDYETRKVHELVVQAKDGAEQPEVGTAFVSIQVRDSNDNQPSMTIIFLSEDGAPRVSEGANPGQYVARISVSDPDYGEHPDVDVSL-EGGEGKFALTTKDSIIYLICVDKLLDREERDSYRLRVLATDAGTPPLRAESSFVLEVTDVNDNPPVFDRQEYSHTVPEAVHPGSFLLQVTARDRDQGVNGEVRYSL---LPTPWFNINPDTGVITTAAPLDYEQEPHPKITVVASDQGQPSLSSTALVRIHLLDVNDNEPIFSSPVYNATLSEGTARGSCFLQVS 573          

HSP 19 Score: 67.781 bits (164), Expect = 5.254e-10
Identity = 61/286 (21.33%), Postives = 122/286 (42.66%), Query Frame = 2
Query:  128 IKENVPIGEVVGQI------ESPGFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGD-------TKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFY-FLDNTSPSSDFFTVDHKTGNVYLRKS--LDFEKSKSHHI 937
            + E+ P+G +V  +      + P     + + +  +  F I   TG I  +  +DRE++  Y+FL+ +++ D          V + + DVNDN P F  + F  ++  N P    +      D D G N+    R+    +   F++D +        VRL+  + L      +  + +QA D G PPL ++ ++ + ++      P+F       S+ E+     + +      +  G +G + Y FL      +    +   TG + + ++  LD+E++  H +
Sbjct: 1188 VPEDAPVGSLVLHLSAVDPDDGPSGQTTYHLSNGTQGAFYIDPLTGRITTATQLDRERRASYTFLVWAIDSDPVGPRSAEATVTVLVRDVNDNAPAFLRSPFHLNLSRNTPTKRAIAAMKAEDKDAGANASILYRLAPASATGGFSVDPYTGE-----VRLL--EPLSGMSPKERTVFVQATDLGEPPLSSTAVLVVHLREEAPQGPRFPQEAIEISLPENSPEG-SVVGTATAAHTGGSTGRISYSFLSGNENGA--LRIHPTTGQITVAQAAMLDYEQNPRHKL 1463          

HSP 20 Score: 65.855 bits (159), Expect = 1.788e-9
Identity = 109/430 (25.35%), Postives = 188/430 (43.72%), Query Frame = 2
Query: 6164 GVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLID----ANGDVKTNI----PLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFS---STAVIEIDVEDKNNHVP-----ILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDE--PQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVL-LKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLD 7390
            GV+ +L  + E+TG   +  A  +DREK +    +  V+  G+ +    +V IHVDD++D+ P FS+ +    + E  P  T        D D G  S   Y I      ++F ++    +NG ++  +     ++   +S Y LV++A    SP   ++ RL + I++IND  P  +       +  +   G+ + ++ A D+D GP+G + Y I +R+ ++   +  +   SG I +++ L       HE  +   D        TA + I V D N++ P      L E+G    +S     G  +  +   D D  ++  V   L      F L   D +   L  +D+   +E+   Y L +  TD A  P  R  S F L V  +      F R   +H    T+PE++  GS + +   +D D
Sbjct:   63 GVSTDL-DIDENTG--IIKTAKVLDREKRNHYS-FIAVTPEGTTV----EVDIHVDDINDHSPTFSKGRTELSIPEHTPLGTRYPVDPAMDSDSGVLSTQGYLIRSGDPLQKFRLETRRVSNGVLEVELVVSSDIDRENQSSYSLVLEAYDGGSPTRSSQMRLDIVILDINDHAPVFNQSRYQALISESLLPGASVLQVYATDADQGPNGDVRYEI-NRRQSDPEGYFTINAQSGLIQINKPLDYETRKVHELVVQAKDGAEQPEVGTAFVSIQVRDSNDNQPSMTIIFLSEDG-APRVSEGANPGQYVARISVSDPDYGEHPDVDVSLEGGEGKFALTTKD-SIIYLICVDKLLDREERDSYRLRVLATD-AGTPPLRAESSFVLEVTDVNDNPPVFDRQEYSH----TVPEAVHPGSFLLQVTARDRD 476          

HSP 21 Score: 65.0846 bits (157), Expect = 2.674e-9
Identity = 54/201 (26.87%), Postives = 91/201 (45.27%), Query Frame = 2
Query:  215 EKKFIISKTTGVIK---VSGLIDREKQNLYSFLIISMNGDTKNVQ------IKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRAT 790
            E KF ++    +I    V  L+DRE+++ Y   +++ +  T  ++      +++ DVNDN P F+   +  ++PE    GS +   T  D D+G N      ++       F I+      G+    +     LDYE      + + A D G P L ++ LV+I + + NDN P F    Y A++ E       FL+V  T
Sbjct:  385 EGKFALTTKDSIIYLICVDKLLDREERDSYRLRVLATDAGTPPLRAESSFVLEVTDVNDNPPVFDRQEYSHTVPEAVHPGSFLLQVTARDRDQGVNGEVRYSLLP---TPWFNIN---PDTGV----ITTAAPLDYEQEPHPKITVVASDQGQPSLSSTALVRIHLLDVNDNEPIFSSPVYNATLSEGTARGSCFLQVSVT 575          
BLAST of Dachsous vs. Ensembl Xenopus
Match: ENSXETT00000010301.1 (dachsous cadherin-related 2 [Source:NCBI gene;Acc:100485624])

HSP 1 Score: 243.047 bits (619), Expect = 4.349e-63
Identity = 551/2412 (22.84%), Postives = 967/2412 (40.09%), Query Frame = 2
Query: 1694 QCFSEIAVRNRHCG--MRIQYS-YDLL--LKTDGILRIN-EHGALCTAENVKHNKLMSTRYLYQIKALDETNSSAVCVVLFAIQPSKVFDVLPTEINITLPIIDSPKFNFSL-----PIGKIIGTFSKLPPAQFIGFIQYHLVPEELSTGAITVDSQSGEILMKKFPIHKNPIRLIVKSVIRKPFNVSP-------LNIVAINFQKLFFARSLYQFILTKSEIKGNLVKIGQVSMDSSCTESVSYDLFGVKNDHSHFTIDVATGVIYGK---DLGSISNKTLMFQVSAKAPKSQTSFAQVIIYIEDGIHQPG-FDFSDLLVNIWENTTVGIEIMQVFPKYPSVSDEYQI---IQSQYSDWLSIHSKTGQIFLNKQFD--REQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTN-FTFEDLSSLGEMECPLKCS----DADSFPNGNLSYRMKI---IKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILI-STNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSY--------FEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSE----IFTVNAVDPDKGLNSIFNYSIELAIDNE-DQINIDSWTGLITTKVSLSCAQNVK--IRIFVSDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQ--LILLKDNLNVKNVHYSLNVVFNKKNLFSISSNL-------------YINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIR----RLKNLEVVYSIKQ---PEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVI--ATHVSNPKIFTVLPLIVKIADENDNEPYILS-PSSSIVRISAPTTENASI----FQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEIHLVSSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCSPLNFMEKNIYNLKIIATDSEGLST-GRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINI--VKPPVNSEIFYVL-NPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSN--ITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTT--VLIDI-SLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNY-CKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFD--SGEIFLSRKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLD---SDKAIFYKI--DNFHPISNNLYLDFE----------SGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYDPPSFQIDSSN--ILWWINGDLFESRIWNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHDIQYFLTPHENFELTCSQSQ---------SSGCNIKSKSVLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSF-----TQNVEGG-IPKLGQILFTAYASDKDRGRFGIVSYQIVENPSENFGINNETGAIYIKNQFIIEKKDKQRVKRSETNEEALKSYRKSF 8554
             CF ++   +   G   +I YS YD     K     RI+ + G +C + ++       T Y   +KA DE   SA   V   I+          +IN   P+ +   +  S+     P  +I+   +        G + Y L+  E S+   T+DS +G I +     H     + +    R    ++        +NI+        F +S Y F++ +   KG+ V   +     +  E VSY +    N H  FTI    G+I  +   D  S+    L  Q S     S  S  QV + I D    P  F   +  +++ +NT+ G  I              QI   I S+  D   I S  G ++LN      RE V  ++       +I S      +            +N ++N  +F +L    E+   L  +       ++     S   +I   + P   + PF I+ +TG + +  S++   S      NL V+ +             I V+I+D N++SP    +T+ F ++++ V    +G++                    +  Q  Y      N F+I  K+ E IN             LNV++  TD G+P +++   + I   + N N P        KQ+     ++ G      + TV A DPD G N    Y    A D    Q  I++ TG I T  +L+     +  + +  SD G P +       ++ +   K +   ++K  T  +P+++ P   +G +    E +    L  S         +H R  +++     + D+L   +V+ S ++ F   + + +S ++             ++ + +       PLF  D    L + E++P G+ + +F        L+N ++ YS+      E  F I+   G L T    DRE        V     A ++S+ +  +V+  IV I D NDN P +LS P +S++       E+A I     +IVA D D G N K+ + I   ++ +        +++L+       Y L +   D G +P S+SV  ++    I    K    +  L           G  + +++        N  + Y ++ G     F ++P TG + T     RE+    +   I V+++      +     I  +I   N++ P       ++++PE++ +    TV+A D D G  GR+ + +          I+ ++G+L  +    +++  ++   I  +   L T  R    K+ I V +   +   F  + +   V E+   G+ + ++        +N EI Y L +       +N TTG + T   L  E+    +      A   S R+ ++ +  + V I D+NDN P+  ENP+ + I       K +  + A+D D   N  + Y   +S+P        + +  + G +      L +      L+V  SD G+P    T  V+IDI  L+++  +V    E  I    ENS  GT +  +K + +   D    +++  G       L+  TG + V     +D E ++K  L   +S   S+   Y +V + + D +DN PVF Q  +++F++EGQP  T VI++   D D G N Q++Y I   +    F++D+ +G + TN+ L+   KS Y L ++A+ + SP   +   +TV I++IND  P I   N  L  +   P G  I  I+A D D    +SY        N    L  A D  SG I L+  L   +  +H   I   D+ + + A + I V D N++ P+  +N   + L    +  + I  + A D+D    G +T++++S      L+GF  NT +       + K     + I   DN   P   L S   L+V +    +Y P         + + E    G  +      DLD    +  I + I   N H   N  YL+            +G L + + L++ +     L +  +  G P   +S  + + I   N  P L  N    +S++    ++   II  +   D ++   +    S+     EN+     F ID+ N  +      D  E+  ++LT+   +A+    S  N+    +  ++I V ++   +       +  +  I EN P  + V  +     D   +     + + +C   Q         S   +I +K  +D+E  E + L + +K         S  ++V I +   DE+ P F    +      +N+ G  I K+G       A D D G  G+V Y  +E PS+ F IN  +G IY+     + KK     K  E  E  +K++   F
Sbjct:  592 HCFLQVKATDADSGPFGQIHYSVYDGFHNTKESQSFRIDPDSGRICVSNDIDKES-GPTSYDLLVKAEDEGGLSAQAFVRVDIE----------DINDNAPVFEPSTYVTSISSHTQPGTEILNVMAIDRDEGLFGDVTYELLSGEHSS-LFTIDSSTGIIYLISVLSHLEDSWVSLSVAARDKGGLTSAVNATVTMNILKTATAPAIFEKSRYTFVIAEDVPKGSAVGTVKAREPLNSLEPVSYRIIS-GNVHQMFTIHTQFGIIRTQKELDFESLPLVVLTVQ-SQLGSSSVFSSTQVNVTITDANDNPPVFSSENERISVHQNTSPGTAIYIAQATDLDSGFNGQISYSIASENQDLFIIDSTFGVLYLNATLSSVREHVLLILAEDYGHPVISSLLTLTIIVE----------QNKQSNTLSFFNLVHRTEISETLPINSHILQVKAYTRNTQSTSSEIMYSLSPTIDSAPFRIHQSTGWIFLRRSVDYEKSKTH---NLKVVATSGDREDQQTATASIIVKILDENDNSPSFDHATHFFTVNESPVPHGVIGSI------------QAFDRDSGNNGQLSYFLLSEGNNFLISSKTGEIINCASLDRERKAHHELNVLV--TDNGTPRRNATTTVYIIVADLNDNKPYFPQLASGKQL--HVKVMEGQAEPMLVATVYAKDPDAGNNGTVVYF--FASDESFGQFVINASTGEIWTTKALTAKLRPQYGLTVTASDQGTPPLVEHTVVNIEVISAFKEKTKTVSKIKTMKVPENTYPTQKIGSVISHEEAF----LLSSK--------MHYRLANEENKGHFVVDSL-TGDVYVSRHLDFETISYYGLSIDIQEIDKISPPNLSVFLTIYIEDTNDHRPLF-PDHIIVLGVDEDVPVGTLLYTFKANDKDGSLENSKIRYSLNTHGTGENPFFIHEWEGALTTANELDREMAESFVLTVTATDQAANISHRRCTSVIVRIV-IQDINDNSPQVLSLPVASVM-------EDAQIGSLVHRIVAKDPDEGRNGKIGFHIKEGNNFV--------DLNLLYLYFQDHYILTILALDDG-IP-SLSVTQTLTISLIDVNDKTPTFTQGLYEAAVPENQDPGLYVIKVAAVDYDLGNNSVLTYEILPGPAYGHFRINPETGELVTTTVFDREQ---QDRFIIEVLVKDGGSPPLSSTTAILCSILDENDHTPEVLFPDVEIRVPENQDLGIIHTVLAADKDAGNNGRLHFQITDGNMGGYFAINNTSGQLWAT--RTLDREDFSSFTITVECHDLGTPHRSTIAKLRITVLDENDNPPTFPKSQYRTLVREDLKIGSAVLKLQASDADEGLNKEIMYSLIDDTQGAFTVNRTTGNIVTIRTLDREVKH--QYVFRVVASDCSLRNPKSATVKVLVYIEDVNDNSPVFTENPIHVLISPKVLENKTIANVHASDVDLGLNGTVVYNLIKSNP-------FFYITQEKGEV-KLQMPLPAEFSSTVLQVQASDLGIPPNTVTGLVIIDIQGLDKEIAFVHNFYEAIIL---ENSEAGTLVVTVKALYHNPNDEIIHYTVFSGDKKGAFNLNPITGDLMVKEPRLLDFETVNKFNLI--ISAESSQYTTYCRVTVFIQDDNDNAPVFDQLDYISFVSEGQPFNTFVIQVFAADGDSGINGQIDYSIISGNENNAFVLDSRHGILSTNVILDREIKSSYRLTVQATDRGSPSCSSTSVVTVLILDINDNAPTIPPMNTVLIAEDAAP-GYSIGSISANDVDLRPDLSYTFTE----NGNPGLKFAIDRYSGIITLTESLDYEESSQHCLRIQASDSVYHTEAELIIKVLDVNDNPPVFTQNIYKVALPELTESNTFITTVSATDQDSEIYGPITYKIISP-----LKGFVINTTS-------ENKSTEIQILIVAMDNGSPP---LTSTAMLSVTILDVNNYAPTF-SEDIYYVNVSEDALVGDTVLTLTAMDLDWSPKNALIDFSIIGGNAH---NLFYLESSEVLSHIPFIVTGKLIINQPLDFEVASAHRLDIFVSNQGFPPLNSSATIIINILDSNDNPPLFSNSEYHVSVREHYPLKSTIII--ISATDSDTGENADITYSIVSGNDENV-----FTIDAQNGTVTLVQPLDYEETMKYSLTL---QARDGHGSKRNV---AFALLSITVLDE--NDFAPKFLFQSQSCNIYENVPFFSPVCSVNAIDLDSGQYGILSFSIQSSCFNDQQHPATFLIDSLTGDIYTKHRIDYEMQERHCLVVQVKDR----SESSACVLVYIDIEGEDEFQPVFYQNQYLFDLPEENIGGQEIGKVG-------ALDNDEGLDGVVHY-FLEKPSQFFSINMTSGMIYLTR--TVHKKRSNTRKNDEFIEFHVKAHSPKF 2853          

HSP 2 Score: 142.895 bits (359), Expect = 9.510e-33
Identity = 89/297 (29.97%), Postives = 146/297 (49.16%), Query Frame = 2
Query:  116 LIFSIKENVPIGEVVGQIE------SPG---FSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYH--------DSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD 955
            L  ++ E +P G +VG I       SPG   F    +      + F +   TG++    ++DRE++  YSF+  ++ G+   V I + DVND+ P F   + +  + E  P G+   L   +DPD G++ ++   ++ G  E  F I Y          + + +  + L+L Q LD E +  + L ++A DGG+P     L+V I+V +ANDN P FD   Y   + E+  I  +   V ATD D G +GE+ Y L        +FTVD ++G + + + LD E+   H + +  RD
Sbjct:   45 LSLAVDEGLPPGTLVGDIRAGLPEGSPGEGFFLSEEDGESLVLRDFQVDSETGIVSTLQVLDRERREHYSFVAATLQGEVVQVDILVRDVNDHSPTFPVHSLQLQVSELTPPGTSFRLPAAWDPDIGEHGLKGYALLRGSQEAPFIIRYGHGKMVEGVGADSTLHPLDLVLIQWLDREELDNYQLEVEAFDGGNPRRTGRLIVDIVVMDANDNPPVFDQLDYKGWVWENAPIGTSVCTVHATDPDLGSNGEVRYSL---RFGEGYFTVDEESGEISVSRPLDREQISIHQLVVQARD 338          

HSP 3 Score: 135.576 bits (340), Expect = 1.434e-30
Identity = 337/1620 (20.80%), Postives = 644/1620 (39.75%), Query Frame = 2
Query: 3851 NLTFIIPDHSQPGYVVGDLNI-FPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNV----KNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNI----------RRLKNLEVVYSIKQPEKYFVINPVTGQ---------------LVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEP-YILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEIHLVSSP----RVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSR-SIFKVKLPEDEAI-TNFLTVVANDPDL-GIFGRIIYSLEGDTFDKKIFIDPSTGKLSCSP-LNFMEKNIYNLKIIATD--SEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPVNS------EIFYVLNPGHSH------IQINTTTGEL-------RTNGPLHLELVEFIE----LTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKT--SNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPE-KAIFRVKENSVDGTFIGQIKMVNYCKD-HSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDANGDVKTNIPLNFHTKSVYD--LVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPN--RNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDA----RFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLR---GFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDK----AIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESR--------IWNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHD-------IQYFLTPHENFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLLI--KGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIVE 8410
            NL+  + +   PG +VGD+    PE    +  F+S            + DS+  I+    L V    +  HYS      +  +      + ++++V  V    P F   S + L++ E  P G+   SF +            LK   ++   +  E  F+I    G+               LV  +  DRE  +  Q  VE  A    NP+    L + + + D NDN P +        V  +AP     S+  + ATD D G N ++ Y +    +G F ++ +SGEI  VS P    ++S ++L V  RD G+ P+  S++ ++    +   S    +  +L      P+   G   G+           + +R     G F+ +    P    +     + RE     ++ ++ ++        +   + + +++   N+ PP F +   ++  + E  +I T  L + A D D  G   R+ YSL+         ++P TG LS +  L+     + NL  +ATD  S  LS+       + I V++T  +   F    +++ + E+    TVLG   +     ++      +I Y +  G  +       +I+  +G +       + +GP   +L+   E    L+  AF + +    I   +              P+   +     I +  QP   +  + A D D+    ++TY+    + ++     ++ +D  +G ++L S +         L V   D G  +      + +++ +      I  + +  F + E+   G+ +G +K            + II G  H++  +H   G   +    ++D E +  ++L  Q   G S +    +V + + D +DN PVFS       +++   P T +      D D GFN Q+ Y I    +Q+ F+ID+   V   + LN    SV +  L+I A     P + +   LT+ IV  N Q   +S  N     ++    P+ S I ++ A   +     S  +     T  +    +   +G IFL R +       H   +V        + ++TA I + + D+N++ P          ++ S      I  + A D+D  +NG++++ L+S    F +    G   N A+L    + + K H + L + +TDN    +    +++ +   L   + YFP+L       + + E       +     KD D+        F+  D          ++  +G+++ TK+L   ++P++ L VT +  G+P  +    +++++    K      +K  T  ++VPE       I +++  ++     S     +A E+ +       F +DS      + GD++ SR         + L+I I +  K   SP NL     +F+ I + +    + R       +   ++E+ P  T +        D       I+Y L  H   E      +  G  + + + LD E  E++ L +    + +    R C+ +++V I + D+++  P+ +       +E    ++G ++    A D D GR G + + I E
Sbjct:   44 NLSLAVDEGLPPGTLVGDIRAGLPEGSPGEGFFLSEEDGESLVLRDFQVDSETGIV--STLQVLDRERREHYSFVAATLQGEV------VQVDILVRDVNDHSPTFPVHSLQ-LQVSELTPPGT---SFRLPAAWDPDIGEHGLKGYALLRGSQ--EAPFIIRYGHGKMVEGVGADSTLHPLDLVLIQWLDREELDNYQLEVE--AFDGGNPRRTGRLIVDIVVMDANDNPPVFDQLDYKGWVWENAPI--GTSVCTVHATDPDLGSNGEVRYSLR-FGEGYFTVDEESGEIS-VSRPLDREQISIHQLVVQARDGGDQPEVTSILLTVKVLDVNDNSP--GIHITLITESGRPEVSEGARTGEYLARIFVQENRVSVRLEGGEGSFS-LQPAGPQLYFLCVNAPLDREL---KDMYELQILAWDTGSPPLQSHKTLLLSVTDLNDQPPMFLQPEGYQATISEATSIGTAVLMLKAQDLDEDGPNSRVTYSLQESQNSSSFILEPGTGVLSIAQLLDHESAPVLNLVAVATDHGSPPLSSS----CTITITVEDTNDNDPIFLQQFYNVSLQEH----TVLGHCFLQVKATDADSGPFGQIHYSVYDGFHNTKESQSFRIDPDSGRICVSNDIDKESGPTSYDLLVKAEDEGGLSAQAFVR-VDIEDINDNA--------------PVFEPSTYVTSISSHTQPGTEILNVMAIDRDEGLFGDVTYELLSGEHSS-----LFTIDSSTGIIYLISVLSHLEDSWVSLSVAARDKGGLTSAVNATVTMNILKTATAPAIFEKSRYTFVIAEDVPKGSAVGTVKAREPLNSLEPVSYRIISGNVHQMFTIHTQFG--IIRTQKELDFESLPLVVLTVQSQLGSSSVFSSTQVNVTITDANDNPPVFSSENERISVHQNTSPGTAIYIAQATDLDSGFNGQISYSIA-SENQDLFIIDSTFGV---LYLNATLSSVREHVLLILAEDYGHPVISSLLTLTI-IVEQNKQSNTLSFFNLVHRTEISETLPINSHILQVKAYTRNTQSTSSEIMYSLSPTIDSAPFRIHQSTGWIFLRRSVDYEKSKTHNLKVVATSGDREDQQTATASIIVKILDENDNSPSFDHATHFFTVNESPVPHGVIGSIQAFDRDSGNNGQLSYFLLSEGNNFLISSKTGEIINCASL----DRERKAH-HELNVLVTDNGTPRRNATTTVYIIVADLNDNKPYFPQLASGKQLHVKVMEGQAEPMLVATVYAKDPDAGNNGTVVYFFASDESF---GQFVINASTGEIWTTKALTAKLRPQYGLTVTASDQGTPPLVEHTVVNIEVISAFKEKTKTVSKIKT--MKVPENTYPTQKIGSVISHEEAFLLSSKMHYRLANEENKG-----HFVVDS------LTGDVYVSRHLDFETISYYGLSIDIQEIDKI--SPPNL----SVFLTIYIEDT--NDHRPLFPDHIIVLGVDEDVPVGTLLYTFKANDKDGSLENSKIRYSLNTHGTGENPFFIHEWEGA-LTTANELDREMAESFVLTVTATDQAANISHRRCT-SVIVRIVIQDINDNSPQVLSLPVASVMEDA--QIGSLVHRIVAKDPDEGRNGKIGFHIKE 1569          

HSP 4 Score: 120.939 bits (302), Expect = 3.917e-26
Identity = 252/1098 (22.95%), Postives = 475/1098 (43.26%), Query Frame = 2
Query: 5342 STGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPVNSEIF--YVLNPG---------HSHIQINTTTGELRTNGPLHLELVEFI--------ELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLI-----DISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVFLHESTGK--IFVAAAAKIDREKID----KIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQ-NKFVAFLNEGQPPKTPVIRLTVYDPD-IGFNSQVEYFIEFYSSQEEFLID-ANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYRIR---HRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVV---DDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKD-LDSDKAIFYKIDNFHPISNNLYLDF----ESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKN-SFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESRIWNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHDIQ-------YFLTP---HENFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLL-IKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQS--FTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIVENPSENFGINNETGAI 8455
            +T + +  +V I V++   H+  F      L+V E +P GT         P +       Y L  G         + H ++    G   T  PL L L++++        +L + AF      R   T   I+D+ ++D NDN P+  +   K ++  +      +  + ATD D  SN   ++     + +     + +D +SG + +   +       H L V   D G   + T++L+     D++ N    ++ ++ E     V E +  G ++ +I    + +++     +  G   E  F  +  G    F+   A +DRE  D    +I+ W     G   ++ +K +++ V D++D  P+F Q   + A ++E     T V+ L   D D  G NS+V Y ++   +   F+++   G +     L+  +  V +LV  A+   SP + + C +T+ + + ND  P       N+ L  +  +G    ++ A D+D GP G I Y +    H    +Q+  ++   DSG I +S  +   + G   +D++V   D+   S+ A + +D+ED N++ P+ + +  V ++SS  + G++IL + AID+D    G VT+EL+S      L   D++T  ++LI       H     + L+  A D      ++ A   +     +  P +         I E +  GS +     ++ L+S + + Y+I     IS N++  F    + G +   K L++   P  +L V   + GS    +S  ++V I   N  P +  ++   +S+           I+    +D   + + SY   S+A E  +       F IDS+  + ++N  L   R     ++++ A+ Y +       +  L + I V +    N      +   T  I+E  P  + +L++  +  + Q       Y L+P      F +     QS+G     +SV D+E  + + L+++   G     ++ + +I+V+I  LD ++  P F H +  FT N E  +P    ++ +  A D+D G  G +SY ++     NF I+++TG I
Sbjct:  118 ATLQGEVVQVDILVRDVNDHSPTFPVHSLQLQVSELTPPGTSFRLPAAWDPDIGEHGLKGYALLRGSQEAPFIIRYGHGKMVEGVGADSTLHPLDLVLIQWLDREELDNYQLEVEAFDGGNPRR---TGRLIVDIVVMDANDNPPVFDQLDYKGWVWENAPIGTSVCTVHATDPDLGSNGEVRY-----SLRFGEGYFTVDEESGEISVSRPLDREQISIHQLVVQARDGGDQPEVTSILLTVKVLDVNDNSPGIHITLITESGRPEVSEGARTGEYLARI----FVQENRVSVRLEGG---EGSFSLQPAGPQLYFLCVNAPLDRELKDMYELQILAW---DTGSPPLQSHKTLLLSVTDLNDQPPMFLQPEGYQATISEATSIGTAVLMLKAQDLDEDGPNSRVTYSLQESQNSSSFILEPGTGVLSIAQLLDHESAPVLNLVAVATDHGSPPLSSSCTITITVEDTNDNDPIFLQQFYNVSLQEHTVLGHCFLQVKATDADSGPFGQIHYSVYDGFHNTKESQSFRIDP--DSGRICVSNDI-DKESGPTSYDLLVKAEDEGGLSAQAFVRVDIEDINDNAPVFEPSTYVTSISSHTQPGTEILNVMAIDRDEGLFGDVTYELLS-GEHSSLFTIDSSTGIIYLI---SVLSHLEDSWVSLSVAARDKGGLTSAVNATVTMNILKTATAPAIFEKSRYTFVIAEDVPKGSAVGTVKAREPLNSLEPVSYRI-----ISGNVHQMFTIHTQFGIIRTQKELDFESLPLVVLTVQSQL-GSSSVFSSTQVNVTITDANDNPPVFSSENERISVHQNTSPGTAIYIAQATDLDSGFNGQISY---SIASENQD------LFIIDSTFGVLYLNATLSSVREH---VLLILAEDYGHP----VISSLLTLTIIVEQNKQSNTLSFFNLVHRTE-ISETLPINSHILQVKAYTRNTQSTSSEIMYSLSPTIDSAPFRI----HQSTGWIFLRRSV-DYEKSKTHNLKVVATSGDREDQQTATASIIVKI--LDENDNSPSFDHATHFFTVN-ESPVPH--GVIGSIQAFDRDSGNNGQLSYFLLSE-GNNFLISSKTGEI 1156          

HSP 5 Score: 107.457 bits (267), Expect = 4.284e-22
Identity = 284/1268 (22.40%), Postives = 518/1268 (40.85%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLI-------ISMNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVR-----LILKQSLDYEIISQFNLVIQAIDGGHPPLQ---ASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHIS--IGVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDAISTS-FDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEIDSTILNENQHVTFVKTT----KRLPTKPIFIFKIFV--LNNLFKINETTGEILSKRSID---CGKYFFNVSMLSLKTNSLIDQTKLEIVVKSGRKLPLYFDRGFRKILVTTGK--SQCFSEIAVRNRHCGMRIQYSYDLLLKTDGILRINEH-GALCTAENVKHNKLMSTRYLYQIKALD---ETNSSAVCVVLFAIQPSKVFDVLPTEINITLPIIDSPKFNFSLPIGKIIGTFSKLPPAQFIGFIQYHLVPEELSTGAITVDSQSGEI-LMKKFPIHKNPIRLIVKS--VIRKPFNVSPLNIVAINF--QKLFFARSLYQFILTKSEIKGNLVKIGQVSMDSSCTESVSYDLFGVKNDHSHFTIDVATGVIYGKDLGSISNKTL-MFQVSAKAPKSQ-TSFAQVIIYIED-GIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSD----EYQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIG---SATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQC------FYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPL----LSGSEIFTVNAVDPD-KGLNSIFNYSIELAIDNEDQINIDS----------WTG--LITTKVSLSCAQNVKIRIFVSDLGFPKMTSSVDTLLKPL 3814
            F++   TG + VS  +D E  + Y   I       IS    +  + I I D ND+ P F        + E+ P+G+   L   F  ++   S+++ +I        ++++ H +    F++      L     LD E+   F L + A D           S++V+I++Q+ NDN P+  +S  +AS+ ED +I     R+ A D D G +G++ + +              K GN ++  +L +   + H+I   + + D  P    ++   I  +   +  P   Q L+   + E N+D  P   V  V   DYD  + S    EIL    +   +I P+  EL         + +   + +   D   P LS+T A+      SIL EN  +      +++  +  ENQ +  + T     K         F+I    +   F IN T+G++ + R++D      +   V    L T       KL I V      P  F +   + LV           ++   +   G+  +  Y L+  T G   +N   G + T   +  ++ +  +Y++++ A D       SA   VL  I+   V D  P      + ++ SPK   +  I  +  +   L      G + Y+L+    S     +  + GE+ L    P   +   L V++  +   P  V+ L I+ I    +++ F  + Y+ I+ ++   G LV   +    +   E + Y +F   +    F ++  TG +  K+   +  +T+  F +   A  SQ T++ +V ++I+D   + P FD  D +  + E       ++QVF            +Y II    ++   + S+ G +  N   DRE  S   +TVQ  +      S+T  + + ILDINDN P      T    ED ++ G     +  +D D  P  +LSY        G+   F I+  +G + +  SL+   S+     + L I + +  +    TE E+ ++++D N++ P+  + N++ +    +  TE  T +          + +  +  P  Y+       F I   S+N      KS E        + ++++A D GSP  +S   L +  ++ N   P         + I++  +    L G  + T+ A+D D    N++ ++SI +  +  +   ++S           TG  +I   +    A   ++ IFVS+ GFP + SS   ++  L
Sbjct: 1361 FVVDSLTGDVYVSRHLDFETISYYGLSIDIQEIDKISPPNLSVFLTIYIEDTNDHRPLFPDHIIVLGVDEDVPVGT---LLYTFKANDKDGSLENSKIR-------YSLNTHGTGENPFFIHEWEGALTTANELDREMAESFVLTVTATDQAANISHRRCTSVIVRIVIQDINDNSPQV-LSLPVASVMEDAQIGSLVHRIVAKDPDEGRNGKIGFHI--------------KEGNNFVDLNLLYLYFQDHYILTILALDDGIPSLSVTQTLTISLIDVNDKTPTFTQGLYEAAVPE-NQD--PGLYVIKVAAVDYDLGNNSVLTYEILPGPAYGHFRINPETGELVTTTVFDREQQDRFIIEVLVKDGGSPPLSSTTAILC----SILDENDHTPEVLFPDVEIRV-PENQDLGIIHTVLAADKDAGNNGRLHFQITDGNMGGYFAINNTSGQLWATRTLDREDFSSFTITVECHDLGTPHRSTIAKLRITVLDENDNPPTFPKSQYRTLVREDLKIGSAVLKLQASDADEGLNKEIMYSLIDDTQGAFTVNRTTGNIVTIRTL--DREVKHQYVFRVVASDCSLRNPKSATVKVLVYIE--DVNDNSPVFTENPIHVLISPKVLENKTIANVHASDVDL---GLNGTVVYNLIK---SNPFFYITQEKGEVKLQMPLPAEFSSTVLQVQASDLGIPPNTVTGLVIIDIQGLDKEIAFVHNFYEAIILENSEAGTLVVTVKALYHNPNDEIIHYTVFS-GDKKGAFNLNPITGDLMVKEPRLLDFETVNKFNLIISAESSQYTTYCRVTVFIQDDNDNAPVFDQLDYISFVSEGQPFNTFVIQVFAADGDSGINGQIDYSIISGNENNAFVLDSRHGILSTNVILDREIKSSYRLTVQATDRGSPSCSSTSVVTVLILDINDNAPTIPPMNTVLIAED-AAPGYSIGSISANDVDLRP--DLSYTFTENGNPGLK--FAIDRYSGIITLTESLDYEESSQ----HCLRIQASDSVY---HTEAELIIKVLDVNDNPPVF-TQNIYKVALPEL--TESNTFI----TTVSATDQDSEIYGPITYKIISPLKGFVINTTSEN------KSTE--------IQILIVAMDNGSPPLTSTAMLSVTILDVNNYAPTF------SEDIYYVNVSEDALVGDTVLTLTAMDLDWSPKNALIDFSI-IGGNAHNLFYLESSEVLSHIPFIVTGKLIINQPLDFEVASAHRLDIFVSNQGFPPLNSSATIIINIL 2544          

HSP 6 Score: 101.679 bits (252), Expect = 2.883e-20
Identity = 237/1087 (21.80%), Postives = 439/1087 (40.39%), Query Frame = 2
Query: 2531 IIYIEDGIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSDEYQIIQSQYS-----DWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSD--ADSFPNGN-LSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNVFYIHQTAVYGTEVGTLLXXXXXXXXX-----XXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEP-LNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQ---INIDSWTGLITTKVSL---SCAQNVKIRIFVSDLGFPKMTSSVDTLLK------PLYEPKSEEFLINKNLTFI--IPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRF---DSQQLILLKDNL-NVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRR-LKNLE-VVYSI--KQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEIHLVSS-PRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQ----RIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFL-TVVANDPDLGIFGRIIYSL--EGDTFDKKIFIDPSTGK-LSCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAF----NATHFSLKVLENSPGGTVLGRINIVKPPV--NSEIFYVLNPGHSHIQ--INTTTGELRTNGPLHLELVEFIELTIHA 5632
            I+ ++   + P FD  D    +WEN  +G  +  V    P +    ++   +YS      + ++  ++G+I +++  DREQ+S   + VQ ++  G    ++   +L +        +   + T    S   E+    +  +  A  F   N +S R++     G    F + P    L  +      +     +  L ++  D G   PL++   + + + D N+  P+ +    +    T    T +GT ++  +    +       +  SL++      F +E     T V+ +  L  ++    P LN++ +ATD GSP  SS   + I   ++N N P  +  +Q   +      + G     V A D D G     +YS+     N  +     ID  +G I     +   S   +  + +   D G     + V   ++      P++EP           T++  I  H+QPG  + ++     + G   LF   T   + G     F    S  +I L   L ++++   SL+V    K   + + N  + + + +   +  +F K    F+ I E++P GS V +   R  L +LE V Y I      + F I+   G + T +  D E+   +   V  + + + +  +F+   + V I D NDN P + S  +  + +   T+   +I+   ATD DSG N +++Y I   +  +F+I+   G ++L ++   V  + L +   D G    S  +  +I  +  K  + + F +      +S     +  I+   +Y++ + S + +I Y L     +  F +   TG +  + SV  E+   S+   + VV  S       D Q     I + I   N+N P F  +     + E       + ++ A D D G  G++ Y L  EG+ F     I   TG+ ++C+ L+   K  + L ++ TD+   +  R   T V I V +   +   F    +     +KV+E      ++  +    P    N  + Y      S  Q  IN +TGE+ T   L  +L     LT+ A
Sbjct:  249 IVVMDANDNPPVFDQLDYKGWVWENAPIGTSVCTVHATDPDLGSNGEV---RYSLRFGEGYFTVDEESGEISVSRPLDREQISIHQLVVQARD--GGDQPEVTSILLTVKVLDVNDNSPGIHITLITESGRPEVSEGARTGEYLARIFVQENRVSVRLE-----GGEGSFSLQPAGPQLYFLCVNAPLDRELKDMYELQILAWDTGS-PPLQSHKTLLLSVTDLNDQPPMFLQPEGY--QATISEATSIGTAVLMLKAQDLDEDGPNSRVTYSLQESQNSSSFILEP---GTGVLSIAQL--LDHESAPVLNLVAVATDHGSPPLSSSCTITITVEDTNDNDP--IFLQQFYNVSLQEHTVLGHCFLQVKATDADSGPFGQIHYSVYDGFHNTKESQSFRIDPDSGRICVSNDIDKESGPTSYDLLVKAEDEGGLSAQAFVRVDIEDINDNAPVFEPS----------TYVTSISSHTQPGTEILNVMAIDRDEG---LFGDVTYELLSGEHSSLFTIDSSTGIIYLISVLSHLEDSWVSLSVAARDKGGLTSAVNATVTMNILKTATAPAIFEKSRYTFV-IAEDVPKGSAVGTVKAREPLNSLEPVSYRIISGNVHQMFTIHTQFGIIRTQKELDFES---LPLVVLTVQSQLGSSSVFSSTQVNVTITDANDNPP-VFSSENERISVHQNTSPGTAIYIAQATDLDSGFNGQISYSIASENQDLFIIDSTFGVLYLNATLSSVREHVLLILAEDYGHPVISSLLTLTIIVEQNKQSNTLSFFNLVHRTEISETLPINSHILQVKAYTRNTQSTSSEIMYSLSPTIDSAPFRIHQSTGWIFLRRSVDYEK---SKTHNLKVVATS---GDREDQQTATASIIVKILDENDNSPSFDHATHFFTVNESPVPHGVIGSIQAFDRDSGNNGQLSYFLLSEGNNF----LISSKTGEIINCASLDRERKAHHELNVLVTDNG--TPRRNATTTVYIIVADLNDNKPYFPQLASGKQLHVKVMEGQAEPMLVATVYAKDPDAGNNGTVVYFFASDESFGQFVINASTGEIWTTKALTAKLRPQYGLTVTA 1285          

HSP 7 Score: 96.6709 bits (239), Expect = 7.716e-19
Identity = 75/265 (28.30%), Postives = 134/265 (50.57%), Query Frame = 2
Query:  218 KKFIISKTTGVIKVSGLIDREKQNLYSFLIISM-NGD-----TKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEG-KNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYV---RLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSK 982
            K F+I+ T+            K      LI++M NG      T  + + ILDVN+  P F+   +  ++ E+  +G  V   T  D D   KN++    I+ G++  +F ++  +  + I ++   +LI+ Q LD+E+ S   L I   + G PPL +S  + I + ++NDN P F  S Y  S++E   +  T + + ATD+D G + ++ Y + + +   + FT+D + G V L + LD+E++  + +++  RD     H SK
Sbjct: 2388 KGFVINTTS----------ENKSTEIQILIVAMDNGSPPLTSTAMLSVTILDVNNYAPTFSEDIYYVNVSEDALVGDTVLTLTAMDLDWSPKNALIDFSIIGGNAHNLFYLESSEVLSHIPFIVTGKLIINQPLDFEVASAHRLDIFVSNQGFPPLNSSATIIINILDSNDNPPLFSNSEYHVSVREHYPLKSTIIIISATDSDTGENADITYSIVSGN-DENVFTIDAQNGTVTLVQPLDYEETMKYSLTLQARDG----HGSK 2637          

HSP 8 Score: 95.1301 bits (235), Expect = 2.353e-18
Identity = 105/400 (26.25%), Postives = 178/400 (44.50%), Query Frame = 2
Query:  212 QEKKFIISKTTG--VIKVSGLIDREKQNLYSFLIISMNGDTKN---VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFY-FLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDAISTSFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEIDSTIL 1393
            ++  F ++  TG  ++K   L+D E  N ++ +I + +        V + I D NDN P F+  ++   + E  P  + V      D D G N      I+SG+    F +D   S +GI    +IL    D EI S + L +QA D G P   ++ +V +++ + NDN P       +  I ED     +   + A  ND  +  +L Y F +N +P    F +D  +G + L +SLD+E+S  H + I   D+   +HT    +I  +   ++ P   Q ++   L E+      NT +  V  TD D+       EI     +++I  L       +IN     KS  I + + A+D   P L++T  L++ I +   +  +FS   + V +    L
Sbjct: 2079 KKGAFNLNPITGDLMVKEPRLLDFETVNKFNLIISAESSQYTTYCRVTVFIQDDNDNAPVFDQLDYISFVSEGQPFNTFVIQVFAADGDSGINGQIDYSIISGNENNAFVLD---SRHGILSTNVIL----DREIKSSYRLTVQATDRGSPSCSSTSVVTVLILDINDNAPTIPPMNTVL-IAEDAAPGYSIGSISA--NDVDLRPDLSYTFTENGNPGLK-FAIDRYSGIITLTESLDYEESSQHCLRIQASDSV--YHTEAELIIKVLDVNDNPPVFTQNIYKVALPELTES---NTFITTVSATDQDS-------EIYGPITYKIISPLKGF----VINTTSENKSTEIQILIVAMDNGSPPLTSTAMLSVTILDVNNYAPTFSEDIYYVNVSEDAL 2451          

HSP 9 Score: 92.8189 bits (229), Expect = 1.291e-17
Identity = 86/287 (29.97%), Postives = 134/287 (46.69%), Query Frame = 2
Query:  122 FSIKENVPIGEVVGQIESPGFSPPFEMHDFQ------EKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTK-----NVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIV-QNANDNVPKFDISRYIASIKEDQEINITFLRVRA-TDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISI 943
            F I E+VP G  VG +++       E   ++       + F I    G+I+    +D E   L    + S  G +       V + I D NDN P F++ N   S+ +N   G+ + +    D D G N   S  I S +++ +F I   DS+ G+ Y+   L        + +  L+I A D GHP + + L + IIV QN   N   F    +   I E   IN   L+V+A T N    S E+ Y L  T  S+  F +   TG ++LR+S+D+EKSK+H++ +
Sbjct:  795 FVIAEDVPKGSAVGTVKAREPLNSLEPVSYRIISGNVHQMFTIHTQFGIIRTQKELDFESLPLVVLTVQSQLGSSSVFSSTQVNVTITDANDNPPVFSSENERISVHQNTSPGTAIYIAQATDLDSGFNGQISYSIAS-ENQDLFII---DSTFGVLYLNATLSS------VREHVLLILAEDYGHPVISSLLTLTIIVEQNKQSNTLSFFNLVHRTEISETLPINSHILQVKAYTRNTQSTSSEIMYSLSPTIDSAP-FRIHQSTGWIFLRRSVDYEKSKTHNLKV 1070          

HSP 10 Score: 92.0485 bits (227), Expect = 2.380e-17
Identity = 239/1040 (22.98%), Postives = 399/1040 (38.37%), Query Frame = 2
Query:  269 IDREKQNLYSFLIISMNGDTKN------VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIAS----IKEDQEINITFLRVRATDNDAGV---SGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD-NSPPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDAIS----TSFDL-EILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEI-DSTILNENQHVTFVKTTKRLPTKPIFIFKIFVLNNL--------FKINETTGEILSKRSID--CGKYFFNVSMLSLKTNSLIDQTKLEIVVKS-GRKLPLYFDRGFRKILVTTGKSQCFSEI---AVRNRHCGMRIQYSYDLLLKTDGILRINEHGALCTAENVKHNKLMSTRYLYQIKALDETNSSAVCVVLFAIQPSKVFDVLPTEINITL-------PIIDSPKFNF----SLPIGKIIGTFSKLPPAQFIGFIQYHLVPEELSTGAITVDSQSGEI-LMKKFPIHKNP-IRLIVKSVIRKP--FNVSPLN--IVAINFQKLFFARSLYQFILTKSEIKGNLVKIGQVS-MDSSCTESVSYDLFGVKNDHSHFTIDVATGVIY-GKDLGSISNKTLMFQVSAKAPKSQTSFAQVIIYIEDGIHQPGFDFSDLL--VNIWENTTVGIEIMQVFP---KYPSVSDE--YQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVSY----LVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNG-PFKPLETEVEISVRIIDANNHSP 3193
            +DRE+ + Y   + + +G          V I ++D NDN P F+  +++  + EN PIG+ V      DPD G N    VR      E  F +D            + + + LD E IS   LV+QA DGG  P   S+L+ + V + NDN P   I+    S    + E         R+   +N   V    GE  + L    P   F  V+           LD E    + + I   D  SPP  + K  ++      +  P  +Q    G  + I+   S  T V  +K  D D        ++ L E  N S F L    P    L +   + +  +  +NL   A D+  P LS++  +TI + ++   +  F    + V + + T+L    H           + P       V +          F+I+  +G I     ID   G   +++ + +     L  Q  + + ++      P++    +  +   +  +Q  +EI      +R  G+    +Y+LL          EH +L T ++       ST  +Y I  L     S V + + A     +   +   + + +        I +  ++ F     +P G  +GT     P   +  + Y ++   +     T+ +Q G I   K+      P + L V+S +     F+ + +N  I   N     F+    +  + ++   G  + I Q + +DS     +SY +     D   F ID   GV+Y    L S+    L+           +S   + I +E         F +L+    I E   +   I+QV        S S E  Y +  +  S    IH  TG IFL +  D E+       +V T   +    +AT  + + ILD NDN P   ++   FT  +      +   ++  D DS  NG LSY +     +   N F I+  TG ++  +SL   +        L V+V+DNG P +   T V I V   D N++ P
Sbjct:  219 LDREELDNYQLEVEAFDGGNPRRTGRLIVDIVVMDANDNPPVFDQLDYKGWVWENAPIGTSVCTVHATDPDLGSNG--EVRYSLRFGEGYFTVDEESG-------EISVSRPLDREQISIHQLVVQARDGGDQPEVTSILLTVKVLDVNDNSPGIHITLITESGRPEVSEGARTGEYLARIFVQENRVSVRLEGGEGSFSLQPAGPQLYFLCVN---------APLDRELKDMYELQILAWDTGSPPLQSHKTLLLSVTDLNDQPPMFLQ--PEGYQATISEATSIGTAVLMLKAQDLDEDGPNSRVTYSLQESQNSSSFIL---EPGTGVLSIAQLLDHESAPVLNLVAVATDHGSPPLSSSCTITITVEDTNDNDPIFLQQFYNVSLQEHTVLG---HCFLQVKATDADSGPFGQIHYSVYDGFHNTKESQSFRIDPDSGRICVSNDIDKESGPTSYDLLVKAEDEGGLSAQAFVRVDIEDINDNAPVFEPSTY--VTSISSHTQPGTEILNVMAIDRDEGLFGDVTYELL--------SGEHSSLFTIDS-------STGIIYLISVLSHLEDSWVSLSVAARDKGGLTSAVNATVTMNILKTATAPAIFEKSRYTFVIAEDVPKGSAVGTVKAREPLNSLEPVSYRIISGNVHQ-MFTIHTQFGIIRTQKELDFESLPLVVLTVQSQLGSSSVFSSTQVNVTITDANDNPPVFSSENERISVHQNTSPGTAIYIAQATDLDSGFNGQISYSIASENQD--LFIIDSTFGVLYLNATLSSVREHVLLILAEDYGHPVISSLLTLTIIVEQNKQSNTLSFFNLVHRTEISETLPINSHILQVKAYTRNTQSTSSEIMYSLSPTIDSAPFRIHQSTGWIFLRRSVDYEKSKTHNLKVVATSGDREDQQTATASIIVKILDENDNSPSFDHATHFFTVNESPVPHGVIGSIQAFDRDSGNNGQLSYFL-----LSEGNNFLISSKTGEIINCASL---DRERKAHHELNVLVTDNGTPRRNATTTVYIIVA--DLNDNKP 1202          

HSP 11 Score: 87.4261 bits (215), Expect = 5.036e-16
Identity = 141/629 (22.42%), Postives = 250/629 (39.75%), Query Frame = 2
Query:  257 VSGLIDREKQNLYSFLIISMNGDT------KNVQIKILDVNDNEPKF-NATNFEKSIPENYPIGSKVDLTTVFDPDE-GKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDN---TSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISI--------------------GVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYD-AISTSFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEIDSTILNENQHVTFVKTTKRLPTKPIFIFKIFVLN--NLFKINETTGEILSKRSIDCGKYFFNVSML--SLKTNSLIDQTKLEIVVKSGRKLPLYFDRGFRKILV--TTGKSQCFSEIAVRNRHCGMRIQYSY-------DLLL--KTDGILRIN-------EHGALCTAENVKHNKLMSTRYLYQIKALDETNSSAVCVVLFAIQPSKVFDVLPTEINITLPI 1981
            V+  +DRE +++Y   I++ +  +      K + + + D+ND  P F     ++ +I E   IG+ V +    D DE G NS  +  +    +   F ++      G+    L + Q LD+E     NLV  A D G PPL +S  + I V++ NDN P F    Y  S++E   +   FL+V+ATD D+G  G++ Y + +    +  S  F +D  +G + +   +D E   + +  +                     + DN+P F  S                         ++ I+    P T + +V   D D  +      E+L+     L  I      + LI+ + + + + ++L++ A D    + +    +T+ I ++      F  SR+   I   +  +   V  VK  + L +     ++I   N   +F I+   G I +++ +D       V  +   L ++S+   T++ + +      P  F     +I V   T            +   G   Q SY       DL +   T G+L +N       EH  L  AE+  H  + S   L  +  + E N  +  +  F +       V  TEI+ TLPI
Sbjct:  422 VNAPLDRELKDMYELQILAWDTGSPPLQSHKTLLLSVTDLNDQPPMFLQPEGYQATISEATSIGTAVLMLKAQDLDEDGPNSRVTYSLQESQNSSSFILE---PGTGV----LSIAQLLDHESAPVLNLVAVATDHGSPPLSSSCTITITVEDTNDNDPIFLQQFYNVSLQEHTVLGHCFLQVKATDADSGPFGQIHYSVYDGFHNTKESQSFRIDPDSGRICVSNDIDKESGPTSYDLLVKAEDEGGLSAQAFVRVDIEDINDNAPVFEPSTY-----------------------VTSISSHTQPGTEILNVMAIDRDEGLFGDVTYELLSGEHSSLFTIDSSTGIIYLISVLSHLEDSWVSLSVAARDKGGLTSAVNATVTMNILKTATAPAIFEKSRYTFVIAEDV-PKGSAVGTVKAREPLNSLEPVSYRIISGNVHQMFTIHTQFGIIRTQKELDFESLPLVVLTVQSQLGSSSVFSSTQVNVTITDANDNPPVFSSENERISVHQNTSPGTAIYIAQATDLDSGFNGQISYSIASENQDLFIIDSTFGVLYLNATLSSVREHVLLILAEDYGHPVISS---LLTLTIIVEQNKQSNTLSFFNL-------VHRTEISETLPI 1009          

HSP 12 Score: 78.9518 bits (193), Expect = 1.937e-13
Identity = 77/310 (24.84%), Postives = 129/310 (41.61%), Query Frame = 2
Query:  110 NLLIFSIKENVPIGEVV---------GQIESPGFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKN----------VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD-NSPPFHTS 979
            ++++  + E+VP+G ++         G +E+         H   E  F I +  G +  +  +DRE    +  L ++      N          V+I I D+NDN P+  +     S+ E+  IGS V      DPDEG+N      I  G              N    + L+     D+ I     L I A+D G P L  +  + I + + ND  P F    Y A++ E+Q+  +  ++V A D D G +  L Y +    P+   F ++ +TG +      D E+     I + V+D  SPP  ++
Sbjct: 1422 HIIVLGVDEDVPVGTLLYTFKANDKDGSLENSKIRYSLNTHGTGENPFFIHEWEGALTTANELDREMAESF-VLTVTATDQAANISHRRCTSVIVRIVIQDINDNSPQVLSLPV-ASVMEDAQIGSLVHRIVAKDPDEGRNGKIGFHIKEG--------------NNFVDLNLLYLYFQDHYI-----LTILALDDGIPSLSVTQTLTISLIDVNDKTPTFTQGLYEAAVPENQDPGLYVIKVAAVDYDLGNNSVLTYEI-LPGPAYGHFRINPETGELVTTTVFDREQQDRFIIEVLVKDGGSPPLSST 1709          

HSP 13 Score: 77.7962 bits (190), Expect = 5.037e-13
Identity = 68/255 (26.67%), Postives = 115/255 (45.10%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLIISMN------GDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSG----DSEKVFAIDYHDSSNGIFYVRLILKQSLDYEI-ISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD 955
            FI+   TGV+ ++ L+D E   + + + ++ +        +  + I + D NDN+P F    +  S+ E+  +G         D D G        +  G       + F ID  DS       R+ +   +D E   + ++L+++A D G   L A   V++ +++ NDN P F+ S Y+ SI    +     L V A D D G+ G++ Y L +   SS  FT+D  TG +YL   L   +     +S+  RD
Sbjct:  518 FILEPGTGVLSIAQLLDHESAPVLNLVAVATDHGSPPLSSSCTITITVEDTNDNDPIFLQQFYNVSLQEHTVLGHCFLQVKATDADSGPFGQIHYSVYDGFHNTKESQSFRID-PDSG------RICVSNDIDKESGPTSYDLLVKAEDEGG--LSAQAFVRVDIEDINDNAPVFEPSTYVTSISSHTQPGTEILNVMAIDRDEGLFGDVTYELLSGEHSS-LFTIDSSTGIIYLISVLSHLEDSWVSLSVAARD 762          

HSP 14 Score: 75.485 bits (184), Expect = 2.416e-12
Identity = 75/265 (28.30%), Postives = 121/265 (45.66%), Query Frame = 2
Query:  215 EKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNG--DTKNV-----QIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSG--DSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHH----ISIGVRDNSPPF 970
            E  F I    G + +   +D E+   YS  + + +G    +NV      I +LD ND  PKF   +   +I EN P  S V      D D G+  I S  I S   + ++  A    DS  G  Y     K  +DYE+  +  LV+Q  D       A +LV I ++  ++  P F  ++Y+  + E+        +V A DND G+ G + YFL+     S FF+++  +G +YL +++  ++S +      I   V+ +SP F
Sbjct: 2598 ENVFTIDAQNGTVTLVQPLDYEETMKYSLTLQARDGHGSKRNVAFALLSITVLDENDFAPKFLFQSQSCNIYENVPFFSPVCSVNAIDLDSGQYGILSFSIQSSCFNDQQHPATFLIDSLTGDIYT----KHRIDYEMQERHCLVVQVKDRSES--SACVLVYIDIEGEDEFQPVFYQNQYLFDLPEENIGGQEIGKVGALDNDEGLDGVVHYFLEK---PSQFFSINMTSGMIYLTRTVHKKRSNTRKNDEFIEFHVKAHSPKF 2853          

HSP 15 Score: 74.3294 bits (181), Expect = 5.137e-12
Identity = 75/264 (28.41%), Postives = 117/264 (44.32%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKNVQ-------IKILDVNDNEPKFN-ATNF----EKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKF----DISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            F I ++TG I +   +D EK   ++  +++ +GD ++ Q       +KILD NDN P F+ AT+F    E  +P    IGS       FD D G N   S  ++S  +  + +     S  G     +I   SLD E  +   L +   D G P   A+  V IIV + NDN P F       +    + E Q   +    V A D DAG +G + YF   +  S   F ++  TG ++  K+L  +    + +++   D   P
Sbjct: 1043 FRIHQSTGWIFLRRSVDYEKSKTHNLKVVATSGDREDQQTATASIIVKILDENDNSPSFDHATHFFTVNESPVPHGV-IGS----IQAFDRDSGNNGQLSYFLLSEGNNFLIS-----SKTG----EIINCASLDRERKAHHELNVLVTDNGTPRRNATTTVYIIVADLNDNKPYFPQLASGKQLHVKVMEGQAEPMLVATVYAKDPDAGNNGTVVYFF-ASDESFGQFVINASTGEIWTTKALTAKLRPQYGLTVTASDQGTP 1291          

HSP 16 Score: 72.4034 bits (176), Expect = 1.761e-11
Identity = 173/790 (21.90%), Postives = 314/790 (39.75%), Query Frame = 2
Query: 6233 IDREKIDKIILWTQVSCGGSEIRGYKKVI-IHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLID-ANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRP-------VGSFITKITAKDS------DGPDGISYRIRHRKLTNQTLFLNVAFDSG-EIFLSRKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPI-LKENGRVINLSSSLKRGSKILYLHAIDKDLRD-NGKVTFELVST--SPWFGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSD--KAIFYKI-DNFHPI--SNNLYLDFESGDLYLTKSLNYSIQP-RFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYDPPSFQIDSS-NILW-----------WIN--------GDLFESRIWNLTIMIVKAQKYQNSPSNLYENGYLFVNIE-VPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHDIQYFLTPHENFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIVENPSENFGINNETGAIYI 8461
            +DRE++D   L  +   GG+  R  + ++ I V D +DN PVF Q  +  ++ E  P  T V  +   DPD+G N +V Y + F   +  F +D  +G++  + PL+    S++ LV++A             LTV ++++ND  P I I    L  ++ RP        G ++ +I  +++      +G +G S+ ++        L +N   D   +     ++L  D G              S   + + V D N+  P+ L+  G    +S +   G+ +L L A D D    N +VT+ L  +  S  F L       +   L+D   E      L    TD+   P   L S   +T+ ++      P  +      +++ E    G    +    D DS     I Y + D FH    S +  +D +SG + ++  ++    P  + L+V     G         + ++   +N  P    + Y+T    +    Q    I N++ +D++   +      +   +  ++     F IDSS  I++           W++        G L  +    +T+ I+K      +P+   ++ Y FV  E VP+       K  E       +N  EP    ++       ++    T H  F +  +Q +           LDFE+     L +L   S     S   +  V +++ D ++  P F  ++   +V       G  ++ A A+D D G  G +SY I     + F I++  G +Y+
Sbjct:  219 LDREELDNYQLEVEAFDGGNPRRTGRLIVDIVVMDANDNPPVFDQLDYKGWVWENAPIGTSVCTVHATDPDLGSNGEVRYSLRF--GEGYFTVDEESGEISVSRPLDREQISIHQLVVQARDGGDQPEVTSILLTVKVLDVNDNSPGIHI---TLITESGRPEVSEGARTGEYLARIFVQENRVSVRLEGGEG-SFSLQPAGPQLYFLCVNAPLDRELKDMYELQILAWDTGS---------PPLQSHKTLLLSVTDLNDQPPMFLQPEGYQATISEATSIGTAVLMLKAQDLDEDGPNSRVTYSLQESQNSSSFILEPGTGVLSIAQLLD--HESAPVLNLVAVATDHGSPP---LSSSCTITITVEDTNDNDPIFL-QQFYNVSLQEHTVLGHCFLQVKATDADSGPFGQIHYSVYDGFHNTKESQSFRIDPDSGRICVSNDIDKESGPTSYDLLVKAEDEGGLSAQAFVRVDIEDINDN-APVFEPSTYVT---SISSHTQPGTEILNVMAIDRDEGLFGDVTYELLSGEHSSL-----FTIDSSTGIIYLISVLSHLEDSWVSLSVAARDKGGLTSAVNATVTMNILKT---ATAPAIFEKSRYTFVIAEDVPKGSAVGTVKARE------PLNSLEPVSYRIIS-----GNVHQMFTIHTQFGIIRTQKE-----------LDFES---LPLVVLTVQSQLGSSSVFSSTQVNVTITDANDNPPVFSSENERISVHQNTSP-GTAIYIAQATDLDSGFNGQISYSIASENQDLFIIDSTFGVLYL 949          

HSP 17 Score: 58.9214 bits (141), Expect = 2.035e-7
Identity = 73/265 (27.55%), Postives = 117/265 (44.15%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSF-LIISMNGD-----TKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDL--TTVF--DPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNA----NDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD---NSPP 967
            F+IS  TG I     +DRE++  +   ++++ NG      T  V I + D+NDN+P F      K +      G    +   TV+  DPD G N        S +S   F I+   +S G  +      ++L  ++  Q+ L + A D G PPL    +V I V +A       V K    +   +    Q+I      V + +    +S ++ Y L N   +   F VD  TG+VY+ + LDFE    + +SI +++    SPP
Sbjct: 1147 FLISSKTGEIINCASLDRERKAHHELNVLVTDNGTPRRNATTTVYIIVADLNDNKPYFPQLASGKQLHVKVMEGQAEPMLVATVYAKDPDAGNNGTVVYFFASDESFGQFVIN---ASTGEIWT----TKALTAKLRPQYGLTVTASDQGTPPLVEHTVVNIEVISAFKEKTKTVSKIKTMKVPENTYPTQKIG----SVISHEEAFLLSSKMHYRLANEE-NKGHFVVDSLTGDVYVSRHLDFETISYYGLSIDIQEIDKISPP 1399          
BLAST of Dachsous vs. Ensembl Xenopus
Match: FAT4 (FAT atypical cadherin 4 [Source:NCBI gene;Acc:100145590])

HSP 1 Score: 214.927 bits (546), Expect = 1.681e-54
Identity = 552/2379 (23.20%), Postives = 972/2379 (40.86%), Query Frame = 2
Query:  128 IKENVPIGEVVGQIES----PGFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDT------KNVQIKILDVNDNEP-----KFNATNFEKSIPENYPIGSKVDLTTVFDPDE-GKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLI-LKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKII-VQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQ-ILWTGGLSEINRDISPNTIVAHVKLTDYD-----AISTSFDLEILNRSPFQ-LIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEIDSTILNENQHVTFVKTTKR----LPTKPIFIFKIFVLN-NLFKINETTGEILSKRSIDC-GKYFFNVSMLSLKTNSLIDQTK--LEIVVKSGRKLPLYFDRGFRKILVTTGKSQCFSEIAVRNRHCGMRIQYSYDL------LLKTD---GILRINEH-GALCTAENVKHNKLMSTRYLYQIKALDETNSSAVCVVLFAIQPSKVFDVLPTEINITLPII--DSPKF---------NFSLPIGKIIGTFSKLPPAQFI-GFIQYHLV--PEELSTGAITVDSQSGEI-LMKKFPIHKNPIRL-IVKSVIRKPFNVSP----LNIVAINFQKLFFARSLYQFILTKSE-IKGNLVKIGQVSMDSSCTESVSYDLFGVKNDHSHFTIDVATGVIYGK-DLGSISNKTLMFQVSA--KAPKSQTSFAQVIIYIED-GIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSDEYQII---QSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDL-------------SSLGEMECPL------KCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNVFY-IHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITT--KVSLSCAQNVKIRIFVSDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQ--PGYVVGDLNIFPENYGAKCLFISNTTTSVD------GFLHLRF---DSQQLILLKDNLNVK--------NVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEI-KENLPSGSHVASFNIRRLKNLEVVYSI---------KQPEKYFVINPVTGQLVTFRMFDRETENQIQFY-VEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSI-VRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEI---HLVSSPRVSAYEL---------------NVTVRDSGE-VPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYD-LQRIFINIDYGNENPPRFSRSIFKVKLPED-EAITNFLTVVANDPDLGIFGRIIYSL-EGDTFDKKIFIDPSTGKLSCSPLNFME-KNIYNLKIIATDSEGLSTGR-KDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPV--NSEIFY-VLNPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSN--ITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQ---------YVQIVPE------KAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDRE-KIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLID-ANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD 6754
            I+E+ P+G  V ++E+     G +        +   F I   +G++ +   +D E +  Y+  I + +  T          ++++DVNDN+P      F AT+   S+ EN  +G+ V L TV D D    N   +V I+ G+ ++ F +      N    + LI +  SLD E I  +NL +   D GHP  ++S+   +I V + ND+ P F        I ED         V A+D D G++  L Y + + +    +F++   +G V    +LD E +    ++I  RD  P   TS   ++++++D+ND  P+   I   G L  +  +    T +  +K TD D      I   FD +  N S  Q L ++ P   +L    D+   + +   L + A D   P LS+T  + +    S+L  N  S   + V+  + I       +FV T       L       + I   + + F+++  TG I +K ++D   K  + + +++     L       + I V   +  P  F +G    ++       F  +AV   + G  +  + DL      L+ T    G+  I+   G + TA  V   +    +  YQ+K +    +S   V   AI            +NIT+  +  +SP F           +   G II     + P + + G + Y L   P+ L      VD  +G + L     +     ++ I+ S +  P   S     +++  +N     F +  Y+  L +SE +     K+     DS     ++Y +    N    F I    G +Y K +L        + QVSA  +A +  ++   V I +ED   ++P F+ ++ +    E  + G  + +++          +I+   ++   D+  +++ TG+I    QFDRE          L    G+A   L +   D+   KP    +       D+             +S+ E+   +        SD D   NG +SY    I        F ++ +TG + ++  L+      +   +L++   D+G   PL     +S+ ++D N++SP      +F  + +    G  V ++   D D G+N +I  S+   + +  F I   + + F+ +    ET   Y   LN+   A D+G+P +SS ++++I   + N NPP        K ++    +L G+ I TV A DPD  +N    Y+I       +   ID   G I T  ++    A   ++ +  SDL  P                +S ++ + KN+T +I D +   P +V    N F  +       + +T T+ D      G +       D++  I+ + + +++        ++ YSL V          ++   + +I+   G   P+FS+  PK++ I KE  P G++V S      +  + V            +   + F I   TG + T  + DRE   ++    V  I    S PK      + + + D NDN P    P+  + + +     + + I Q+ ATDAD GPN+ +TY I   +D  F I+ +SG++     +   R S Y L               N+T+ D  + +PK    V+S                           +  G I+  +  +   S  N +I Y +       IF ++P+TG      ++      + E+ Q  V+     D    D   R++ NI   N+NPP FSR+ +   + E+    +  LT    D D G   ++ Y++  GD+  +  F     G LS   L   E ++ Y+L +   D       R     +V I + +   +  +F +   +  V EN+P  TV+ R     P    NS I Y +L    +   I    GE+R  G L  E +    LTI A  K   + S   +S  +++ ++DINDN P  ++   K+ I  S      L +L A+D+D+  N  + Y     +P+ +     + +D  +G L +   +    K  + LK+  SD G   +  T  + I L+  +          Y   VPE      K I +V     D     ++            +S+  G N +  F   S+G++ +  +  +DRE K    +L T    G   + G   + I V+D++DNKP F+ N     + E  P  T ++ +   D D G N  + Y +   +SQ  F I+ + G + ++  L+   K  Y L++ A+   SP + +   +TV I ++ND  P+         + +    GSF+  +T  D D
Sbjct:  251 IEEDSPVGSSVLKVEATDRDEGPNAAIRYQLAEGTPFQIDPESGLVTIREPLDYESRRQYTLSIQAKDLGTPPLTGRSEALVRLIDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNVTVAILGGNEQRHFEVQTSKVPN----LSLIKVASSLDRERIPSYNLTVSVSDQGHPRPRSSVASLVIYVNDINDHPPVFQEPHSKVEISEDLPPGSYICGVSASDGDTGLNANLRYSIVSGNKLG-WFSISENSGLVTSTSALDREIAPQLLLNISARDQGPQPKTSYATLLVNLLDVNDQKPTFTGINVNGHLVSLPENSLVGTELLMLKATDGDLGDNGTIRFYFDAD--NPSQCQGLFRLDPLSGKLSNRADLDREQQDRCTLQILATDLGTPPLSSTAKVIV----SLLDVNDNSPVFYPVQYFANIQENEPPASFVATVTASDPDLGINGTIRYSIRAGDTSKFQVHPETGAISTKAALDREEKTAYQLQVVATDGGGLQSHNHAIVTITVLDTQDNPPSFSQGSYSFVM-------FENVAV-GYNVGTVVATTIDLNTNITYLVTTGDQKGVFTIDRSTGLIMTASVVDREE----QDFYQLKVV----ASGGAVTGEAI------------VNITVKDLNDNSPHFVNAVENVNVVENWKTGHIIFQAKAVDPDEGVNGRVSYSLKQNPQSL----FYVDEVTGAVSLTGPLDVDTGSYQVEIIASDMGVPQLASSFILTISVHDVNDNPPVFDQLSYEVTLLESEPVNSRFFKVYATDKDSGLNGEITYSIIH-GNVGEAFGI-FPDGQLYVKSELDREVKDLYILQVSASDRAVEPLSTTVNVTIILEDVNDNRPLFNSTNYVFYFEEENSGGSFVGRIYAVDKDSGSNGEIMYAFETMQPDF-ELNTVTGEITSTHQFDRE---------ALMRQRGAAAFTLKVTSTDLGLPKPLKDQATVQIYIRDINDNHPKFSKDLYQASISELASNMTQVLRVSSSDVDEGNNGLISYS---IMKGNEEKHFTMDSSTGQVALVGRLDY---EATASYSLIIQAVDSGAV-PLSATSTLSIEVLDENDNSPSFPKAALFVDVVENMRVGELVSSVTATDSDSGDNADIHYSITGTNNHGTFSISPNTGSIFLAKKLDFETQALY--KLNIT--AKDKGNPPRSSTMSVIIKVRDFNDNPPSFPAGDIFKSVVEN--VLIGTSILTVTATDPDADINGQLTYTIIQQKPRGNHFVIDEVRGTIYTNAEIDREFANLFELTVRASDLAVPL---------------ESRKYAL-KNVTILISDLNDNVPTFV--SQNAFAADPSLAIGSVLSTITAFDPDEGSNGEIEYEIISGDTETFIVDRYSGDLRVAAPMLPSHLIYSLIVAATDLGAERKATTTELTIILE--GQDGPVFSQ--PKYITILKEGEPVGTNVISIEAASPRGTDSVVEYFIVSVRCEGRTVGRLFTIGRNTGVIQTAAVLDRERGARLYLVDVYAIEKEASLPKTQRAQ-VEITLQDINDNPPVF--PTDILDLTVEENVGDGSKIMQLTATDADEGPNALVTYTIISGADDSFRIDPESGDLIATKRLDRERRSKYSLLVRADDGLQSSDMRINITISDVNDHIPKFSRAVYSFDVAE---------------------DTIPGSIVAAILATDDDSGVNGEITYAVSDDDDDGIFFLNPVTGVFNVTRAL------DYELQQYYVLTVCAQDGGGQDSCVRVYFNILDVNDNPPVFSRNSYSASVMENLPPGSTILTFNVTDADDGFNSKLSYTISSGDSMGQ--FQVSKDGTLSVLQLLDRETQSFYSLVVQVHDMAPPPAPRYTSSVEVSIILLDVNDNPPSFISPKLTY-VQENTPTDTVVFRAQATDPDSGPNSYIQYSLLGSLGNKFSIGIIDGEVRLTGELDREDISNYTLTIIAKDKGEPSLS---SSMDMNIIVLDINDNSPHFSQRHFKVEISESTLTGTDLIQLIASDADEGINGMVRYAIIDGNPSNE-----FRIDSVTGVLSIARPLDRERKSSYTLKIQASDRGSSPRSDTATVSILLSDINDVVPKFELSPYTVSVPENLETLPKIILQVVARDDDQGLNSRL-----------TYSLASG-NEDGAFTLSSSGQLSLIKS--LDREVKEWYSLLITATDAGFPALTGTGTISIQVEDINDNKPTFALNHHFITIPEDAPTGTDILMVNCSDSDAGQNGVIRYSLNGGNSQ--FTINPSTGQIISSSLLDREAKDHYTLLVIATDGGSPPLTSTTNVTVNIRDVNDNPPRFLHHPYVTHIPSPTTAGSFVFAVTVTDED 2482          

HSP 2 Score: 204.527 bits (519), Expect = 2.108e-51
Identity = 416/1615 (25.76%), Postives = 696/1615 (43.10%), Query Frame = 2
Query: 2345 DSSCTESVSYDLFG-VKNDHSHFTIDVATGVIYGKDLGSISNKTLMFQVSAKA-PKSQTSFAQVIIYIEDGIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSDE-------YQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIGSA---TXXXXXXXXXXXXXKPYCKNSKTNFTF-EDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNI----WNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNVF-YIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFF-CPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVKIRIFVSDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNL-TFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNV-HYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGS--HVASFNIRRLKNLEVVYSI--KQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENAS----IFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEIHLVSSP----RVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKS-GFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSV-QTQH------SVSREEIGNSEIVQIPVVIQSLHDAS--IYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAI-TNFLTVVA-NDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCSPLNFMEKNI-YNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINI--VKPPVNSEIFYVLNPGHSH--IQINTTTGELRTNGPLHLELVEFIELTIHAF-AKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSN--ITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYV-QIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVF---------LHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGY--KKVIIHXXXXXXNK-PVFSQNKFVAFLNEGQPPKTPVIRLTVYDPD-IGFNSQVEYFIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDG---ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARF---SSTAVIEIDVEDKNNH 6967
            DS     + Y L G + N  S   ID    +    D   ISN TL      K  P   +S    II ++   + P F      V I E+T  G +++Q+     S +DE       Y II    S+   I S TG + + +  DRE+ S   + +Q  +   S    T  + + + DIND  P  + S    +  E+L +L ++   +   D D   N  L+Y +      G    F ++ ++G L +I SL+     W S       LL+  +D G F  L     IS+++ D N++ P     + F  I + A  GT++  +   D D G+NG I  SL   +    F I   +       +   E  + Y     +++IATD GSP  +S  N+ +N  + N NPP  +    H  +     P  +GS +F V   D D G N+  ++S  L   N ++ +ID   G I T  ++  A  +   + V D G    T      ++  +  K++  LI  +  TF  P++ + G +V  +       G+   +I+  + +     H+   + QL  +K+ L+ + +  Y L V          SS   + + V  V  + P F +D P   EI ENL       +++ +     N +V Y+I     E +F IN V G++   R  DRE  +  Q+ + V A+   +P   +++ +I+ + D+NDN P      S I   SA   ENA     + Q+  +D D+G N+   Y I  +S   F IN ++G I  VS P        Y + V+  DSG    +VS   +I    +   +  RF  +  S  L  P++   G  + Q+ ++  S  G     YY I  + +++F ++  TG +   QH      SVS    GN  I +   ++ +    S  I     + INI   N+N P+FS + +   + ++  I T  + V A +D D G+   + YSL  +    K  ID  TG ++ +    M+ N  Y +K+ A D        +    + +  +N   HT  F+ +H S+ VLE+   GTV+  I+       +N  I Y ++ G+      IN +TG L     L  EL +  +LTI A    +++    +T   ++ + + D+NDN PI   +     +  +      + +L+ATD D   N  I Y    SD        ++++D  +G +  +  +    K  + L V   +     +C+ V + + L   ++YV + V +   F V E +  GT +G++    +  D       IDG  H L+F         + + TGKI V+    +DREK ++I L       GS IRG    +V +++  +D N  PVFS   +   ++EG  P T V  ++ +D D +   S+  YFI   + +  F I+   G V     L+     +Y+L + A    SP       L V + +IND  P +S     +K   N   G+ +  + + D D P      SY +           L+     G +  +R++    + +    +V  D+ F   SST  + I V D+N++
Sbjct: 2065 DSGPNSYIQYSLLGSLGNKFSIGIIDGEVRLTGELDREDISNYTLTIIAKDKGEPSLSSSMDMNIIVLDINDNSPHFSQRHFKVEISESTLTGTDLIQLIA---SDADEGINGMVRYAIIDGNPSNEFRIDSVTGVLSIARPLDRERKSSYTLKIQASDRGSSPRSDTATVSILLSDINDVVPKFELSPYTVSVPENLETLPKIILQVVARDDDQGLNSRLTYSLASGNEDGA---FTLS-SSGQLSLIKSLDREVKEWYS-------LLITATDAG-FPALTGTGTISIQVEDINDNKPTFALNHHFITIPEDAPTGTDILMVNCSDSDAGQNGVIRYSLNGGNSQ--FTINPSTGQIISSSLLDREAKDHY----TLLVIATDGGSPPLTSTTNVTVNIRDVNDNPPRFL---HHPYVTHIPSPTTAGSFVFAVTVTDEDIGSNAELHFS--LKGRNSEKFHIDPLRGAIRTAGAIEGASEITFSVHVRDGGLNSKTDLTTVTVR--FANKADFPLIRADRKTFTFPENQEVGTLVSTIFGSSSRGGSLSFYIA--SGNFGNTFHIDELNGQL-YIKNPLDFETMPKYELWVEARDMGFPPFSSYEKLEITVLDVNDNQPQFKQD-PFIAEIIENLSPRKILTISAEDKDSGSNGQVEYTIFDGNKEAFFSINRVNGEIRNTRQLDREKAS--QYTLSVKASDKGSPARSSIVKVIIYVLDDNDNAPRF----SQI--FSAFVAENAVLGCFVTQVTTSDEDAGANAISRYTIADTS-LPFHINLNTGVI-TVSRPLNREDNDRYIVRVSAHDSG---WTVSTDVTIFVTDVNDNAP-RF--SKPSYYLDYPETLDIGSKVTQV-FATDSDEGLNGHVYYFIKSQ-SELFRINSTTGEIFNKQHLKYQNPSVS----GNININRHSFIVSASDRGSPPIMSETTVSINIVDSNDNAPKFSSTKYFTPVSKNAKIGTKLIKVTAVDDKDFGLNSEVGYSLSTENIHGKFQIDKETGWITVASSLMMDINKNYMIKVFAKDKGNPPLSSQALVNITVTEEN--YHTPEFSQSHVSVTVLESLSVGTVIRTISARDRDASMNGIIAYNISSGNEAGLFAINASTGALSLLKNLDYELCQKHDLTISAVDGGWVA----KTGYCVVTIYVKDVNDNPPIFKADEYFPSVMENAPSGTTVIRLNATDVDSAPNAVIAYSVQSSDS------DLFVIDPNTGIITTQGFLDYETKQHYHLTVKAFNVPDEERCSFVTVTVQLEGANEYVPRFVSKLYYFEVSEAAPKGTVVGEV----FASDRDGG---IDGDVHYLIFGSSRKKGFQIDKKTGKISVSGI--LDREKEERISLKIIAKNVGS-IRGADIDEVNVNITILDANDPPVFSLKVYNVQISEGVTPGTHVTFVSAFDSDSVPSWSRFSYFIGSGNDKGAFAINPQTGQVTVTTELDREMTPLYNLTVLAIDSGSPSATGSAALLVTLDDINDNGPTLSTTKGEVK--ENYRAGTHVMTLQSTDLDLPPNQGPFSYYLLSTGPATSYFSLSPG---GILTTTREIDREQINEFFLSVVTRDSGFPQMSSTGTVHITVTDQNDN 3598          

HSP 3 Score: 199.904 bits (507), Expect = 6.284e-50
Identity = 368/1542 (23.87%), Postives = 648/1542 (42.02%), Query Frame = 2
Query: 3308 SLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSG----SEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTK---VSLSCAQNVK----IRIFVSDLGFPKMTSSVDTLL--------KPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCL-----------FISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFS-ISSNLYINVIVNRVGFSWPLFSKD--SPKFLEIKENLPSGSHVASFNIRRLKNLEVVYSIKQ--PEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIV----ATDADSGPNSKLTYQINPSSD-GIFMINGDSGEIHLVSS---PRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKT-----------KSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYS--QTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRF-SRSIFKVKLPEDEAITNFL-TVVANDPDLGIFGRIIYSL-EGDTFDKKIFIDPSTGKLSCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPP-----VNSEIFYVLNPGHS---HIQINTTTGELRTNGPLHLELVEFIELT-IHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSN--ITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPE--KAI--FRVKENSVDGTFIGQIKMVNYCKDHSA-----KFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDANGDVKTNIPLNFHTKSVYDLVIKASSKA---SPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDD---ARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEP--QEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKIT-KFVCKDLDS--DKAIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIE--KENKGPNLIDNKYITLSLQVP 7654
            SLKQ +    FY+++++    +     ++T  SY     V +IA+D G P  +S   L I+  + N NPP         Q+ +   LL      S  F V A D D GLN    YSI          N+    G+       V     + VK    +++  SD     ++++V+  +        +PL+         + N  F   + +  G  VG +    ++ G+              F  NT T      H +FD + L+  +         ++L V      L   +     + + +  +  + P FSKD       E+  N+     V+S ++    N  + YSI +   EK+F ++  TGQ+      D E        ++ + +      +     L +++ DENDN     SPS     +     EN  + ++V    ATD+DSG N+ + Y I  +++ G F I+ ++G I L         + Y+LN+T +D G  P+S ++   I  +               KS +  +    S+           I GQL+Y+  Q    GN               F +D + G++ T   + RE     E+      +    ++  Y L+ + I I   N+N P F S++ F        AI + L T+ A DPD G  G I Y +  GDT  +   +D  +G L  +        IY+L + ATD   L   RK  T  +  +    Q    F+   +   + E  P GT +  I    P      V   I  V   G +      I   TG ++T   L  E    + L  ++A  K  S    +T  A +++ + DINDN P+   + + + +  +      + +L+ATD+D+  N  +TY               + +D +SG+L     +    + ++ L ++ +D+G+ S    + I IS   DH     +P+  +A+  F V E+++ G+ +  I   +   D S       +++ D  +  + FL+  TG   V  A  +D E     +L      GG +     +V  ++ DV+DN PVFS+N + A + E  PP + ++   V D D GFNS++ Y I    S  +F +  +G +     L+  T+S Y LV++    A   +P   +   +++ ++++ND  P    P     +  N P  + + +  A D D GP+  SY I++  L +     ++    GE+ L+ +L   D+  +   I+  D      SS+  + I V D N++ P   +    + +S S   G+ ++ L A D D   NG V + ++  +P    R  D+ T  L  I  P  +E+   Y L IQ +D    P+    ++   ++LL       P+   +  T +++PE+L++  KI  + V +D D   +  + Y + + +   +  +    SG L L KSL+  ++  + L++T    G P    +  +S+Q+E   +NK    +++ +IT+    P
Sbjct:  918 SLKQ-NPQSLFYVDEVTGAVSLTGPLDVDT-GSY----QVEIIASDMGVPQLASSFILTISVHDVNDNPPVF------DQLSYEVTLLESEPVNSRFFKVYATDKDSGLNGEITYSIIHG-------NVGEAFGIFPDGQLYVKSELDREVKDLYILQVSASDRAVEPLSTTVNVTIILEDVNDNRPLFN--------STNYVFYFEEENSGGSFVGRIYAVDKDSGSNGEIMYAFETMQPDFELNTVTGEITSTH-QFDREALMRQR-----GAAAFTLKVTSTDLGLPKPLKDQATVQIYIRDINDNHPKFSKDLYQASISELASNMTQVLRVSSSDVDEGNNGLISYSIMKGNEEKHFTMDSSTGQVALVGRLDYEATASYSLIIQAVDSGAV--PLSATSTLSIEVLDENDN-----SPSFPKAALFVDVVENMRVGELVSSVTATDSDSGDNADIHYSITGTNNHGTFSISPNTGSIFLAKKLDFETQALYKLNITAKDKGNPPRSSTMSVIIKVRDFNDNPPSFPAGDIFKSVVENVLIGTSILTVTATDPDADINGQLTYTIIQQKPRGNH--------------FVIDEVRGTIYTNAEIDREFANLFELTVRASDLAVPLESRKYALKNVTILISDLNDNVPTFVSQNAFAAD--PSLAIGSVLSTITAFDPDEGSNGEIEYEIISGDT--ETFIVDRYSGDLRVAAPMLPSHLIYSLIVAATD---LGAERKATTTELTIILE-GQDGPVFSQPKYITILKEGEPVGTNVISIEAASPRGTDSVVEYFIVSVRCEGRTVGRLFTIGRNTGVIQTAAVLDRERGARLYLVDVYAIEKEASLP--KTQRAQVEITLQDINDNPPVFPTDILDLTVEENVGDGSKIMQLTATDADEGPNALVTYTI------ISGADDSFRIDPESGDLIATKRLDRERRSKYSL-LVRADDGLQSSDMRINITISDVNDH-----IPKFSRAVYSFDVAEDTIPGSIVAAILATD---DDSGVNGEITYAVSDDDDDGIFFLNPVTGVFNVTRA--LDYELQQYYVLTVCAQDGGGQ-DSCVRVYFNILDVNDNPPVFSRNSYSASVMENLPPGSTILTFNVTDADDGFNSKLSYTISSGDSMGQFQVSKDGTLSVLQLLDRETQSFYSLVVQVHDMAPPPAPRYTSSVEVSIILLDVNDNPPSFISPKLTY-VQENTPTDTVVFRAQATDPDSGPN--SY-IQYSLLGSLGNKFSIGIIDGEVRLTGELDREDISNYTLTIIAKDKGEPSLSSSMDMNIIVLDINDNSPHFSQRHFKVEISESTLTGTDLIQLIASDADEGINGMVRYAIIDGNPSNEFR-IDSVTGVLS-IARPLDRERKSSYTLKIQASDRGSSPRSDTATV---SILLSDINDVVPKFELSPYT-VSVPENLETLPKIILQVVARDDDQGLNSRLTYSLASGN--EDGAFTLSSSGQLSLIKSLDREVKEWYSLLITATDAGFPALTGTGTISIQVEDINDNKPTFALNHHFITIPEDAP 2365          

HSP 4 Score: 196.823 bits (499), Expect = 5.239e-49
Identity = 448/1971 (22.73%), Postives = 793/1971 (40.23%), Query Frame = 2
Query: 2855 PYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPIL------ISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSK--NTFVIRVKS---LETINSYFEPLNVMLIATDRGSPS-KSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSL--SCAQNVKIRIFVSDLGFPKMTSSVDTLLKPLYEPKSEEFL---INKNLTFI-IPDHSQPGYVV-------GDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLK---NLEVVYSIKQPE-KYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENAS----IFQIVATDADSGPNSKLTYQINPSSD-GIFMINGDSGEI---HLVSSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAI-TNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCSPLNFMEKNIYNLKIIATDS--EGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIV--KPPVNSEIFYVLNPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIP--NSNQPQ-----------------KPLTKLSATDSDKTSN--ITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIF-RVKENSVDGTFIGQIKMVNYCKDHSAK--FSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEY-FIEFYSSQEEFLID-ANGDVKTNIPLNFHTKSVYDLVIKASSKASPF---VFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDD---ARFSSTAVIEIDVEDKNN-------HVPILKE----NGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEPQEKGHPYFL----GIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKAIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESRIWNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHDIQYFLTPHENFELTCSQSQSSGCNIKSKS-------VLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISV--LDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIVENPSENFGINNETGAIYIKNQF 8473
            P   +S+     E+ S +G     ++ +D D  PN  + Y++          PF+I+P +G + I   L+  +        L +   D G   PL    E  VR+ID N++ P++       ++    + + A  GT V  L + D D                 Q  +  + SK  N  +I+V S    E I SY    N+ +  +D+G P  +SSV +LVI   + N +PP  V  + H ++     L  GS I  V+A D D GLN+   YSI ++ +     +I   +GL+T+  +L    A  + + I   D G P+  +S  TLL  L +   ++     IN N   + +P++S  G  +       GDL    +N   +  F ++  +   G   L   S +L    D    +    +L ++        +SS   + V +  V  + P+F      F  I+EN P  S VA+          N  + YSI+  +   F ++P TG + T    DRE +   Q  ++V+AT     +      + + + D  DN P     S S V       EN +    +  +VAT  D   N+ +TY +      G+F I+  +G I    +V       Y+L V V   G V  +   + +I  + +   S      N++     +   K+G II Q          N  + Y L       +F VD +TG+V     +  +    +   Q+ ++   +    +     + I++   N+NPP F +  ++V L E E + + F  V A D D G+ G I YS+      +   I P       S L+   K++Y L++ A+D   E LST       V I +++   +   FN+T++     E + GG+ +GRI  V      N EI Y         ++NT TGE+                + H F +    R     +  + V   D+   +P+  +  V+I+I   N N P+                   + ++S++D D+ +N  I+Y   + +       K + +D  +G + L   +       + L +   D+G      T  + I +  ++      P+ A+F  V EN   G  +  +   +     +A   +SI    NH    +  +TG IF+A     + + + K+ + T    G         VII V D +DN P F        + E     T ++ +T  DPD   N Q+ Y  I+       F+ID   G + TN  ++    ++++L ++AS  A P     +A   +T+ I ++ND  P   +       D +  +GS ++ ITA D D  +G +  I +  ++  T    V   SG++ ++  +L S +  +   +   D    R ++T  + I +E ++        ++ ILKE       VI++ ++  RG+  +  + I   +R  G+    L +     G+      TAA+      +E+G   +L     I+   +    Q+  + I    +    P   FP  I     ++T+ E++  GSKI +    D D                ++  +D ESGDL  TK L+   + ++ L+V      + + + S ++ + I   +   ++        S  V E     +I++ +L  D +S        +V+ +  + I+    F    + +        +E + + +  +  +    Q+S   +Y N  L VN   P                +  + EN PP +T+L       D  +    +     T S   S G    SK        +LD ET   Y L + +        +  +T  VE+S+  LD+++  P F+    T  V+   P    ++F A A+D D G    + Y ++ +    F I    G + +  + 
Sbjct:  240 PVFSSSQYQAKIEEDSPVGSSVLKVEATDRDEGPNAAIRYQL------AEGTPFQIDPESGLVTIREPLDYESRRQ---YTLSIQAKDLGT-PPLTGRSEALVRLIDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNVTVAILGGNEQRHFEVQTSKVPNLSLIKVASSLDRERIPSY----NLTVSVSDQGHPRPRSSVASLVIYVNDINDHPP--VFQEPHSKVEISEDLPPGSYICGVSASDGDTGLNANLRYSI-VSGNKLGWFSISENSGLVTSTSALDREIAPQLLLNISARDQG-PQPKTSYATLLVNLLDVNDQKPTFTGINVNGHLVSLPENSLVGTELLMLKATDGDLG---DNGTIRFYFDADNPSQCQGLFRLDPLSGKLSNRADLDREQQDRCTLQILATDLGTPPLSSTAKVIVSLLDVNDNSPVFYP-VQYFANIQENEPPASFVATVTASDPDLGINGTIRYSIRAGDTSKFQVHPETGAISTKAALDREEKTAYQ--LQVVATDGGGLQSHNHAIVTITVLDTQDNPPSFSQGSYSFVMF-----ENVAVGYNVGTVVATTIDL--NTNITYLVTTGDQKGVFTIDRSTGLIMTASVVDREEQDFYQLKV-VASGGAV--TGEAIVNITVKDLNDNSP--HFVNAVENVNVVENWKTGHIIFQAKAVDPDEGVNGRVSYSLKQNP-QSLFYVDEVTGAVSLTGPLDVD----TGSYQVEIIASDMGVPQLASSFILTISVHDVNDNPPVFDQLSYEVTLLESEPVNSRFFKVYATDKDSGLNGEITYSIIHGNVGEAFGIFPDGQLYVKSELDREVKDLYILQVSASDRAVEPLST----TVNVTIILEDVNDNRPLFNSTNYVFYFEEENSGGSFVGRIYAVDKDSGSNGEIMYAFETMQPDFELNTVTGEI---------------TSTHQFDREALMRQRGAAAFTLKVTSTDLGLPKPLKDQATVQIYIRDINDNHPKFSKDLYQASISELASNMTQVLRVSSSDVDEGNNGLISYSIMKGNEE-----KHFTMDSSTGQVALVGRLDYEATASYSLIIQAVDSGAVPLSATSTLSIEVLDENDNSPSFPKAALFVDVVENMRVGELVSSVTATDSDSGDNADIHYSITGTNNHGTFSISPNTGSIFLAKKLDFETQALYKLNI-TAKDKGNPPRSSTMSVIIKVRDFNDNPPSFPAGDIFKSVVENVLIGTSILTVTATDPDADINGQLTYTIIQQKPRGNHFVIDEVRGTIYTNAEIDREFANLFELTVRASDLAVPLESRKYALKNVTILISDLNDNVPTF-VSQNAFAADPSLAIGSVLSTITAFDPD--EGSNGEIEYEIISGDTETFIVDRYSGDLRVAAPMLPSHL-IYSLIVAATDLGAERKATTTELTIILEGQDGPVFSQPKYITILKEGEPVGTNVISIEAASPRGTDSVVEYFI-VSVRCEGRTVGRLFTIGRNTGVI----QTAAVL----DRERGARLYLVDVYAIEKEASLPKTQRAQVEITLQDINDNPP--VFPTDI----LDLTVEENVGDGSKIMQLTATDADEGPNALVTYTIISGADDSFRIDPESGDLIATKRLDRERRSKYSLLVR-----ADDGLQSSDMRINITISDVNDHIPKFSRAVYSFDVAEDTIPGSIVAAILATDDDSGVNGEITYAVSDDDDDGIF----FLNPVTGVFNVTRALDYELQQYYVLTVCAQDGGGQDSCVRVYFN-ILDVNDNPP---------VFSRNSYSASVMENLPPGSTILTFNVTDADDGF----NSKLSYTISSGDSMGQFQVSKDGTLSVLQLLDRETQSFYSLVVQVH-DMAPPPAPRYTSSVEVSIILLDVNDNPPSFISPKLTY-VQENTPT-DTVVFRAQATDPDSGPNSYIQYSLLGSLGNKFSIGIIDGEVRLTGEL 2099          

HSP 5 Score: 188.348 bits (477), Expect = 1.898e-46
Identity = 398/1677 (23.73%), Postives = 714/1677 (42.58%), Query Frame = 2
Query: 3014 FEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXX------XSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIAT-DRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSL--SCAQNVKIRIFVSDLGFPKMTSSVDTLLKPL------------YEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLR-FDSQ-------QLILLKDNLNVKNV-HYSLNV-VFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLK---NLEVVYSIKQPEK--YFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYI--LSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQI---NPS-SDGIFMINGDSGEIH---LVSSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAIT-NFLTVVANDPDLGIFGRIIYSL-EGDTFDKKIF-IDPSTGK-LSCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPP--VNSEIFYVL--NPGHSHIQINTTTGELRTNGPLHLEL----VEFI--ELTIHAFA-KFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSN--ITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIV-PEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVFLHESTGKIF--------VAAAAKIDREKIDK-------IILWTQVSCG-GSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDT--NRPVGSFITKITAKDSDGPDG--ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDAR---FSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDE-PQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLD--SDKAIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFL---LIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKNSFRYS-----YYLISVAPE 7750
            F IN TTG +   S+++   S  S +INL+V+ S   P  P  TEV I+V  +D N++SP+    ++    +    G     L    +       ++      +S  Q   ++       S     + + S   ++    P   +L+   D+G+P +   + + +   + N NPP     +   ++    P+  GS +  V A D D+G N+   Y +           ID  +GL+T +  L     +   + I   DLG P +T   + L++ +            Y P +  +         + +++Q G VV  L +   +  A      N T ++ G    R F+ Q        LI +  +L+ + +  Y+L V V ++ +    SS   + + VN +    P+F +   K +EI E+LP GS++   +        N  + YSI    K  +F I+  +G + +    DRE   Q+   +         PK  +   L+V + D ND +P    ++ +  +V +   +     +  + ATD D G N  + +     NPS   G+F ++  SG++     +   +     L +   D G  P S +    +    +   S + F       N+   +  + F +  ++ S      N  IRY + AG  ++ F V P TG++ T+ ++ REE       Q+ VV         ++   + I +    +NPP FS+  +   + E+ A+  N  TVVA   DL     I Y +  GD   K +F ID STG  ++ S ++  E++ Y LK++A  S G  TG      V I V++   ++  F     ++ V+EN   G ++ +   V P   VN  + Y L  NP  S   ++  TG +   GPL ++     VE I  ++ +   A  FI T S+   +           DN P+  +   ++ +  S        K+ ATD D   N  ITY     +      + ++      G L++KS +   +K  + L+V  SD  V    TTV + I L   +    +      +F  +E +  G+F+G+I  V+  KD         G N E+++  E+    F        + +  + DRE + +        +  T    G    ++    V I++ D++DN P FS++ + A ++E     T V+R++  D D G N  + Y I   + ++ F +D++ G V     L++   + Y L+I+A    +  + A   L++ +++ ND  P  S P   L +D   N  VG  ++ +TA DSD  D   I Y I     TN     +++ ++G IFL++KL       ++ +I   D      SST  + I V D N++ P         ++  ++  G+ IL + A D D   NG++T+ ++   P       D     ++   E  +E  + + L ++ +D A+  + R  ++  +T+L+       P  +  ++       SL  GS ++     D D  S+  I Y+I      +    +D  SGDL +   +     P  L   LIV    +G+  K T+  L++ +E ++ GP     KYIT+      + +   + +N++ ++  S R +     Y+++SV  E
Sbjct:   73 FSINSTTGSIYTTSNID-RESLISDVINLVVLSSQ--PTYP--TEVRITV--LDINDNSPVFPEPSIVVSFKEDTQGGRQVILDTATDSDAGTNGVDHRSYRIVSGNQDGRFKLGITVNPSGEGAFLHLMSQGPLDRETNPCYYLLVEVEDKGTPKRLGHLQVNVTVQDINDNPPVFSSSQYQAKIEEDSPV--GSSVLKVEATDRDEGPNAAIRYQLAEGT----PFQIDPESGLVTIREPLDYESRRQYTLSIQAKDLGTPPLTGRSEALVRLIDVNDNDPVVKFRYFPATSRYA-------SVDENAQVGTVVALLTVTDADSPAAN---GNVTVAILGGNEQRHFEVQTSKVPNLSLIKVASSLDRERIPSYNLTVSVSDQGHPRPRSSVASLVIYVNDINDHPPVFQEPHSK-VEISEDLPPGSYICGVSASDGDTGLNANLRYSIVSGNKLGWFSISENSGLVTSTSALDREIAPQLLLNISA-RDQGPQPKT-SYATLLVNLLDVNDQKPTFTGINVNGHLVSLPENSLVGTELLMLKATDGDLGDNGTIRFYFDADNPSQCQGLFRLDPLSGKLSNRADLDREQQDRCTLQILATDLGTPPLSSTAKVIVSLLDVNDNSPV-FYPVQYFANIQENEPPASF-VATVTASDPDLGINGTIRYSIRAGDTSK-FQVHPETGAISTKAALDREE---KTAYQLQVVATDGGGLQSHNHAIVTITVLDTQDNPPSFSQGSYSFVMFENVAVGYNVGTVVATTIDLNT--NITYLVTTGD--QKGVFTIDRSTGLIMTASVVDREEQDFYQLKVVA--SGGAVTGE---AIVNITVKDLNDNSPHFVNAVENVNVVENWKTGHIIFQAKAVDPDEGVNGRVSYSLKQNP-QSLFYVDEVTGAVSLTGPLDVDTGSYQVEIIASDMGVPQLASSFILTISVHDVN-----------DNPPVFDQLSYEVTLLESEPVNSRFFKVYATDKDSGLNGEITYSIIHGN--VGEAFGIF----PDGQLYVKSELDREVKDLYILQVSASDRAVEPLSTTVNVTIILEDVNDNRPLFNSTNYVFYFEEENSGGSFVGRIYAVD--KDS--------GSNGEIMYAFETMQPDFELNTVTGEITSTHQFDREALMRQRGAAAFTLKVTSTDLGLPKPLKDQATVQIYIRDINDNHPKFSKDLYQASISELASNMTQVLRVSSSDVDEGNNGLISYSIMKGNEEKHFTMDSSTGQVALVGRLDYEATASYSLIIQAVDSGAVPLSATSTLSIEVLDENDNSP--SFPKAALFVDVVENMRVGELVSSVTATDSDSGDNADIHYSITG---TNNHGTFSISPNTGSIFLAKKLDFETQALYKLNITAKDKGNPPRSSTMSVIIKVRDFNDNPPSFPAGDIFKSVVENVLIGTSILTVTATDPDADINGQLTYTIIQQKPRGNHFVIDEVRGTIYTNAEIDREFANLFELTVRASDLAVPLESRKYALKNVTILISDLNDNVPTFVSQNA--FAADPSLAIGSVLSTITAFDPDEGSNGEIEYEI--ISGDTETFIVDRYSGDLRVAAPM----LPSHLIYSLIVAATDLGAERKATTTELTIILEGQD-GPVFSQPKYITI------LKEGEPVGTNVISIEAASPRGTDSVVEYFIVSVRCE 1660          

HSP 6 Score: 177.178 bits (448), Expect = 4.647e-43
Identity = 429/1909 (22.47%), Postives = 778/1909 (40.75%), Query Frame = 2
Query: 2291 LTKSEIKGNLVKIGQVSM---DSSCTESVSYDLFGVKNDHSHFTIDVATG-VIYGKDLGSISNKTLMFQVSAKAPKSQTSFAQVIIYIED-GIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSDEYQIIQSQYSDWLSIHSKTGQIFLN---------KQFDREQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKP--YCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGP--FKPLETEVEISVRIIDANNHSPILISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRV----------KSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDN--EDQINIDSWTGLITTKVSLSCAQ--NVKIRIFVSDLGF-PKM-TSSVDTLLK------PLYE--------PKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIR---RLKNLEVVYSIKQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEIHLVSS-PRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQL-SYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKL-SCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPVNSEIF--YVLNPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNI-TYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXI--------RHFLKVIVSDNGVPS--KCTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVN---YCKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIV----VDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAAL----FLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKAIFYKIDNFHPISNN----LYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKEN-KGPNLIDNKYITLSLQVPEMIQKPAIISNL----LQMDKNSFRYSYYLISVAP 7747
            LT  E  G+  KI Q++    D      V+Y +    +D   F ID  +G +I  K L           V A     Q+S  ++ I I D   H P F  +    ++ E+T  G  +  +       +D+   +  + +  +S     G  FLN         +  D E   Y V+TV  ++  G  +       +   ++ P  + +NS +    E+L   G        +DAD   N  LSY +     +G    F+++        +S L + +       +L+V V D  P       + VE+S+ ++D N++ P  IS  + Y+ +     T V              +       P+ Y  + +     N F I +             E I++Y     + +IA D+G PS SS +++ I  ++ N N P     ++H ++      L+G+++  + A D D+G+N +  Y+I   ID    ++  IDS TG+++    L   +  +  ++I  SD G  P+  T++V  LL       P +E        P++ E L    L  +  D  Q       LN          L  S  + + DG   L   S QL L+K         YSL +        +++    I++ V  +  + P F+ +   F+ I E+ P+G+ +   N       +N  + YS+      F INP TGQ+++  + DRE ++   + + VIAT   +P + +   + V I D NDN P  L     +  I +PTT  + +F +  TD D G N++L + +   +   F I+   G I    +    S    +V VRD G   K+     ++ F +      IR    +     + P+++    +G L S    SSS    + +Y+ +G F   F +D + G +  ++ +  E +   E+    V  + +        +++ I +   N+N P+F +  F  ++ E+ +    LT+ A D D G  G++ Y++     +    I+   G++ +   L+  + + Y L + A+D    S  R    KVII+V +   +   F+   FS  V EN+  G  + ++        +     Y +        IN  TG +  + PL+ E  +   + + A        S  T S  + + + D+NDN P  ++    +  P +      +T++ ATDSD+  N   Y F +S        +++ ++  +G +F K  +              RH   V  SD G P     TTV I+I ++ +    +    K    V +N+  GT + ++  V+   +  +    +S+     H    + + TG I VA++  +D  K   I ++ +   G   +     V I V + + + P FSQ+     + E     T +  ++  D D   N  + Y I   +    F I+A+ G +     L++     +DL I A           C +T+Y+ ++ND  P          +  N P G+ + ++ A D D  P+  I+Y ++    ++  LF+ +  ++G I  ++  L  +  +H    V    V D    S   + + +E  N +VP          +S +  +G+ +  + A D+D   +G V + +  +S   G +  D  T  +     L  E +E+     + +++    +    R   I  + V +    +  P +       + I E +  G+ +T FV    DSD    +   ++   S N      ++ ++G + +T  L+  + P + L V     GSP    S  L V ++  N  GP L   K      +V E  +    +  L    L +  N   +SYYL+S  P
Sbjct: 1734 LTVEENVGDGSKIMQLTATDADEGPNALVTYTIISGADDS--FRIDPESGDLIATKRLDRERRSKYSLLVRADD-GLQSSDMRINITISDVNDHIPKFSRAVYSFDVAEDTIPGSIVAAIL-----ATDDDSGVNGEITYAVSDDDDDGIFFLNPVTGVFNVTRALDYELQQYYVLTVCAQDGGGQDSCVRVYFNILDVNDNPPVFSRNSYSASVMENLPP-GSTILTFNVTDADDGFNSKLSYTISSGDSMGQ---FQVSKDG----TLSVLQLLDRETQSFYSLVVQVHDMAPPPAPRYTSSVEVSIILLDVNDNPPSFISPKLTYVQENTPTDTVV-----------FRAQATDPDSGPNSYIQYSLLGSLGNKFSIGIIDGEVRLTGELDREDISNY----TLTIIAKDKGEPSLSSSMDMNIIVLDINDNSPH--FSQRHFKVEISESTLTGTDLIQLIASDADEGINGMVRYAI---IDGNPSNEFRIDSVTGVLSIARPLDRERKSSYTLKIQASDRGSSPRSDTATVSILLSDINDVVPKFELSPYTVSVPENLETLPKIILQVVARDDDQ------GLN--------SRLTYSLASGNEDGAFTLS-SSGQLSLIKSLDREVKEWYSLLITATDAGFPALTGTGTISIQVEDINDNKPTFALNH-HFITIPEDAPTGTDILMVNCSDSDAGQNGVIRYSLNGGNSQFTINPSTGQIISSSLLDREAKDH--YTLLVIATDGGSPPLTSTTNVTVNIRDVNDNPPRFLH-HPYVTHIPSPTTAGSFVFAVTVTDEDIGSNAELHFSLKGRNSEKFHIDPLRGAIRTAGAIEGASEITFSVHVRDGGLNSKTDLTTVTVRFANKADFPLIR----ADRKTFTFPENQE---VGTLVSTIFGSSSRGGSLSFYIASGNFGNTFHIDELNGQLYIKNPLDFETMPKYELW---VEARDMGFPPFSSYEKLEITVLDVNDNQPQFKQDPFIAEIIENLSPRKILTISAEDKDSGSNGQVEYTIFDGNKEAFFSINRVNGEIRNTRQLDREKASQYTLSVKASDKG--SPARSSIVKVIIYVLDDNDNAPRFSQI-FSAFVAENAVLGCFVTQVTTSDEDAGANAISRYTIADTSLPFHINLNTGVITVSRPLNREDNDRYIVRVSAH------DSGWTVSTDVTIFVTDVNDNAPRFSKPSYYLDYPETLDIGSKVTQVFATDSDEGLNGHVYYFIKSQS------ELFRINSTTGEIFNKQHLKYQNPSVSGNININRHSFIVSASDRGSPPIMSETTVSINI-VDSNDNAPKFSSTKYFTPVSKNAKIGTKLIKVTAVDDKDFGLNSEVGYSLSTENIHGKFQIDKETGWITVASSLMMDINKNYMIKVFAK-DKGNPPLSSQALVNITVTEENYHTPEFSQSHVSVTVLESLSVGTVIRTISARDRDASMNGIIAYNISSGNEAGLFAINASTGALSLLKNLDYELCQKHDLTISAVDGGWVAKTGYCVVTIYVKDVNDNPPIFKADEYFPSVMENAPSGTTVIRLNATDVDSAPNAVIAYSVQS---SDSDLFV-IDPNTG-IITTQGFLDYETKQHYHLTVKAFNVPDEERCSFVTVTVQLEGANEYVPRFVSKLYYFEVSEAAPKGTVVGEVFASDRDGGIDGDVHYLIFGSSRKKGFQ-IDKKTGKISVSGILDREKEER-----ISLKIIAKNVG-SIRGADIDEVNVNITILDANDPPVFSLKVYNVQISEGVTPGTHVT-FVSA-FDSDSVPSWSRFSYFIGSGNDKGAFAINPQTGQVTVTTELDREMTPLYNLTVLAIDSGSPSATGSAALLVTLDDINDNGPTLSTTKG-----EVKENYRAGTHVMTLQSTDLDLPPNQGPFSYYLLSTGP 3541          

HSP 7 Score: 174.866 bits (442), Expect = 2.154e-42
Identity = 447/1884 (23.73%), Postives = 775/1884 (41.14%), Query Frame = 2
Query: 2234 IVAINFQKLFFARSLYQFILTKSEIKGNLVKIGQVS---MDSSCTESVSYDLFGVKNDHSHFTIDVATG--VIYGK-DLGSISNKTLMFQV--SAKAPKSQTSFAQVIIYIEDGIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSD----EYQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLK---NLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEV----EISVRIIDANNHSPILISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQ-----INIDSWTGLITTKVSLSCAQNVKIRIFVSDLGFPKMTSSVDTLLKPLYEPKSEEFLINKN--------LTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASF---NIRRLKNLEVVYSIKQPEK--YFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPS-SDGIFMINGDS--GEIHLVSSPRVSAYELNVTVRDSGEVPK---SVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAI-TNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCS-PLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRI--NIVK----PPVNSEIFYVLNPGHSHIQIN-TTTGELRTNGPLHLELVEFIELTIHAF-AKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVP--SKCTTVLIDISLNQD-------HQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSI-IDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDD----ARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEP--QEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKAIFYKIDNFHPISNNLY-LDFESGDLYLTKSLNYSIQP---------RFLLIVTCAIVGSPEKITSFNLSVQI-EKENKGPNLIDNKYIT 7636
            I  IN     F++ LYQ  +  SE+  N+ ++ +VS   +D      +SY +    N+  HFT+D +TG   + G+ D  + ++ +L+ Q   S   P S TS   + + +++  + P F  + L V++ EN  VG  +  V        D     Y I  +      SI   TG IFL K+ D E  +   + +  K   N   S+T+ + + + D NDN P         +  +   +G     +  +D D+  NG L+Y +   KP G  N F I+   G +   + ++   +N   +  L V  SD     PLE+       +++ I D N++ P  +S N F    +   G+ + T+   D D G NGEIE  +      + F +++ S +   +RV +    +     L  ++ ATD G+  K++   L I  I   ++ P    PK    +    P+  G+ + ++ A  P +G +S+  Y I +++  E +       I   TG+I T   L   +    R+++ D+   +  +S+    +   E   ++  IN N        L   + ++   G  +  L     + G   L      +  D    +  +S  LI  K     +   YSL V   + +    SS++ IN+ ++ V    P FS+    F ++ E+   GS VA+    +     N E+ Y++   +    F +NPVTG     R  D E +   Q+YV  +       +   V  +   I D NDN P + S +S    +       ++I     TDAD G NSKL+Y I+   S G F ++ D     + L+     S Y L V V D    P    + SV  SI    +              +  + P      ++ +   +   S  N  I+Y L+ G     FS+  I G V+    + RE+I N  +  I         +S  D+  I ++I   N+N P FS+  FKV++ E     T+ + ++A+D D GI G + Y++       +  ID  TG LS + PL+   K+ Y LKI A+D    S+ R D   V I + +       F  + +++ V EN      L +I   +V       +NS + Y L  G+       +++G+L     L  E+ E+  L I A  A F +     T S    +++ DINDN+P  A N   I IP        +  ++ +DSD   N   ++  +   +Q     + ++  +G +   S +    K  + L VI +D G P  +  T V ++I    D       H YV  +P          +  G+F+  + + +     +A+    + G N E   +    G I  A A     E   +I     V  GG   +     +        + P+   ++      E Q   T V   T++         + ++I   +    F ID  NG +    PL+F T   Y+L ++A     P   +  +L + ++++ND +P+        ++  N      +T I+A+D D G +G + Y I      N+  F ++   +GEI  +R+L      ++   +   D    AR S   VI I V D N++ P   +      ++ +   G  +  +   D+D   N    + +  TS  F +    N    +  +  P  +E    Y + +   D+       + +IF   V    P+   P      S  +  PE+L  GSK+T+      DSD+ +   +  F    + L+ ++  +G+++  + L Y   P         R   IV+ +  GSP  ++   +S+ I +  +  P     KY T
Sbjct: 1187 IRDINDNHPKFSKDLYQASI--SELASNMTQVLRVSSSDVDEGNNGLISYSIMK-GNEEKHFTMDSSTGQVALVGRLDYEATASYSLIIQAVDSGAVPLSATSTLSIEV-LDENDNSPSFPKAALFVDVVENMRVGELVSSVTATDSDSGDNADIHYSITGTNNHGTFSISPNTGSIFLAKKLDFETQALYKLNITAKDKGNPPRSSTMSVIIKVRDFNDNPPSFPAGDIFKSVVENVLIGTSILTVTATDPDADINGQLTYTIIQQKPRG--NHFVIDEVRGTIYTNAEIDREFAN---LFELTVRASDLA--VPLESRKYALKNVTILISDLNDNVPTFVSQNAFAADPSLAIGSVLSTITAFDPDEGSNGEIEYEIISGDT-ETFIVDRYSGD---LRVAAPMLPSHLIYSL--IVAATDLGAERKATTTELTI--ILEGQDGPVFSQPKYITILKEGEPV--GTNVISIEAASP-RGTDSVVEYFI-VSVRCEGRTVGRLFTIGRNTGVIQTAAVLDRERGA--RLYLVDVYAIEKEASLPKTQRAQVEITLQD--INDNPPVFPTDILDLTVEENVGDGSKIMQLTATDADEGPNALVTYTIISGADDSFRIDPESGDLIATKRLDRERRSKYSLLV---RADDGLQSSDMRINITISDVNDHIPKFSRAVYSF-DVAEDTIPGSIVAAILATDDDSGVNGEITYAVSDDDDDGIFFLNPVTGVFNVTRALDYELQ---QYYVLTVCAQDGGGQDSCVR-VYFNILDVNDNPP-VFSRNSYSASVMENLPPGSTILTFNVTDADDGFNSKLSYTISSGDSMGQFQVSKDGTLSVLQLLDRETQSFYSLVVQVHDMAPPPAPRYTSSVEVSIILLDVNDNPPSFISPKLTYVQENTPTDT---VVFRAQATDPDSGPNSYIQYSLL-GSLGNKFSIGIIDGEVRLTGELDREDISNYTLTIIAKDKGEPSLSSSMDMNIIVLDI---NDNSPHFSQRHFKVEISESTLTGTDLIQLIASDADEGINGMVRYAIIDGNPSNEFRIDSVTGVLSIARPLDRERKSSYTLKIQASDRG--SSPRSDTATVSILLSDINDVVPKFELSPYTVSVPENL---ETLPKIILQVVARDDDQGLNSRLTYSLASGNEDGAFTLSSSGQLSLIKSLDREVKEWYSLLITATDAGFPALTGTGTIS----IQVEDINDNKPTFALNHHFITIPEDAPTGTDILMVNCSDSDAGQNGVIRYSLNGGNSQ-----FTINPSTGQIISSSLLDREAKDHYTLLVIATDGGSPPLTSTTNVTVNIRDVNDNPPRFLHHPYVTHIPSP--------TTAGSFVFAVTVTDEDIGSNAELHFSLKGRNSEKFHIDPLRGAIRTAGAI----EGASEITFSVHVRDGGLNSKTDLTTVTVRFANKADFPLIRADRKTFTFPENQEVGTLV--STIFG-SSSRGGSLSFYIASGNFGNTFHIDELNGQLYIKNPLDFETMPKYELWVEARDMGFPPFSSYEKLEITVLDVNDNQPQFKQDPFIAEIIENLSPRKILT-ISAEDKDSGSNGQVEYTIFD---GNKEAFFSINRVNGEIRNTRQLDREKASQYTLSVKASDKGSPARSSIVKVI-IYVLDDNDNAPRFSQIFSAF-VAENAVLGCFVTQVTTSDEDAGANAISRYTIADTSLPFHI----NLNTGVITVSRPLNREDNDRYIVRVSAHDSGWTVSTDV-TIFVTDVNDNAPRFSKP------SYYLDYPETLDIGSKVTQVFAT--DSDEGLNGHVYYFIKSQSELFRINSTTGEIFNKQHLKYQ-NPSVSGNININRHSFIVSASDRGSPPIMSETTVSINIVDSNDNAPKFSSTKYFT 2978          

HSP 8 Score: 136.346 bits (342), Expect = 8.473e-31
Identity = 139/494 (28.14%), Postives = 238/494 (48.18%), Query Frame = 2
Query:  119 IFSIKENVPIGEVVGQIES-PGFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREK--QNLYSFLIISMNGD-TKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSI--QSVRIVSGDSEKVF--AIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQILW---TGGLSEINRDISPNTIVAHVKLTDYD--AISTSFDLEILNRSPFQLIKI----LPKMWELKLINDIGNYKSNSINLTLKAVD--YPEPSLSTTQALTIKIHESILFENSFSHSRFQVEIDSTILNENQHVTFVKTTKRLPTKPIFIFKIFVLNNL--FKINETTGEILSKRSID 1537
            +F + E  P G  VG I + PGF+  + + +F    F I+ TTG I  +  IDRE    ++ + +++S        V+I +LD+NDN P F   +   S  E+   G +V L T  D D G N +  +S RIVSG+ +  F   I  + S  G F + L+ +  LD E    + L+++  D G P     L V + VQ+ NDN P F  S+Y A I+ED  +  + L+V ATD D G +  + Y L   +P    F +D ++G V +R+ LD+E  + + +SI  +D   P  T +   ++ +ID+NDN P ++  +   T   + ++ +    T+VA + +TD D  A + +  + IL  +  +  ++    +P +  +K+ + +   +  S NLT+   D  +P P  S+  +L I +++       F     +VEI   +   +       +           + I   N L  F I+E +G + S  ++D
Sbjct:   40 VFQVLEEQPPGTYVGTISTKPGFT--YRLSEFH-VLFSINSTTGSIYTTSNIDRESLISDVINLVVLSSQPTYPTEVRITVLDINDNSPVFPEPSIVVSFKEDTQGGRQVILDTATDSDAGTNGVDHRSYRIVSGNQDGRFKLGITVNPSGEGAF-LHLMSQGPLDRETNPCYYLLVEVEDKGTPKRLGHLQVNVTVQDINDNPPVFSSSQYQAKIEEDSPVGSSVLKVEATDRDEGPNAAIRYQLAEGTP----FQIDPESGLVTIREPLDYESRRQYTLSIQAKDLGTPPLTGRSEALVRLIDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNVTVAILGGNEQRHFEVQTSKVPNLSLIKVASSLDRERIPSYNLTVSVSDQGHPRPR-SSVASLVIYVNDINDHPPVFQEPHSKVEISEDLPPGSYICGVSASDGDTGLNANLRYSIVSGNKLGWFSISENSGLVTSTSALD 524          

HSP 9 Score: 120.553 bits (301), Expect = 5.661e-26
Identity = 351/1567 (22.40%), Postives = 651/1567 (41.54%), Query Frame = 2
Query: 2264 FARSLYQFILTKSEIKGNLVK-IGQVSMDSSCTESVSYDLFGVKNDHSHFTIDVATGVI-YGKDLGSISNKTLMFQVSAKAPKSQTSFAQVIIYIED-GIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSDEYQIIQSQYSDWLSIHSKTGQIFLNKQ--------FDREQVSYLVVTVQLKNLIG------SATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVG-MNNPFEINPTTGCLLIISSLNIWN-SNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNV-FYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNR-------NPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLS--CAQNVKIRIFVSDLGFPKMTSS--VDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRL---KNLEVVYSIK-QPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVAT--DADSGPNSKLTYQINPSSDGIFMINGDSGEIHL---VSSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQL------------SYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLT-VVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCS-PLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPP--VNSEIFYVLNPGHSHIQINTTTGELRTNGPLHLE---LVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQ--KPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSA------KFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIR-GYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDG 6757
            F+R++Y F + +  I G++V  I     DS     ++Y +    +D   F ++  TGV    + L     +  +  V A+    Q S  +V   I D   + P F  +    ++ EN   G  I+       +V+D      S+ S  +S     GQ  ++K          DRE  S+  + VQ+ ++        ++++++ + +LD+NDN P   + K  +  E+  +   +    + +D DS PN  + Y +     +G + N F I    G + +   L+  + SN      L +I  D G    L + +++++ ++D N++SP     +    I ++ + GT++  L+  D D G NG +  ++   +    F I+ ++    + R    E  +SY     + + A+DRGS  +S    + I   + N        +P  + +P+  + +    P +    I  V A D D+GLNS   YS  LA  NED     S +G ++   SL     +   + I  +D GFP +T +  +   ++ + + K   F +N +    IP+ +  G  +  +N    + G   + I  +    +    +   + Q+I           HY+L V+        ++S   + V +  V  + P F    P    I     +GS V +  +       N E+ +S+K +  + F I+P+ G + T      E  ++I F V V    +++    T +   V+ A++ D  P I +      R +    EN  +  +V+T   + S   S   Y  + +    F I+  +G++++   +    +  YEL V  RD G  P S      I    +                   PQ K    I ++            S     S  N  + Y +  G     FS++ + G ++    + RE+        + V        +   + ++ I +   N+N PRFS+ IF   + E+  +  F+T V  +D D G      Y++   +      I+ +TG ++ S PLN  + + Y +++ A DS     G    T V IFV +   +   F+   + L   E    G+ + ++        +N  ++Y +       +IN+TTGE+     L  +   +   I +  H+F    S R      +   V I  ++ N   P  +  K F P S   +    L K++A D DK   +  +   S  +T+ ++  + +D ++G + + SS++  +   + +KV   D G P   +  L++I++ +++ +    PE +   V    ++   +G +      +D  A       ++I  G    L  ++ STG +  +    +D E   K  L      GG   + GY  V I+V DV+DN P+F  +++   + E  P  T VIRL   D D   N+ + Y ++  S  + F+ID N G + T   L++ TK  Y L +KA +       +   +TV +   N+  P+        ++    P G+ + ++ A D DG
Sbjct: 1828 FSRAVYSFDVAEDTIPGSIVAAILATDDDSGVNGEITYAVSD-DDDDGIFFLNPVTGVFNVTRALDYELQQYYVLTVCAQDGGGQDSCVRVYFNILDVNDNPPVFSRNSYSASVMENLPPGSTILTF-----NVTDADDGFNSKLSYTISSGDSMGQFQVSKDGTLSVLQLLDRETQSFYSLVVQVHDMAPPPAPRYTSSVEVSIILLDVNDNPPSFISPKLTYVQENTPT-DTVVFRAQATDPDSGPNSYIQYSL-----LGSLGNKFSIGIIDGEVRLTGELDREDISN----YTLTIIAKDKGE-PSLSSSMDMNIIVLDINDNSPHFSQRHFKVEISESTLTGTDLIQLIASDADEGINGMVRYAIIDGNPSNEFRIDSVTGVLSIARPLDRERKSSY----TLKIQASDRGSSPRSDTATVSILLSDINDVVPKFELSPYTVSVPENLETL----PKI----ILQVVARDDDQGLNSRLTYS--LASGNEDGAFTLSSSGQLSLIKSLDREVKEWYSLLITATDAGFPALTGTGTISIQVEDINDNKPT-FALNHHF-ITIPEDAPTGTDILMVNCSDSDAGQNGV-IRYSLNGGNSQFTINPSTGQIISSSLLDREAKDHYTLLVIATDGGSPPLTSTTNVTVNIRDVNDNPPRFLH-HPYVTHIPSPTTAGSFVFAVTVTDEDIGSNAELHFSLKGRNSEKFHIDPLRGAIRTAGAI--EGASEITFSVHVRDGGLNSKTDLTTV--TVRFANKAD-FPLIRAD-----RKTFTFPENQEVGTLVSTIFGSSSRGGSLSFYIASGNFGNTFHIDELNGQLYIKNPLDFETMPKYELWVEARDMGFPPFSSYEKLEITVLDVNDNQ---------------PQFKQDPFIAEIIENLSPRKILTISAEDKDSGSNGQVEYTIFDGNKEAFFSINRVNGEIRNTRQLDREKASQ---YTLSVKASDKGSPARSSIVKVIIYVLDDNDNAPRFSQ-IFSAFVAENAVLGCFVTQVTTSDEDAGANAISRYTIADTSL--PFHINLNTGVITVSRPLNREDNDRYIVRVSAHDS-----GWTVSTDVTIFVTDVNDNAPRFSKPSYYLDYPETLDIGSKVTQVFATDSDEGLNGHVYYFIKSQSELFRINSTTGEIFNKQHLKYQNPSVSGNININRHSFIVSASDRGSPPIMSETTVSINIVDSNDNAPKFSSTKYFTPVSKNAKIGTKLIKVTAVD-DKDFGLNSEVGYS-LSTENIHGKFQIDKETGWITVASSLMMDINKNYMIKVFAKDKGNPPLSSQALVNITVTEENYHT---PEFSQSHVSVTVLESLSVGTVIRTISARDRDASMNGIIAYNISSGNEAGLFAINASTGAL--SLLKNLDYELCQKHDLTISAVDGGWVAKTGYCVVTIYVKDVNDNPPIFKADEYFPSVMENAPSGTTVIRLNATDVDSAPNAVIAYSVQ-SSDSDLFVIDPNTGIITTQGFLDYETKQHYHLTVKAFNVPDEERCSFVTVTVQLEGANEYVPRFVSKLYYFEVSEAAPKGTVVGEVFASDRDG 3315          

HSP 10 Score: 118.242 bits (295), Expect = 2.432e-25
Identity = 259/1212 (21.37%), Postives = 485/1212 (40.02%), Query Frame = 2
Query: 5078 NENPPRFSRSIFKVKLPEDEAI-TNFLTVVANDPDLGIFGRIIYSL-EGDTFDKKIFIDPSTGKLSC-SPLNFMEKNIYNLKIIATD-SEGLSTGRKDFTKVIIFVQNTKQ--HTLAFNATHFSLKVLENSPGGTVLGRINIV---KPPVNSEIFYVLNPGHS--HIQINTTT----GELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISL----NQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNY-CKDHSAKFSIIDGVN----HELVFLHESTGKIFVAAAAKIDREKIDKIILWT-QVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDS--DKAIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESRIWNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIG---NLRKCVEIKRLTGVINENEPPKTTVL---KLPEWYHDIQYFLTPHENFELTCSQSQSSGCNIKSKSVLDFETHENYRL-----QLLIKGSYFYLRSCSHTIMVE----------------ISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIV-ENPSENFGINNETGAIYIKNQFIIE----------KKDKQRVKRSET 8518
            N+NPP FS S ++ K+ ED  + ++ L V A D D G    I Y L EG  F     IDP +G ++   PL++  +  Y L I A D      TGR +    +I V +         F AT     V EN+  GTV+  + +     P  N  +   +  G+   H ++ T+       ++    L  E +    LT+    +       +++ A + + + DIND+ P+  E   K+ I     P   +  +SA+D D   N   ++      +      + +   SG +   S++   +  +  L +   D G   K +   + ++L    +Q   +  I     +  + ENS+ GT +  +K  +    D+       D  N      L  L   +GK+  +  A +DRE+ D+  L       G   +    KVI+ + DV+DN PVF   ++ A + E +PP + V  +T  DPD+G N  + Y I    + +  +    G + T   L+   K+ Y L + A+            +T+ +++  D  P  S  + +  +  N  VG  +  + A   D    I+Y +      +Q     +   +G I  +  +   +   ++  +V      +  A++ I V+D N++ P        +N+  + K G  I    A+D D   NG+V++ L   +P   L   D  T A+ L          Y + I  +D  + PQ  L S F LT+ + +  +  P +    S E+T+ ES    S+  K    D DS  +  I Y I   H      +  F  G LY+   L+  ++  ++L V+ +        T+ N+++ +E  N    L ++       +  E     + +  +  +DK+S      + +    QP+       F++++      + G++  +  ++   +             + + G     ++V    +G    L+    ++     IN+N P  +  L    + E   ++   L       ++ S        + S S++     +++ +     Q+ + G   Y  + S++++++                I VLD ++  P F   +   +V   + ++G+++ +  A+D D G    + Y I   N    F I+  TG+I++  +   E           KDK    RS T
Sbjct:  236 NDNPPVFSSSQYQAKIEEDSPVGSSVLKVEATDRDEGPNAAIRYQLAEGTPFQ----IDPESGLVTIREPLDYESRRQYTLSIQAKDLGTPPLTGRSEALVRLIDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNVTVAILGGNEQRHFEVQTSKVPNLSLIKVASSLDRERIPSYNLTVSVSDQ--GHPRPRSSVASLVIYVNDINDHPPVFQEPHSKVEISEDLPPGSYICGVSASDGDTGLNANLRYSI---VSGNKLGWFSISENSGLVTSTSALDREIAPQLLLNISARDQGPQPKTSYATLLVNLLDVNDQKPTFTGINVNGHLVSLPENSLVGTELLMLKATDGDLGDNGTIRFYFDADNPSQCQGLFRLDPLSGKL--SNRADLDREQQDRCTLQILATDLGTPPLSSTAKVIVSLLDVNDNSPVFYPVQYFANIQENEPPASFVATVTASDPDLGINGTIRYSIRAGDTSKFQVHPETGAISTKAALDREEKTAYQLQVVATDGGGLQSHNHAIVTITVLDTQDNPPSFSQGSYSFVMFENVAVGYNVGTVVATTIDLNTNITYLV---TTGDQKGVFTIDRSTGLIMTASVVDREEQDFYQLKVVASGGAVTGEAIVNITVKDLNDNSPHFVNAVENVNVVENWKTGHIIFQAKAVDPDEGVNGRVSYSL-KQNPQ-SLFYVDEVTGAVSLTGPLDVDTGSYQVEIIASDMGV-PQ--LASSFILTISV-HDVNDNPPVFDQLSYEVTLLESEPVNSRFFKVYATDKDSGLNGEITYSI--IHGNVGEAFGIFPDGQLYVKSELDREVKDLYILQVSASDRAVEPLSTTVNVTIILEDVNDNRPLFNSTNYVFYFE--EENSGGSFVGRIYAVDKDSGSNGEIMYAFETMQPD-------FELNT------VTGEITSTHQFDREAL-------------MRQRGAAAFTLKVTSTDLGLPKPLKDQATVQIYIRDINDNHPKFSKDLYQASISELASNMTQVL------RVSSSDVDEGNNGLISYSIMKGNEEKHFTMDSSTGQVALVGRLDYEATASYSLIIQAVDSGAVPLSATSTLSIEVLDENDNSPSFPKAALFVDVVENM-RVGELVSSVTATDSDSGDNADIHYSITGTNNHGTFSISPNTGSIFLAKKLDFETQALYKLNITAKDKGNPPRSST 1390          

HSP 11 Score: 115.161 bits (287), Expect = 2.539e-24
Identity = 93/310 (30.00%), Postives = 150/310 (48.39%), Query Frame = 2
Query:  104 NSNLLIFSIKENVPIGEVVGQI---ESPGFSPPFEMHDFQ--EKKFIISKTTGVIKVSGLIDRE---KQNLYSFLIISMNG----------DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTS 979
            NS   +F  +E    G  VG+I   +    S    M+ F+  +  F ++  TG I  +   DRE   +Q   +   + +            D   VQI I D+NDN PKF+   ++ SI E     ++V   +  D DEG N + S  I+ G+ EK F +   DSS G    ++ L   LDYE  + ++L+IQA+D G  PL A+  + I V + NDN P F  +     + E+  +      V ATD+D+G + ++ Y +  T+ +   F++   TG+++L K LDFE    + ++I  +D   P  +S
Sbjct: 1088 NSTNYVFYFEEENSGGSFVGRIYAVDKDSGSNGEIMYAFETMQPDFELNTVTGEITSTHQFDREALMRQRGAAAFTLKVTSTDLGLPKPLKDQATVQIYIRDINDNHPKFSKDLYQASISELASNMTQVLRVSSSDVDEGNNGLISYSIMKGNEEKHFTM---DSSTG----QVALVGRLDYEATASYSLIIQAVDSGAVPLSATSTLSIEVLDENDNSPSFPKAALFVDVVENMRVGELVSSVTATDSDSGDNADIHYSITGTN-NHGTFSISPNTGSIFLAKKLDFETQALYKLNITAKDKGNPPRSS 1389          

HSP 12 Score: 102.834 bits (255), Expect = 1.273e-20
Identity = 119/490 (24.29%), Postives = 213/490 (43.47%), Query Frame = 2
Query:  107 SNLLIFSIKENVPIGEVVGQI------ESPGFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNG---DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDAISTSFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENS--FSHSRFQVEIDSTILNENQHVTFVKTTKRLPTKPIFIFKIFVLN--NLFKINETTGEILSKRSID 1537
            +++L  +++ENV  G  + Q+      E P     + +    +  F I   +G +  +  +DRE+++ YS L+ + +G       + I I DVND+ PKF+   +   + E+   GS V      D D G N   +  +   D + +F   + +   G+F V     ++LDYE+   + L + A DGG     + + V   + + NDN P F  + Y AS+ E+     T L    TD D G + +L Y + +      F     K G + + + LD E    + + + V D +PP        +   I + D   +     +  L+ +  +   +T+V   + TD D+   S+    L  S      I     E++L  ++     ++  LT+ A D  EPSLS++  + I + +  + +NS  FS   F+VEI  + L     +  + +        +  + I   N  N F+I+  TG +   R +D
Sbjct: 1729 TDILDLTVEENVGDGSKIMQLTATDADEGPNALVTYTIISGADDSFRIDPESGDLIATKRLDRERRSKYSLLVRADDGLQSSDMRINITISDVNDHIPKFSRAVYSFDVAEDTIPGSIVAAILATDDDSGVNGEITYAVSDDDDDGIF---FLNPVTGVFNV----TRALDYELQQYYVLTVCAQDGGG--QDSCVRVYFNILDVNDNPPVFSRNSYSASVMENLPPGSTILTFNVTDADDGFNSKLSYTISSGDSMGQFQV--SKDGTLSVLQLLDRETQSFYSLVVQVHDMAPPPAPRYTSSVEVSIILLDVNDNPPSFISPKLTYVQENTPTDTVVFRAQATDPDSGPNSYIQYSLLGSLGNKFSIGIIDGEVRLTGELDREDISNYTLTIIAKDKGEPSLSSSMDMNIIVLD--INDNSPHFSQRHFKVEISESTLTGTDLIQLIASDADEGINGMVRYAIIDGNPSNEFRIDSVTGVLSIARPLD 2205          

HSP 13 Score: 97.4413 bits (241), Expect = 6.002e-19
Identity = 89/308 (28.90%), Postives = 140/308 (45.45%), Query Frame = 2
Query:  107 SNLLIFSIKENVPIGEVVGQI----ESPGFSPPFEMHDF---QEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNG--------DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKN-SIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVS-GELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTS 979
            S L  F + E  P G VVG++       G         F   ++K F I K TG I VSG++DREK+   S  II+ N         D  NV I ILD ND  P F+   +   I E    G+ V   + FD D   + S  S  I SG+ +  FAI+           ++ +   LD E+   +NL + AID G P    S  + + + + NDN P    ++    +KE+       + +++TD D   + G   Y+L +T P++ +F++    G +   + +D E+     +S+  RD+  P  +S
Sbjct: 3288 SKLYYFEVSEAAPKGTVVGEVFASDRDGGIDGDVHYLIFGSSRKKGFQIDKKTGKISVSGILDREKEERISLKIIAKNVGSIRGADIDEVNVNITILDAND-PPVFSLKVYNVQISEGVTPGTHVTFVSAFDSDSVPSWSRFSYFIGSGNDKGAFAINPQTG-------QVTVTTELDREMTPLYNLTVLAIDSGSPSATGSAALLVTLDDINDNGPTLSTTK--GEVKENYRAGTHVMTLQSTDLDLPPNQGPFSYYLLSTGPATSYFSL-SPGGILTTTREIDREQINEFFLSVVTRDSGFPQMSS 3584          

HSP 14 Score: 95.9005 bits (237), Expect = 1.411e-18
Identity = 73/251 (29.08%), Postives = 124/251 (49.40%), Query Frame = 2
Query:  221 KFIISKTTGVIKVSG--LIDREKQNLYSFLIISMNGDTKN--------VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISI 943
            KF I K TG I V+   ++D  K    +++I     D  N        V I + + N + P+F+ ++   ++ E+  +G+ +   +  D D   N I +  I SG+   +FAI+   +S G     L L ++LDYE+  + +L I A+DGG        +V I V++ NDN P F    Y  S+ E+     T +R+ ATD D+  +  + Y +   S  SD F +D  TG +  +  LD+E  + +H+++
Sbjct: 3019 KFQIDKETGWITVASSLMMDINK----NYMIKVFAKDKGNPPLSSQALVNITVTEENYHTPEFSQSHVSVTVLESLSVGTVIRTISARDRDASMNGIIAYNISSGNEAGLFAIN---ASTGA----LSLLKNLDYELCQKHDLTISAVDGGWVAKTGYCVVTIYVKDVNDNPPIFKADEYFPSVMENAPSGTTVIRLNATDVDSAPNAVIAYSVQ--SSDSDLFVIDPNTGIITTQGFLDYETKQHYHLTV 3256          

HSP 15 Score: 95.1301 bits (235), Expect = 2.875e-18
Identity = 229/946 (24.21%), Postives = 399/946 (42.18%), Query Frame = 2
Query: 2318 LVKIGQVSMDSSCTESVSYDLFGVKNDHSHFTIDVATGVIYGK---DLGSISNKTLMFQVSAKAPKSQTSFAQVIIYI-EDGIHQPGFD--FSDLLVNIWENTTVGIEIMQVFPKYPSVSDE---------YQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINL-----LVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNVFY-IHQTAVYGTE-VGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQI-NIDSWTGLIT--TKVSLSCAQNVKIRIFVSDLGFPKMTSSVDTLL--------KPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKN-VHYSLNV-VFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFL------EIKENLPSGSHVAS-FNIRRLKNLE--VVYSI--KQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPN-SKLTYQINPSSD-GIFMINGDSGEIHLVSS---PRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDI-------RYYLIA-GKFAQIFSVDPITGSVQTQHSVSREEI 4978
            ++ I     DS     V Y +F   N  + F+I+   G I      D    S  TL  + S K   +++S  +VIIY+ +D  + P F   FS     + EN  +G  + QV     + SDE         Y I  +       I+  TG I +++  +RE     +V V   +   + + D+ + + D+NDN P          + +   +G     +  +D+D   NG++ Y +K       +  F IN TTG +     L   N + SG IN+     +V  SD G   P+ +E  +S+ I+D+N+++P   ST  F  + + A  GT+ +    + D+D G N E+  SL   + +  F I+K +    V     ++   +Y     + + A D+G+P  SS   + I   E N + PE    + H  +     L  G+ I T++A D D  +N I  Y+I     NE  +  I++ TG ++    +     Q   + I   D G+   T      +         P++  K++E+  +      + +++  G  V  LN    +     + I+ +  S D  L +   +  +I  +  L+ +   HY L V  FN  +    S   ++ V V   G +  +     P+F+      E+ E  P G+ V   F   R   ++  V Y I     +K F I+  TG++    + DRE E +I   +++IA +V + +   +  + V I   + N+P + S     V+IS   T    +  + A D+DS P+ S+ +Y I   +D G F IN  +G++ + +         Y L V   DSG    + S    +    I             +++ +  + K  +  G  ++  T  S +LD+        YYL++ G     FS+ P  G + T   + RE+I
Sbjct: 2675 ILTISAEDKDSGSNGQVEYTIFD-GNKEAFFSINRVNGEIRNTRQLDREKASQYTLSVKASDKGSPARSSIVKVIIYVLDDNDNAPRFSQIFSAF---VAENAVLGCFVTQV-----TTSDEDAGANAISRYTIADTSLP--FHINLNTGVITVSRPLNREDNDRYIVRVSAHDSGWTVSTDVTIFVTDVNDNAPRFSKPSYYLDYPETLDIGSKVTQVFATDSDEGLNGHVYYFIK-----SQSELFRINSTTGEIFNKQHLKYQNPSVSGNININRHSFIVSASDRGS-PPIMSETTVSINIVDSNDNAPKFSSTKYFTPVSKNAKIGTKLIKVTAVDDKDFGLNSEVGYSLSTENIHGKFQIDKETGWITVASSLMMDINKNYM----IKVFAKDKGNPPLSSQALVNITVTEENYHTPE--FSQSHVSVTVLESLSVGTVIRTISARDRDASMNGIIAYNISSG--NEAGLFAINASTGALSLLKNLDYELCQKHDLTISAVDGGWVAKTGYCVVTIYVKDVNDNPPIF--KADEYFPS------VMENAPSGTTVIRLNATDVDSAPNAV-IAYSVQSSDSDLFVIDPNTGIITTQGFLDYETKQHYHLTVKAFNVPDEERCS---FVTVTVQLEGANEYV-----PRFVSKLYYFEVSEAAPKGTVVGEVFASDRDGGIDGDVHYLIFGSSRKKGFQIDKKTGKISVSGILDREKEERIS--LKIIAKNVGSIRGADIDEVNVNITILDANDPPVFSLKVYNVQISEGVTPGTHVTFVSAFDSDSVPSWSRFSYFIGSGNDKGAFAINPQTGQVTVTTELDREMTPLYNLTVLAIDSGSPSATGSAALLVTLDDINDNGP--------TLSTTKGEVKENYRAG--THVMTLQSTDLDLPPNQGPFSYYLLSTGPATSYFSLSP-GGILTTTREIDREQI 3565          

HSP 16 Score: 93.2041 bits (230), Expect = 9.685e-18
Identity = 77/260 (29.62%), Postives = 130/260 (50.00%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLIISMNGD---TKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEI--------ISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDN-DAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            F I+  TGVI VS  ++RE  + Y   + + +     + +V I + DVNDN P+F+  ++    PE   IGSKV      D DEG N      I S    ++F I+   S+ G     +  KQ L Y+         I++ + ++ A D G PP+ +   V I + ++NDN PKF  ++Y   + ++ +I    ++V A D+ D G++ E+ Y L +T      F +D +TG + +  SL  + +K++ I +  +D   P
Sbjct: 2806 FHINLNTGVITVSRPLNREDNDRYIVRVSAHDSGWTVSTDVTIFVTDVNDNAPRFSKPSYYLDYPETLDIGSKVTQVFATDSDEGLNGHVYYFIKS--QSELFRIN---STTG----EIFNKQHLKYQNPSVSGNININRHSFIVSASDRGSPPIMSETTVSINIVDSNDNAPKFSSTKYFTPVSKNAKIGTKLIKVTAVDDKDFGLNSEVGYSL-STENIHGKFQIDKETGWITVASSLMMDINKNYMIKVFAKDKGNP 3055          

HSP 17 Score: 92.0485 bits (227), Expect = 2.413e-17
Identity = 71/256 (27.73%), Postives = 121/256 (47.27%), Query Frame = 2
Query:  212 QEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGD------TKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNS 961
            ++  F +S ++G + +   +DRE +  YS LI + +        T  + I++ D+NDN+P F   +   +IPE+ P G+ + +    D D G+N +    +  G+S+  F I+    S G    ++I    LD E    + L++ A DGG PPL ++  V + +++ NDN P+F    Y+  I            V  TD D G + EL + L     +S+ F +D   G +  R +   E +     S+ VRD  
Sbjct: 2291 EDGAFTLS-SSGQLSLIKSLDREVKEWYSLLITATDAGFPALTGTGTISIQVEDINDNKPTFALNHHFITIPEDAPTGTDILMVNCSDSDAGQNGVIRYSLNGGNSQ--FTIN---PSTG----QIISSSLLDREAKDHYTLLVIATDGGSPPLTSTTNVTVNIRDVNDNPPRFLHHPYVTHIPSPTTAGSFVFAVTVTDEDIGSNAELHFSLKGR--NSEKFHIDPLRGAI--RTAGAIEGASEITFSVHVRDGG 2532          

HSP 18 Score: 83.1889 bits (204), Expect = 9.631e-15
Identity = 70/272 (25.74%), Postives = 123/272 (45.22%), Query Frame = 2
Query:  116 LIFSIKENVPIGEVVGQIESPGFSPPFEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNG-----DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFE 916
            +IF  K   P   V G++        + +    +  F + + TG + ++G +D +  +    +I S  G      +  + I + DVNDN P F+  ++E ++ E+ P+ S+       D D G N   +  I+ G+  + F I + D        +L +K  LD E+   + L + A D    PL  ++ V II+++ NDN P F+ + Y+   +E+        R+ A D D+G +GE+ Y  +   P  +  TV   TG +      D E
Sbjct:  898 IIFQAKAVDPDEGVNGRVS-------YSLKQNPQSLFYVDEVTGAVSLTGPLDVDTGSYQVEIIASDMGVPQLASSFILTISVHDVNDNPPVFDQLSYEVTLLESEPVNSRFFKVYATDKDSGLNGEITYSIIHGNVGEAFGI-FPDG-------QLYVKSELDREVKDLYILQVSASDRAVEPLSTTVNVTIILEDVNDNRPLFNSTNYVFYFEEENSGGSFVGRIYAVDKDSGSNGEIMYAFETMQPDFELNTV---TGEITSTHQFDRE 1151          

HSP 19 Score: 82.4185 bits (202), Expect = 1.805e-14
Identity = 94/385 (24.42%), Postives = 167/385 (43.38%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKN------VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLS---------EINRDISPNTIVAHVKLTDYDAIS--TSFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHE 1327
            F I+ +TG + +   +D E    +   I +++G          V I + DVNDN P F A  +  S+ EN P G+ V      D D   N++ +  + S DS+ +F ID    + GI    +  +  LDYE    ++L ++A +       + + V + ++ AN+ VP+F    Y   + E          V A+D D G+ G++ Y +  +S     F +D KTG + +   LD EK +   + I           +K    I   DI++   +I IL               +I+  ++P T V  V   D D++   + F   I + +      I P+  ++ +  ++    +   NLT+ A+D   PS + + AL + + +
Sbjct: 3125 FAINASTGALSLLKNLDYELCQKHDLTISAVDGGWVAKTGYCVVTIYVKDVNDNPPIFKADEYFPSVMENAPSGTTVIRLNATDVDSAPNAVIAYSVQSSDSD-LFVID---PNTGI----ITTQGFLDYETKQHYHLTVKAFNVPDEERCSFVTVTVQLEGANEYVPRFVSKLYYFEVSEAAPKGTVVGEVFASDRDGGIDGDVHYLIFGSS-RKKGFQIDKKTGKISVSGILDREKEERISLKI----------IAKNVGSIRGADIDEVNVNITILDANDPPVFSLKVYNVQISEGVTPGTHVTFVSAFDSDSVPSWSRFSYFIGSGNDKGAFAINPQTGQVTVTTELDREMTPLYNLTVLAIDSGSPSATGSAALLVTLDD 3490          

HSP 20 Score: 77.7962 bits (190), Expect = 4.577e-13
Identity = 70/265 (26.42%), Postives = 122/265 (46.04%), Query Frame = 2
Query:  194 FEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLII--SMNGDTKNVQIKILDVNDNE-PKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTS 979
            F +     +KF I    G I+ +G I+   +  +S  +    +N  T    + +   N  + P   A     + PEN  +G+ V  +T+F     +    S  I SG+    F ID     NG  Y+    K  LD+E + ++ L ++A D G PP  +   ++I V + NDN P+F    +IA I E+       L + A D D+G +G++ Y + + +  + FF+++   G +   + LD EK+  + +S+   D   P  +S
Sbjct: 2491 FSLKGRNSEKFHIDPLRGAIRTAGAIEGASEITFSVHVRDGGLNSKTDLTTVTVRFANKADFPLIRADRKTFTFPENQEVGTLV--STIFG-SSSRGGSLSFYIASGNFGNTFHID---ELNGQLYI----KNPLDFETMPKYELWVEARDMGFPPFSSYEKLEITVLDVNDNQPQFKQDPFIAEIIENLSPR-KILTISAEDKDSGSNGQVEYTIFDGNKEA-FFSINRVNGEIRNTRQLDREKASQYTLSVKASDKGSPARSS 2743          

HSP 21 Score: 74.3294 bits (181), Expect = 5.840e-12
Identity = 208/926 (22.46%), Postives = 364/926 (39.31%), Query Frame = 2
Query: 6056 KAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREK-----IDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEE------FLIDANGD-----VKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDD------ARFSSTAVIEIDVEDKNNHVPILK-----ENGRVINLSSSLKRGSKILYLHAIDKDL-RDNGKVTFELVSTSPWFGLRGFDNNTAA---LFLIDEP----QEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDS--DKAIFYKIDNFHPISNN----LYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQ-IEKENKGPNL----IDNKYITL---SLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIY--DPPSFQIDSSN----------ILWWINGDLFESRIWNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHD------IQYFLTPHENFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFT----QNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIVENPSEN-FGINNETGAIYIKNQFIIEKKDKQRVKRSETNEEALKSYRKSFQFRISASSGVKTSYAYVELTM 8617
            + +F+V E    GT++G I          ++F       H L  ++ +TG I+  +   IDRE      I+ ++L +Q +   +E+R      I V D++DN PVF +   V    E       VI  T  D D G N          S  ++        ++ +G+     + +  PL+  T   Y L+++   K +P      ++ V + +IND  P  S      K++ + PVGS + K+ A D D  +G +  IR+ +L   T F  +  +SG + +   L      ++   I   D         S   V  IDV D +   P++K        R  ++  + + G+ +  L   D D    NG VT  ++  +     R F+  T+    L LI       +E+   Y L + ++D    P+ R  S+ +L + +     + P     HS ++ I E L  GS I      D D+  +  + Y I     +S N      +   SG +  T +L+  I P+ LL ++    G   K +   L V  ++  ++ P      ++   ++L   SL   E++   A   +L   D  + R  +Y  +  P Q + ++  DP S ++ +             L  +  DL    + +   +IV      ++    Y   Y F NI+                       ENEPP + V  +     D      I+Y +   +  +    Q       I +K+ LD E    Y+LQ++       L+S +H I V I+VLD  +  P F   S++    +NV  G   +G ++ T    + +      ++Y +     +  F I+  TG I   +    E++D                    +Q ++ AS G  T  A V +T+
Sbjct:   38 RQVFQVLEEQPPGTYVGTISTKPGFTYRLSEF-------HVLFSINSTTGSIYTTS--NIDRESLISDVINLVVLSSQPTYP-TEVR------ITVLDINDNSPVFPEPSIVVSFKEDTQGGRQVILDTATDSDAGTNGVDHRSYRIVSGNQDGRFKLGITVNPSGEGAFLHLMSQGPLDRETNPCYYLLVEVEDKGTPKRLGHLQVNVTVQDINDNPPVFSSSQYQAKIEEDSPVGSSVLKVEATDRD--EGPNAAIRY-QLAEGTPF-QIDPESGLVTIREPLDYESRRQYTLSIQAKDLGTPPLTGRSEALVRLIDVNDND---PVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNVTVAILGGNEQ---RHFEVQTSKVPNLSLIKVASSLDRERIPSYNLTVSVSDQG-HPRPR-SSVASLVIYVNDINDHPPVFQEPHS-KVEISEDLPPGSYICGVSASDGDTGLNANLRYSI-----VSGNKLGWFSISENSGLVTSTSALDREIAPQLLLNISARDQGPQPKTSYATLLVNLLDVNDQKPTFTGINVNGHLVSLPENSLVGTELLMLKATDGDL--GDNGTIR--FYFDADNPSQCQGLFRLDPLSGKLSNRADLDREQQDRCTLQILATDLGTPPLSSTAKVIVSLLDVNDNSPVFYPVQY-FANIQ-----------------------ENEPPASFVATVTASDPDLGINGTIRYSIRAGDTSKF---QVHPETGAISTKAALDREEKTAYQLQVVATDG-GGLQSHNHAI-VTITVLDTQDNPPSFSQGSYSFVMFENVAVGY-NVGTVVATTIDLNTN------ITYLVTTGDQKGVFTIDRSTGLIMTASVVDREEQD-------------------FYQLKVVASGGAVTGEAIVNITV 870          

HSP 22 Score: 69.707 bits (169), Expect = 1.408e-10
Identity = 59/211 (27.96%), Postives = 99/211 (46.92%), Query Frame = 2
Query:  329 KNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNS 961
            + ++I +LDVNDN+P+F    F   I EN     K+   +  D D G N      I  G+ E  F+I+     NG     +   + LD E  SQ+ L ++A D G P   + + V I V + NDN P+F    + A + E+  +     +V  +D DAG +    Y + +TS     F ++  TG + + + L+ E +  + + +   D+ 
Sbjct: 2641 EKLEITVLDVNDNQPQFKQDPFIAEIIENLSP-RKILTISAEDKDSGSNGQVEYTIFDGNKEAFFSIN---RVNG----EIRNTRQLDREKASQYTLSVKASDKGSPARSSIVKVIIYVLDDNDNAPRFS-QIFSAFVAENAVLGCFVTQVTTSDEDAGANAISRYTIADTSLP---FHINLNTGVITVSRPLNREDNDRYIVRVSAHDSG 2839          
BLAST of Dachsous vs. Ensembl Xenopus
Match: CDH23 (cadherin related 23 [Source:HGNC Symbol;Acc:HGNC:13733])

HSP 1 Score: 208.764 bits (530), Expect = 8.510e-53
Identity = 345/1343 (25.69%), Postives = 599/1343 (44.60%), Query Frame = 2
Query: 3014 FEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPIL--ISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTF--VIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNED-QINIDSWTGLITTKVSLSCAQN---VKIRIFVSDLGFPKMTSSVD---TLL----------KPLYEPKSEEFLINKN-----LTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLF---SISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLK---NLEVVYSIKQPEKY--FVINPVTGQLVTFRMFDRETENQIQFY-VEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSS-DGIFMINGDSGEIHL---VSSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIR-FXXXXXXXXXXXPQSKSGFIIGQLS---YSQTSSSGNLDIRYYLIAGKFAQIFSVDPITG--SVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAIT-NFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTG--KLSCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPVNSEI-FYVLN-----------PGHSHI-QINTTTGELRTNGPLHLELVEFIELTIHAF--AKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIF---IPNSNQPQKPLTKLSATDSDKTSN--ITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTV-----LIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSA--KFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKK-----VIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPK-ISIPNRN-LKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKL 6796
            F+I+  TG + +   ++       G    L++V+D+G   P +    +S+ ++D N++SP     S +V  + +    G  V  +  +D D G NG +  SL   +    F I + + NT   V  +KS++        L V   A+D GSP + S   L +N  + N NPP    P  +   ++   +  G+ +  VNA D DKGLNS+ +Y I     NED    +D  TG I T+ +    +     K+ + V D G P ++++     T+L           P+YE   +E  ++ N      T +  D    G V    +I   N   +   I+N T    G + +  +    + L          Y+L V    +       ++S   + V VN +  +WP F K      EI E  P G  VA+F         N +V YSI   +    FVI+ V G L   + ++ + EN I FY + ++A    NP   +   + +++ D NDN+P +L+   +I  IS  T  +  I +I+A+DAD+G N+ LT+ I   + +  F IN ++G +++   +   ++S Y+L +TV+D+ E  ++    F +   +I  ++  R   +    +      S  G  I  L+    +  +  G+  +  Y + G    +F+++  TG  +V+    + RE   N  I+ + +V + +    +    R+ + +   N+N P FS S   V L E+     + + V A D D GI  ++ Y +E    D+   ID  TG  +++   ++  EK+ Y L ++ATD   +         V I + +       F     ++ VLE++  GTV+  +  +   +N  + +Y++            P    + +IN  TG +     L+ ELV   ++TI  +  A  +  RS+   +A + V I+D+NDN P      V  F   I     P   L  +SA D DK  N  ITY      P       + L D  +G +    ++           V  SDNG P +   V     ++DI+ N +  + Q   +K +F   E+   G  + QIK  +      A  ++S++DG       ++ +TG I++ +   +DREK D   L         +I   ++     V+I V DV+D +P FS+++F   + E +P  T VI ++  D D G N  V Y +E   S E FLID +  + T+  L   +   ++L + A+ K  P ++    L V ++++ND RP  +  PN   L +    P+ S + ++ A D+D  +G++  +R+  L
Sbjct:  208 FKIDEITGAITVKGLVD----REKGDFYTLIVVADDG--GPKKDSAVVSITVLDENDNSPQFDPTSDSVVNVPEDCPTGRRVALVQARDPDDGNNGLVTFSLTAGNPSGIFEI-RTTNNTLGEVFLIKSIDREVQELYTLKVQ--ASDSGSPPRRSEYTLTVNVNDVNDNPPVFDKPFGYNVSVYEN-VGGGTSVIRVNATDKDKGLNSVLSYYITQG--NEDLTFRMDRLTGEIATRPAPPDREKQSFYKLVVTVEDEGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQDEGPNGTVT--YSISAGNV-QETFSINNAT----GLIRVVKELDYEVCLG--------RYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKPYEGPFEITEGQP-GPRVATFKADDKDSGLNGQVEYSIVGGDLLGDFVISSVEGDLRVRKDYELDREN-IAFYNITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLNLPQNI-SISENTPVSTPITRILASDADTGRNALLTFNITAGNLENAFSINENTGIVYVNRQLDREKISEYKLTITVKDNPENARNSRRDFDVLIVTISDENDNRPLFTQGSYLAELTENSPEGTPITVLNGPVLALDNDIGSNAVVSYRLLGAQINLFTINNSTGVVTVRAGKVIDRESFLNP-ILDLTLVAEDI--GKLNSTARLVLTVLDANDNRPIFSPSSVTVHLRENSPPGFSVVKVTATDADSGINQQLSYRIESGAQDR-FLIDAFTGVIRVANVTVDREEKDTYKLIVVATDQGAVPLSGS--ITVSILIDDVNDCPPEFVNPIQTVSVLESAEVGTVVAEVTAIDRDLNPRLEYYIIEILATDDTNSLIPNQQGVFEINFKTGSVMVKSNLNRELVATYDITISVYDNASEVVDRSVSAPNAKLTVNILDVNDNTPRFRPFGVTAFTERIVEGATPGTTLISVSAVDPDKGPNGQITYSLHNLVPAGY----LQLEDNMAGKIIANRTVDYEQVQWLNFTVRASDNGSPRRSAEVPVYLQIVDINDN-NPIFSQSSYQKPVF---EDIQLGATVLQIKATDADSGRFALIQYSLVDGEGK--FGINPTTGDIYILST--LDREKKDHYTLTAIARDNPGDIASNRRENSVQVLITVLDVNDCRPQFSKSQFSTSVYENEPEGTSVITMSATDLDEGDNGVVTYNLEGPGS-EAFLIDKDSGLITSRRL-LQSFERFNLTVVATDKGRPPLWGTTMLKVDVIDVNDNRPVFVRPPNGTILHIKEEIPLKSTVYEVYATDND--EGLNGAVRYNLL 1498          

HSP 2 Score: 169.088 bits (427), Expect = 1.001e-40
Identity = 250/1053 (23.74%), Postives = 462/1053 (43.87%), Query Frame = 2
Query: 4181 IKENLPSGSHVASFNIRRLKNL-EVVYSIKQPE-----KYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRI--SAPTTENASIFQIVATDADSGPNSKLTYQI---NPSSDGIFMI---NGDSGEIHLVSSPRVSA---YELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITN--FLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSC-SPLNF-MEKNIYNLKIIATDSEGLSTGRKDFTK-VIIFVQNTKQHTLAFNATHFS-LKVLENSPGGTVLG-RINIVKPPVNSEIFYVLNPGH--SHIQINTTTGELRTNGPLHL--ELVEFIELTIHAFAK----FISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCT-----TVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFI----GQIKMVNYCKDHSAKFSI-IDGVNHELVFLHESTGKIFVAAAAKIDREK-IDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDA-NGDVK-TNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRI--------RHRKLTNQTLFLNVAFDSGEIF----LSRKLLVS-DVGKHEFD---IVVDDARFSSTAVIEIDVEDKNNHVPILKENG------RVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDN 7138
            I EN+ +G+ V     R + NL ++ Y   Q         F I+ +TG +    + DRE  +   FY  ++      PK  + + + + + DENDN P     S S+V +    PT    ++ Q  A D D G N  +T+ +   NPS  GIF I   N   GE+ L+ S        Y L V   DSG  P+      +++   +     + F                G  + +++ +      N  + YY+  G     F +D +TG + T+ +    E       ++ V ++   + ++     +++ I   N+N P F   +++V   E     N   LT  A D D G  G + YS+      +   I+ +TG +     L++ +    Y L + ATD   +   R   T  V++ V +   +   F   +    ++ E  PG  V   + +     +N ++ Y +  G       I++  G+LR      L  E + F  +TI A  +    F ST       A++++R++DINDN PI    P  I I  +     P+T++ A+D+D   N    F+    T   L   + ++  +G +++   +       + L + V DN   ++ +      +++ IS   D++ +       +  + ENS +GT I    G +  ++     +A  S  + G    L  ++ STG + V A   IDRE  ++ I+  T V+    ++    ++++ V D +DN+P+FS +     L E  PP   V+++T  D D G N Q+ Y IE   +Q+ FLIDA  G ++  N+ ++   K  Y L++ A+ + +  +     +++ I ++ND  P+   P + + +  +  VG+ + ++TA D D    + Y I         +  + NQ     + F +G +     L+R+L+ + D+    +D    VVD +  +  A + +++ D N++ P  +  G      R++  ++    G+ ++ + A+D D   NG++T+ L +  P   L+  DN
Sbjct:  168 IIENIATGTEVVRVQARSIDNLNQLSYKFDQTTYAQALALFKIDEITGAITVKGLVDREKGD---FYTLIVVADDGGPKKDSAV-VSITVLDENDNSPQFDPTSDSVVNVPEDCPTGRRVALVQ--ARDPDDGNNGLVTFSLTAGNPS--GIFEIRTTNNTLGEVFLIKSIDREVQELYTLKVQASDSGSPPRRSEYTLTVNVNDVNDNPPV-FDKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYITQGNEDLTFRMDRLTGEIATRPAPPDRE--KQSFYKLVVTVEDEGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQDEGPNGTVTYSISAGNVQETFSINNATGLIRVVKELDYEVCLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKPYEGPFEITEGQPGPRVATFKADDKDSGLNGQVEYSIVGGDLLGDFVISSVEGDLRVRKDYELDRENIAFYNITIMAKDRGNPPFSST-------AVVEIRVLDINDNDPILLNLPQNISISENTPVSTPITRILASDADTGRNALLTFN---ITAGNLENAFSINENTGIVYVNRQLDREKISEYKLTITVKDNPENARNSRRDFDVLIVTISDENDNRPL-FTQGSYLAELTENSPEGTPITVLNGPVLALDNDIGSNAVVSYRLLGAQINLFTINNSTGVVTVRAGKVIDRESFLNPILDLTLVAEDIGKLNSTARLVLTVLDANDNRPIFSPSSVTVHLRENSPPGFSVVKVTATDADSGINQQLSYRIE-SGAQDRFLIDAFTGVIRVANVTVDREEKDTYKLIVVATDQGAVPLSGSITVSILIDDVNDCPPEFVNPIQTVSVLESAEVGTVVAEVTAIDRDLNPRLEYYIIEILATDDTNSLIPNQQGVFEINFKTGSVMVKSNLNRELVATYDITISVYDNASEVVDRSVSAPNAKLTVNILDVNDNTPRFRPFGVTAFTERIVEGATP---GTTLISVSAVDPDKGPNGQITYSLHNLVPAGYLQLEDN 1194          

HSP 3 Score: 128.642 bits (322), Expect = 1.720e-28
Identity = 83/256 (32.42%), Postives = 137/256 (53.52%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLIISMNG----DTKNVQIKILDVNDNEPKFNATNFEK-SIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDIS-RYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDF-FTVDHKTGNVYLRKS-LDFEKSKSHHISIGVRDNSPP 967
            F I + TG I V GL+DREK + Y+ ++++ +G    D+  V I +LD NDN P+F+ T+    ++PE+ P G +V L    DPD+G N + +  + +G+   +F I   +++ G     + L +S+D E+   + L +QA D G PP ++   + + V + NDN P FD    Y  S+ E+     + +RV ATD D G++  L Y++  T  + D  F +D  TG +  R +  D EK   + + + V D   P
Sbjct:  208 FKIDEITGAITVKGLVDREKGDFYTLIVVADDGGPKKDSAVVSITVLDENDNSPQFDPTSDSVVNVPEDCPTGRRVALVQARDPDDGNNGLVTFSLTAGNPSGIFEIRTTNNTLG----EVFLIKSIDREVQELYTLKVQASDSGSPPRRSEYTLTVNVNDVNDNPPVFDKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYI--TQGNEDLTFRMDRLTGEIATRPAPPDREKQSFYKLVVTVEDEGNP 457          

HSP 4 Score: 125.176 bits (313), Expect = 1.704e-27
Identity = 290/1320 (21.97%), Postives = 544/1320 (41.21%), Query Frame = 2
Query: 3392 ETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVM-PKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSI------FNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQ-NVKIRIFVSDLGFPKMTSSVDTLL-------KPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIF-PENYGAKCLFISNTTTSVDGFLHLRFDSQQL---ILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIR-RLKNLEVV--YSIKQPEK--YFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSS-DGIFMINGDSGEIHLVSSPR----VSAYELNVTVRDSGE-VPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGS--VQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLT-VVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCSPLNFMEK-NIYNLKIIATDS-EGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPVNSEI-------FYVLNPGHSHIQINTTTG--ELRTNGPLHLE--LVEFIELTIHA--FAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSN--ITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHF-LKVIVSDNG-VP---SKCTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGV----------NHELVF-LHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGY------KKVIIHXXXXXXNKPVFSQNKFVAFLN---EGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDAN--GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKL--------LVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFEL 7096
            ET  +Y+  +NV   ATD+  P       + +  +     P E+V       + +    + +G+E+  V A   D  LN +        Y+  LA+       ID  TG IT K  +   + +    I V+D G PK  S+V ++         P ++P S+  ++N      +P+    G  V  +    P++     +  S T  +  G   +R  +  L    L+K         Y+L V  +        S   + V VN V  + P+F K     + + EN+  G+ V   N   + K L  V  Y I Q  +   F ++ +TG++ T R    + E Q  + + V      NP +     + V I DENDN P   SP   + R   P + N+ I    A D D GPN  +TY I+  +    F IN  +G I +V        +  Y L VT  D    V + ++   ++                       + + + G  +         S  N  + Y ++ G     F +  + G   V+  + + RE I       I ++ +   +        + I +   N+N P        + + E+  ++  +T ++A+D D G    + +++     +    I+ +TG +  +     EK + Y L I   D+ E     R+DF  +I+ + +   +   F    +  ++ ENSP GT +  +N     ++++I       + +L    +   IN +TG   +R    +  E  L   ++LT+ A    K  ST  +  T       ++D NDN+PI + + V + +  ++ P   + K++ATD+D   N  ++Y+ +            +L+D  +G + + +  +   +   + L V+ +D G VP   S   ++LID   +   ++V  +   ++    E++  GT + ++  ++   +   ++ II+ +          N + VF ++  TG + V +   ++RE +    +   V    SE+          K+ +++ DV+DN P F      AF     EG  P T +I ++  DPD G N Q+ Y +          ++ N  G +  N  +++      +  ++AS   SP   AE  + + IV+IND  P  S  +    +  +  +G+ + +I A D+D   G    I++  +  +  F  +   +G+I++   L         ++ + +     +  + R +S  V+ I V D N+  P   ++    ++  +   G+ ++ + A D D  DNG VT+ L
Sbjct:  120 ETKTTYY--MNVS--ATDQAVPFNRGFCTIYVTLMNE---PDEVVQFTSPTYKAVIIENIATGTEVVRVQARSIDN-LNQLSYKFDQTTYAQALAL-----FKIDEITGAITVKGLVDREKGDFYTLIVVADDGGPKKDSAVVSITVLDENDNSPQFDPTSDS-VVN------VPEDCPTGRRVALVQARDPDDGNNGLVTFSLTAGNPSGIFEIRTTNNTLGEVFLIKSIDREVQELYTLKVQASDSGSPPRRSEYTLTVNVNDVNDNPPVFDKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYITQGNEDLTFRMDRLTGEIAT-RPAPPDREKQSFYKLVVTVEDEGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQDEGPNGTVTYSISAGNVQETFSINNATGLIRVVKELDYEVCLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKPYEGPFEITEGQPGPRVATFKADDKDSGLNGQVEYSIVGGDLLGDFVISSVEGDLRVRKDYELDRENIA---FYNITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLNLPQNISISENTPVSTPITRILASDADTGRNALLTFNITAGNLENAFSINENTGIVYVNRQLDREKISEYKLTITVKDNPENARNSRRDFDVLIVTISDENDNRPLFTQGSYLAELTENSPEGTPITVLNGPVLALDNDIGSNAVVSYRLLGAQINLFTINNSTGVVTVRAGKVIDRESFLNPILDLTLVAEDIGKLNSTARLVLT-------VLDANDNRPIFSPSSVTVHLRENSPPGFSVVKVTATDADSGINQQLSYRIESG------AQDRFLIDAFTGVIRVANVTVDREEKDTYKLIVVATDQGAVPLSGSITVSILIDDVNDCPPEFVNPIQTVSVL---ESAEVGTVVAEVTAIDRDLNPRLEYYIIEILATDDTNSLIPNQQGVFEINFKTGSVMVKS--NLNRELVATYDITISVYDNASEVVDRSVSAPNAKLTVNILDVNDNTPRFRPFGVTAFTERIVEGATPGTTLISVSAVDPDKGPNGQITYSLHNLVPAGYLQLEDNMAGKIIANRTVDYEQVQWLNFTVRASDNGSPRRSAEVPVYLQIVDINDNNPIFSQSSYQKPVFEDIQLGATVLQIKATDADS--GRFALIQYSLVDGEGKF-GINPTTGDIYILSTLDREKKDHYTLTAIARDNPGDIASNRRENSVQVL-ITVLDVNDCRPQFSKSQFSTSVYENEPEGTSVITMSATDLDEGDNGVVTYNL 1393          

HSP 5 Score: 114.775 bits (286), Expect = 2.565e-24
Identity = 87/266 (32.71%), Postives = 133/266 (50.00%), Query Frame = 2
Query:  215 EKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMN--GDTKN--------VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKF--DISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSS---DFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            E KF I+ TTG I +   +DREK++ Y+   I+ +  GD  +        V I +LDVND  P+F+ + F  S+ EN P G+ V   +  D DEG N + +  +  G   + F I   D  +G+   R +L+         +FNL + A D G PPL  + ++K+ V + NDN P F    +  I  IKE+  +  T   V ATDND G++G + Y L  T   +   ++FT+D  +G +     LD EK   +++ I   D   P
Sbjct: 1290 EGKFGINPTTGDIYILSTLDREKKDHYTLTAIARDNPGDIASNRRENSVQVLITVLDVNDCRPQFSKSQFSTSVYENEPEGTSVITMSATDLDEGDNGVVTYNL-EGPGSEAFLI---DKDSGLITSRRLLQS------FERFNLTVVATDKGRPPLWGTTMLKVDVIDVNDNRPVFVRPPNGTILHIKEEIPLKSTVYEVYATDNDEGLNGAVRYNLLKTGAGTKDWEYFTIDSTSGLIQTALRLDREKQAMYNLIIVAYDLGQP 1545          

HSP 6 Score: 88.1965 bits (217), Expect = 2.995e-16
Identity = 75/265 (28.30%), Postives = 123/265 (46.42%), Query Frame = 2
Query:  212 QEKKFIISKTTGVIKVSGLIDREKQNLYSFLII-----------SMNGDTKNVQIKILDVNDNEPKF---NATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFA--IDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDN 958
            Q+  F I+  TG + V   ++RE    Y   I            S++     + + ILDVNDN P+F     T F + I E    G+ +   +  DPD+G N     +I       V A  +   D+  G    ++I  +++DYE +   N  ++A D G P   A + V + + + NDN P F  S Y   + ED ++  T L+++ATD D+G    + Y L +       F ++  TG++Y+  +LD EK   + ++   RDN
Sbjct: 1072 QQGVFEINFKTGSVMVKSNLNRELVATYDITISVYDNASEVVDRSVSAPNAKLTVNILDVNDNTPRFRPFGVTAFTERIVEGATPGTTLISVSAVDPDKGPNG----QITYSLHNLVPAGYLQLEDNMAG----KIIANRTVDYEQVQWLNFTVRASDNGSPRRSAEVPVYLQIVDINDNNPIFSQSSYQKPVFEDIQLGATVLQIKATDADSGRFALIQYSLVD---GEGKFGINPTTGDIYILSTLDREKKDHYTLTAIARDN 1325          

HSP 7 Score: 83.5741 bits (205), Expect = 7.981e-15
Identity = 79/265 (29.81%), Postives = 126/265 (47.55%), Query Frame = 2
Query:  224 FIISKTTGVIKVSG--LIDREK-------QNLYSFLIISMNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFL------DNTSP----SSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNS 961
            F I+ +TGV+ V    +IDRE          L +  I  +N  T  + + +LD NDN P F+ ++    + EN P G  V   T  D D G N   S RI SG  ++ F I   D+  G+  V  +   ++D E    + L++ A D G  PL  S+ V I++ + ND  P+F       S+ E  E+      V A D D  ++  L Y++      D+T+         F ++ KTG+V ++ +L+ E   ++ I+I V DN+
Sbjct:  855 FTINNSTGVVTVRAGKVIDRESFLNPILDLTLVAEDIGKLNS-TARLVLTVLDANDNRPIFSPSSVTVHLRENSPPGFSVVKVTATDADSGINQQLSYRIESGAQDR-FLI---DAFTGVIRVANV---TVDREEKDTYKLIVVATDQGAVPLSGSITVSILIDDVNDCPPEFVNPIQTVSVLESAEVGTVVAEVTAIDRD--LNPRLEYYIIEILATDDTNSLIPNQQGVFEINFKTGSVMVKSNLNRELVATYDITISVYDNA 1109          

HSP 8 Score: 80.8777 bits (198), Expect = 4.976e-14
Identity = 183/866 (21.13%), Postives = 347/866 (40.07%), Query Frame = 2
Query: 2588 VNIWENTTVGIEIMQVFPKYPSVSDE----YQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGE----------MECPLKCSDADSFPNGNLSYRMKIIKPVGMN-NPFEINPTTGCLLIISSLNIWNS---NPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNV-FYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTF-------VIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIE--LAIDNED----------QINIDSWTGLITTKVSLSCAQNVKIRIFVSD---------LGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSV-DGFLHLRFDSQQLILLKDNLNVKNVHY---SLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDS---PKFLEIKENLPSGSHVASFNIRRLKNLE---VVYSIKQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATH----VSNPKIFTVLPLIVKIADENDNEP-YILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEIHLVSSPRV----SAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLI---AG-KFAQIFSVDPITGSVQTQHSVSREE 4975
            ++I ENT V   I ++              + I      +  SI+  TG +++N+Q DRE++S   +T+ +K+   +A        + I        N         L+ L E          +  P+   D D   N  +SYR+     +G   N F IN +TG + + +   I      NP  I++L ++  D G    L +   + + ++DAN++ PI   ++V  ++ + +  G  V              + +  + Q   Y+   IE  +++ F       VIRV ++       +   ++++ATD+G+   S  I + I   + N  PPE V P Q   ++    +  G+ +  V A+D D  LN    Y I   LA D+ +          +IN  + + ++ + ++        I I V D         +  P    +V+ L      P+   F +    T  I + + PG  +  ++    + G       +    V  G+L L  +    I+    ++ + V +   ++    N     S    +Y+ ++   +  + P+FS+ S   P F    E++  G+ V         +     + YS+   E  F INP TG +      DRE ++   + +  IA      +++ +    + +++ + D ND  P +  S  S+ V  + P  E  S+  + ATD D G N  +TY +       F+I+ DSG   L++S R+      + L V   D G  P   + +  +    +     +     + ++     +      + ++  +      N  +RY L+   AG K  + F++D  +G +QT   + RE+
Sbjct:  703 ISISENTPVSTPITRILASDADTGRNALLTFNITAGNLENAFSINENTGIVYVNRQLDREKISEYKLTITVKDNPENARNSRRDFDVLIVTISDENDNRPLFTQGSYLAELTENSPEGTPITVLNGPVLALDNDIGSNAVVSYRL-----LGAQINLFTINNSTGVVTVRAGKVIDRESFLNP--ILDLTLVAEDIGK---LNSTARLVLTVLDANDNRPIFSPSSVTVHLRENSPPGFSV--------VKVTATDADSGINQQLSYR---IESGAQDRFLIDAFTGVIRVANVTVDREEKDTYKLIVVATDQGAVPLSGSITVSILIDDVNDCPPEFVNPIQTVSVLESAEV--GTVVAEVTAIDRD--LNPRLEYYIIEILATDDTNSLIPNQQGVFEINFKTGSVMVKSNLNRELVATYDITISVYDNASEVVDRSVSAPNAKLTVNILDVNDNTPRFRPFGVTA-FTERIVEGATPGTTLISVSAVDPDKGPNGQITYSLHNLVPAGYLQLEDNMAGKIIANRTVDYEQVQWLNFTVRASDNGSPRRSAEVPVYLQIV--DINDNNPIFSQSSYQKPVF----EDIQLGATVLQIKATDADSGRFALIQYSLVDGEGKFGINPTTGDIYILSTLDREKKDH--YTLTAIARDNPGDIASNRRENSVQVLITVLDVNDCRPQFSKSQFSTSVYENEP--EGTSVITMSATDLDEGDNGVVTYNLEGPGSEAFLIDKDSG---LITSRRLLQSFERFNLTVVATDKGRPPLWGTTMLKVDVIDVNDNRPVFVRPPNGTILHIKEEIPLKSTVYEVYATDNDEGLNGAVRYNLLKTGAGTKDWEYFTIDSTSGLIQTALRLDREK 1529          

HSP 9 Score: 79.7221 bits (195), Expect = 1.007e-13
Identity = 79/261 (30.27%), Postives = 123/261 (47.13%), Query Frame = 2
Query:  215 EKKFIISKTTGVIKVSGLIDREK-QNLYSFLIISMN---------GDTKNVQIKILDVNDNEPKFNATNFEK--SIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVP-KFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDN 958
            ++ F I+  TG+I+V   +D E     Y+ ++ + +           T  V + + D+NDN P F    +E    I E  P G +V      D D G N      IV GD    F I    S  G   VR      LD E I+ +N+ I A D G+PP  ++ +V+I V + NDN P   ++ + I SI E+  ++    R+ A+D D G +  L  F        + F+++  TG VY+ + LD EK   + ++I V+DN
Sbjct:  525 QETFSINNATGLIRVVKELDYEVCLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTF-PKPYEGPFEITEGQP-GPRVATFKADDKDSGLNGQVEYSIVGGDLLGDFVIS---SVEGDLRVRK--DYELDRENIAFYNITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLNLPQNI-SISENTPVSTPITRILASDADTGRNA-LLTFNITAGNLENAFSINENTGIVYVNRQLDREKISEYKLTITVKDN 776          

HSP 10 Score: 78.5666 bits (192), Expect = 2.645e-13
Identity = 69/242 (28.51%), Postives = 115/242 (47.52%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKN--------VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASL---LVKIIVQNANDNVPKFDISRYIASIKED--QEINITFLR--VRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKS 904
            F+IS   G ++V    + +++N+  + I  M  D  N        V+I++LD+NDN+P         SI EN P+ + +      D D G+N++ +  I +G+ E  F+I+    + GI YV     + LD E IS++ L I   D       +     ++ + + + NDN P F    Y+A + E+  +   IT L   V A DND G +  + Y L       + FT+++ TG V +R  
Sbjct:  637 FVISSVEGDLRVRKDYELDRENIAFYNITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLNLPQNISISENTPVSTPITRILASDADTGRNALLTFNITAGNLENAFSIN---ENTGIVYV----NRQLDREKISEYKLTITVKDNPENARNSRRDFDVLIVTISDENDNRPLFTQGSYLAELTENSPEGTPITVLNGPVLALDNDIGSNAVVSYRL--LGAQINLFTINNSTGVVTVRAG 869          

HSP 11 Score: 77.7962 bits (190), Expect = 4.268e-13
Identity = 131/466 (28.11%), Postives = 209/466 (44.85%), Query Frame = 2
Query: 2594 IWENTTVGIEIMQVFPKYPSVSDEYQIIQSQY----SDWLSIHSK-TGQIFLNKQFDREQVSYLVVTVQLKNLIG---SATXXXXXXXXXXXXXKP-YCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDN-GPFKP--LETEVEISVRIIDANNHSPIL----ISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSI---ELAIDNEDQINIDSWTGLITTKVSLSCAQNV--KIRIFVSDLGFPKMTSSVDTLLKPLYE-PKSEEFLIN------KNLTFIIPDHSQPGYVVGDL 3907
            I E  T G  ++ V    P      QI  S +    + +L +     G+I  N+  D EQV +L  TV+  +      SA + ++L I+DINDN P + ++S     FED+  LG     +K +DADS     + Y +     V     F INPTTG + I+S+L+    +      L  I  DN G       E  V++ + ++D N+  P       ST+V+   +    GT V T+   D D G+NG +  +L+ P   + F I+K S    +   + L++    FE  N+ ++ATD+G P       L ++ I+ N N P  V P     +     +   S ++ V A D D+GLN    Y++        + +   IDS +GLI T + L   +     + I   DLG P    ++  L   L +   +E   I       +  T  + +HS+PG VVG++
Sbjct: 1150 IVEGATPGTTLISVSAVDPDKGPNGQITYSLHNLVPAGYLQLEDNMAGKIIANRTVDYEQVQWLNFTVRASDNGSPRRSAEVPVYLQIVDINDNNPIFSQSSYQKPVFEDIQ-LGATVLQIKATDADSGRFALIQYSL-----VDGEGKFGINPTTGDIYILSTLDREKKDH---YTLTAIARDNPGDIASNRRENSVQVLITVLDVNDCRPQFSKSQFSTSVY---ENEPEGTSVITMSATDLDEGDNGVVTYNLEGPGS-EAFLIDKDSG--LITSRRLLQS----FERFNLTVVATDKGRPPLWGTTMLKVDVIDVNDNRPVFVRPPNGTILHIKEEIPLKSTVYEVYATDNDEGLNGAVRYNLLKTGAGTKDWEYFTIDSTSGLIQTALRLDREKQAMYNLIIVAYDLGQPVPYETMLPLQVALDDIDDNEPAFIRPPRGALQYQTLSVREHSKPGTVVGNV 1596          

HSP 12 Score: 77.0258 bits (188), Expect = 6.716e-13
Identity = 78/332 (23.49%), Postives = 150/332 (45.18%), Query Frame = 2
Query:  104 NSNLLIFS-------IKENVPIG----EVVGQIESPGFSP--PFEMHDFQEKKFIISKTTGVIKVSGL-IDREKQNLYSFLIISMN------GDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPD-EGKNSIQSVRIVSGDS--------EKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVI-------QAIDGGHPPLQASLLVKIIVQNANDNVPKF---DISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSK 982
            N N  IFS       ++EN P G    +V       G +    + +    + +F+I   TGVI+V+ + +DRE+++ Y  ++++ +        +  V I I DVND  P+F       S+ E+  +G+ V   T  D D   +     + I++ D         + VF I++   S       +++K +L+ E+++ +++ I       + +D       A L V I+  + NDN P+F    ++ +   I E      T + V A D D G +G++ Y L N  P+      D+  G +   +++D+E+ +  + ++   DN  P  +++
Sbjct:  908 NDNRPIFSPSSVTVHLRENSPPGFSVVKVTATDADSGINQQLSYRIESGAQDRFLIDAFTGVIRVANVTVDREEKDTYKLIVVATDQGAVPLSGSITVSILIDDVNDCPPEFVNPIQTVSVLESAEVGTVVAEVTAIDRDLNPRLEYYIIEILATDDTNSLIPNQQGVFEINFKTGS-------VMVKSNLNRELVATYDITISVYDNASEVVDRSVSAPNAKLTVNIL--DVNDNTPRFRPFGVTAFTERIVEGATPGTTLISVSAVDPDKGPNGQITYSLHNLVPAGYLQLEDNMAGKIIANRTVDYEQVQWLNFTVRASDNGSPRRSAE 1230          

HSP 13 Score: 72.4034 bits (176), Expect = 1.929e-11
Identity = 64/224 (28.57%), Postives = 102/224 (45.54%), Query Frame = 2
Query:  269 IDREKQNLYSFLIISMNGDTK------NVQIKILDVNDNEPKFNAT-NFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQ-EINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFE 916
            IDRE Q LY+  + + +  +        + + + DVNDN P F+    +  S+ EN   G+ V      D D+G NS+ S  I  G+ +  F +D      G    R       D E  S + LV+   D G+P L A+  V + + + NDN P F    Y  +  E    +N   L   A D D G +G + Y + +     + F++++ TG + + K LD+E
Sbjct:  330 IDREVQELYTLKVQASDSGSPPRRSEYTLTVNVNDVNDNPPVFDKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYITQGNEDLTFRMDRL---TGEIATR---PAPPDREKQSFYKLVVTVEDEGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQDEGPNGTVTYSI-SAGNVQETFSINNATGLIRVVKELDYE 546          

HSP 14 Score: 66.2402 bits (160), Expect = 1.517e-9
Identity = 57/228 (25.00%), Postives = 110/228 (48.25%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTK-------NVQIKILDVNDNEPKF-----NATNFEK-SIPENYPIGSKV-DLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQA-----------IDGGHPPLQASLL--VKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFY 826
            F I  T+G+I+ +  +DREKQ +Y+ +I++ +            +Q+ + D++DNEP F      A  ++  S+ E+   G+ V +++   D DEG N+I    I +G+ +  F +        I   +L + ++LD E    ++++++A           +     P   S L  V++ +++ ND  P+F    Y A +  D ++    ++V A D D G +  +FY
Sbjct: 1510 FTIDSTSGLIQTALRLDREKQAMYNLIIVAYDLGQPVPYETMLPLQVALDDIDDNEPAFIRPPRGALQYQTLSVREHSKPGTVVGNVSGAVDVDEGSNAIVYYFIATGNQDNNFLL--------IPEGKLTVLKNLDREKEPYYSIIVKASSNRSWTPGNSLGKKFDPATDSTLQEVRVYLEDINDQPPRFTKPEYTAGVATDAKVGSELIKVLAVDADVGNNSLVFY 1729          

HSP 15 Score: 62.3882 bits (150), Expect = 1.866e-8
Identity = 43/138 (31.16%), Postives = 72/138 (52.17%), Query Frame = 2
Query:  569 LILK--QSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIA-SIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFH 973
            LI++  Q LD E  S   LV++A +    P+++S+ V I V++ ND VP F   +Y    ++E   I  +   VRATD D G  G + Y +   S +   F +D  TG +     LD+E   ++++++   D + PF+
Sbjct:    4 LIMRGVQPLDRETNSSHVLVVEAYNSDQGPMRSSVRVIIYVEDVNDEVPVFTQQQYSRLGLRETVGIGTSVTVVRATDRDTGDGGLVTYKI--ISGADGKFDIDASTGLLTTIDYLDYETKTTYYMNVSATDQAVPFN 139          
BLAST of Dachsous vs. Ensembl Xenopus
Match: CDH23 (cadherin related 23 [Source:HGNC Symbol;Acc:HGNC:13733])

HSP 1 Score: 208.764 bits (530), Expect = 9.173e-53
Identity = 345/1343 (25.69%), Postives = 599/1343 (44.60%), Query Frame = 2
Query: 3014 FEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPIL--ISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTF--VIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNED-QINIDSWTGLITTKVSLSCAQN---VKIRIFVSDLGFPKMTSSVD---TLL----------KPLYEPKSEEFLINKN-----LTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLF---SISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLK---NLEVVYSIKQPEKY--FVINPVTGQLVTFRMFDRETENQIQFY-VEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSS-DGIFMINGDSGEIHL---VSSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIR-FXXXXXXXXXXXPQSKSGFIIGQLS---YSQTSSSGNLDIRYYLIAGKFAQIFSVDPITG--SVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAIT-NFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTG--KLSCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPVNSEI-FYVLN-----------PGHSHI-QINTTTGELRTNGPLHLELVEFIELTIHAF--AKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIF---IPNSNQPQKPLTKLSATDSDKTSN--ITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTV-----LIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSA--KFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKK-----VIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPK-ISIPNRN-LKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKL 6796
            F+I+  TG + +   ++       G    L++V+D+G   P +    +S+ ++D N++SP     S +V  + +    G  V  +  +D D G NG +  SL   +    F I + + NT   V  +KS++        L V   A+D GSP + S   L +N  + N NPP    P  +   ++   +  G+ +  VNA D DKGLNS+ +Y I     NED    +D  TG I T+ +    +     K+ + V D G P ++++     T+L           P+YE   +E  ++ N      T +  D    G V    +I   N   +   I+N T    G + +  +    + L          Y+L V    +       ++S   + V VN +  +WP F K      EI E  P G  VA+F         N +V YSI   +    FVI+ V G L   + ++ + EN I FY + ++A    NP   +   + +++ D NDN+P +L+   +I  IS  T  +  I +I+A+DAD+G N+ LT+ I   + +  F IN ++G +++   +   ++S Y+L +TV+D+ E  ++    F +   +I  ++  R   +    +      S  G  I  L+    +  +  G+  +  Y + G    +F+++  TG  +V+    + RE   N  I+ + +V + +    +    R+ + +   N+N P FS S   V L E+     + + V A D D GI  ++ Y +E    D+   ID  TG  +++   ++  EK+ Y L ++ATD   +         V I + +       F     ++ VLE++  GTV+  +  +   +N  + +Y++            P    + +IN  TG +     L+ ELV   ++TI  +  A  +  RS+   +A + V I+D+NDN P      V  F   I     P   L  +SA D DK  N  ITY      P       + L D  +G +    ++           V  SDNG P +   V     ++DI+ N +  + Q   +K +F   E+   G  + QIK  +      A  ++S++DG       ++ +TG I++ +   +DREK D   L         +I   ++     V+I V DV+D +P FS+++F   + E +P  T VI ++  D D G N  V Y +E   S E FLID +  + T+  L   +   ++L + A+ K  P ++    L V ++++ND RP  +  PN   L +    P+ S + ++ A D+D  +G++  +R+  L
Sbjct:  222 FKIDEITGAITVKGLVD----REKGDFYTLIVVADDG--GPKKDSAVVSITVLDENDNSPQFDPTSDSVVNVPEDCPTGRRVALVQARDPDDGNNGLVTFSLTAGNPSGIFEI-RTTNNTLGEVFLIKSIDREVQELYTLKVQ--ASDSGSPPRRSEYTLTVNVNDVNDNPPVFDKPFGYNVSVYEN-VGGGTSVIRVNATDKDKGLNSVLSYYITQG--NEDLTFRMDRLTGEIATRPAPPDREKQSFYKLVVTVEDEGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQDEGPNGTVT--YSISAGNV-QETFSINNAT----GLIRVVKELDYEVCLG--------RYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKPYEGPFEITEGQP-GPRVATFKADDKDSGLNGQVEYSIVGGDLLGDFVISSVEGDLRVRKDYELDREN-IAFYNITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLNLPQNI-SISENTPVSTPITRILASDADTGRNALLTFNITAGNLENAFSINENTGIVYVNRQLDREKISEYKLTITVKDNPENARNSRRDFDVLIVTISDENDNRPLFTQGSYLAELTENSPEGTPITVLNGPVLALDNDIGSNAVVSYRLLGAQINLFTINNSTGVVTVRAGKVIDRESFLNP-ILDLTLVAEDI--GKLNSTARLVLTVLDANDNRPIFSPSSVTVHLRENSPPGFSVVKVTATDADSGINQQLSYRIESGAQDR-FLIDAFTGVIRVANVTVDREEKDTYKLIVVATDQGAVPLSGS--ITVSILIDDVNDCPPEFVNPIQTVSVLESAEVGTVVAEVTAIDRDLNPRLEYYIIEILATDDTNSLIPNQQGVFEINFKTGSVMVKSNLNRELVATYDITISVYDNASEVVDRSVSAPNAKLTVNILDVNDNTPRFRPFGVTAFTERIVEGATPGTTLISVSAVDPDKGPNGQITYSLHNLVPAGY----LQLEDNMAGKIIANRTVDYEQVQWLNFTVRASDNGSPRRSAEVPVYLQIVDINDN-NPIFSQSSYQKPVF---EDIQLGATVLQIKATDADSGRFALIQYSLVDGEGK--FGINPTTGDIYILST--LDREKKDHYTLTAIARDNPGDIASNRRENSVQVLITVLDVNDCRPQFSKSQFSTSVYENEPEGTSVITMSATDLDEGDNGVVTYNLEGPGS-EAFLIDKDSGLITSRRL-LQSFERFNLTVVATDKGRPPLWGTTMLKVDVIDVNDNRPVFVRPPNGTILHIKEEIPLKSTVYEVYATDND--EGLNGAVRYNLL 1512          

HSP 2 Score: 168.703 bits (426), Expect = 1.335e-40
Identity = 250/1053 (23.74%), Postives = 462/1053 (43.87%), Query Frame = 2
Query: 4181 IKENLPSGSHVASFNIRRLKNL-EVVYSIKQPE-----KYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRI--SAPTTENASIFQIVATDADSGPNSKLTYQI---NPSSDGIFMI---NGDSGEIHLVSSPRVSA---YELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITN--FLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSC-SPLNF-MEKNIYNLKIIATDSEGLSTGRKDFTK-VIIFVQNTKQHTLAFNATHFS-LKVLENSPGGTVLG-RINIVKPPVNSEIFYVLNPGH--SHIQINTTTGELRTNGPLHL--ELVEFIELTIHAFAK----FISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCT-----TVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFI----GQIKMVNYCKDHSAKFSI-IDGVNHELVFLHESTGKIFVAAAAKIDREK-IDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDA-NGDVK-TNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRI--------RHRKLTNQTLFLNVAFDSGEIF----LSRKLLVS-DVGKHEFD---IVVDDARFSSTAVIEIDVEDKNNHVPILKENG------RVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDN 7138
            I EN+ +G+ V     R + NL ++ Y   Q         F I+ +TG +    + DRE  +   FY  ++      PK  + + + + + DENDN P     S S+V +    PT    ++ Q  A D D G N  +T+ +   NPS  GIF I   N   GE+ L+ S        Y L V   DSG  P+      +++   +     + F                G  + +++ +      N  + YY+  G     F +D +TG + T+ +    E       ++ V ++   + ++     +++ I   N+N P F   +++V   E     N   LT  A D D G  G + YS+      +   I+ +TG +     L++ +    Y L + ATD   +   R   T  V++ V +   +   F   +    ++ E  PG  V   + +     +N ++ Y +  G       I++  G+LR      L  E + F  +TI A  +    F ST       A++++R++DINDN PI    P  I I  +     P+T++ A+D+D   N    F+    T   L   + ++  +G +++   +       + L + V DN   ++ +      +++ IS   D++ +       +  + ENS +GT I    G +  ++     +A  S  + G    L  ++ STG + V A   IDRE  ++ I+  T V+    ++    ++++ V D +DN+P+FS +     L E  PP   V+++T  D D G N Q+ Y IE   +Q+ FLIDA  G ++  N+ ++   K  Y L++ A+ + +  +     +++ I ++ND  P+   P + + +  +  VG+ + ++TA D D    + Y I         +  + NQ     + F +G +     L+R+L+ + D+    +D    VVD +  +  A + +++ D N++ P  +  G      R++  ++    G+ ++ + A+D D   NG++T+ L +  P   L+  DN
Sbjct:  182 IIENIATGTEVVRVQARSIDNLNQLSYKFDQTTYAQALALFKIDEITGAITVKGLVDREKGD---FYTLIVVADDGGPKKDSAV-VSITVLDENDNSPQFDPTSDSVVNVPEDCPTGRRVALVQ--ARDPDDGNNGLVTFSLTAGNPS--GIFEIRTTNNTLGEVFLIKSIDREVQELYTLKVQASDSGSPPRRSEYTLTVNVNDVNDNPPV-FDKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYITQGNEDLTFRMDRLTGEIATRPAPPDRE--KQSFYKLVVTVEDEGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQDEGPNGTVTYSISAGNVQETFSINNATGLIRVVKELDYEVCLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKPYEGPFEITEGQPGPRVATFKADDKDSGLNGQVEYSIVGGDLLGDFVISSVEGDLRVRKDYELDRENIAFYNITIMAKDRGNPPFSST-------AVVEIRVLDINDNDPILLNLPQNISISENTPVSTPITRILASDADTGRNALLTFN---ITAGNLENAFSINENTGIVYVNRQLDREKISEYKLTITVKDNPENARNSRRDFDVLIVTISDENDNRPL-FTQGSYLAELTENSPEGTPITVLNGPVLALDNDIGSNAVVSYRLLGAQINLFTINNSTGVVTVRAGKVIDRESFLNPILDLTLVAEDIGKLNSTARLVLTVLDANDNRPIFSPSSVTVHLRENSPPGFSVVKVTATDADSGINQQLSYRIE-SGAQDRFLIDAFTGVIRVANVTVDREEKDTYKLIVVATDQGAVPLSGSITVSILIDDVNDCPPEFVNPIQTVSVLESAEVGTVVAEVTAIDRDLNPRLEYYIIEILATDDTNSLIPNQQGVFEINFKTGSVMVKSNLNRELVATYDITISVYDNASEVVDRSVSAPNAKLTVNILDVNDNTPRFRPFGVTAFTERIVEGATP---GTTLISVSAVDPDKGPNGQITYSLHNLVPAGYLQLEDN 1208          

HSP 3 Score: 128.257 bits (321), Expect = 2.131e-28
Identity = 83/256 (32.42%), Postives = 137/256 (53.52%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLIISMNG----DTKNVQIKILDVNDNEPKFNATNFEK-SIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDIS-RYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDF-FTVDHKTGNVYLRKS-LDFEKSKSHHISIGVRDNSPP 967
            F I + TG I V GL+DREK + Y+ ++++ +G    D+  V I +LD NDN P+F+ T+    ++PE+ P G +V L    DPD+G N + +  + +G+   +F I   +++ G     + L +S+D E+   + L +QA D G PP ++   + + V + NDN P FD    Y  S+ E+     + +RV ATD D G++  L Y++  T  + D  F +D  TG +  R +  D EK   + + + V D   P
Sbjct:  222 FKIDEITGAITVKGLVDREKGDFYTLIVVADDGGPKKDSAVVSITVLDENDNSPQFDPTSDSVVNVPEDCPTGRRVALVQARDPDDGNNGLVTFSLTAGNPSGIFEIRTTNNTLG----EVFLIKSIDREVQELYTLKVQASDSGSPPRRSEYTLTVNVNDVNDNPPVFDKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYI--TQGNEDLTFRMDRLTGEIATRPAPPDREKQSFYKLVVTVEDEGNP 471          

HSP 4 Score: 125.176 bits (313), Expect = 2.008e-27
Identity = 290/1320 (21.97%), Postives = 544/1320 (41.21%), Query Frame = 2
Query: 3392 ETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVM-PKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSI------FNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQ-NVKIRIFVSDLGFPKMTSSVDTLL-------KPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIF-PENYGAKCLFISNTTTSVDGFLHLRFDSQQL---ILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIR-RLKNLEVV--YSIKQPEK--YFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSS-DGIFMINGDSGEIHLVSSPR----VSAYELNVTVRDSGE-VPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGS--VQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLT-VVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCSPLNFMEK-NIYNLKIIATDS-EGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPVNSEI-------FYVLNPGHSHIQINTTTG--ELRTNGPLHLE--LVEFIELTIHA--FAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSN--ITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHF-LKVIVSDNG-VP---SKCTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGV----------NHELVF-LHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGY------KKVIIHXXXXXXNKPVFSQNKFVAFLN---EGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDAN--GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKL--------LVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFEL 7096
            ET  +Y+  +NV   ATD+  P       + +  +     P E+V       + +    + +G+E+  V A   D  LN +        Y+  LA+       ID  TG IT K  +   + +    I V+D G PK  S+V ++         P ++P S+  ++N      +P+    G  V  +    P++     +  S T  +  G   +R  +  L    L+K         Y+L V  +        S   + V VN V  + P+F K     + + EN+  G+ V   N   + K L  V  Y I Q  +   F ++ +TG++ T R    + E Q  + + V      NP +     + V I DENDN P   SP   + R   P + N+ I    A D D GPN  +TY I+  +    F IN  +G I +V        +  Y L VT  D    V + ++   ++                       + + + G  +         S  N  + Y ++ G     F +  + G   V+  + + RE I       I ++ +   +        + I +   N+N P        + + E+  ++  +T ++A+D D G    + +++     +    I+ +TG +  +     EK + Y L I   D+ E     R+DF  +I+ + +   +   F    +  ++ ENSP GT +  +N     ++++I       + +L    +   IN +TG   +R    +  E  L   ++LT+ A    K  ST  +  T       ++D NDN+PI + + V + +  ++ P   + K++ATD+D   N  ++Y+ +            +L+D  +G + + +  +   +   + L V+ +D G VP   S   ++LID   +   ++V  +   ++    E++  GT + ++  ++   +   ++ II+ +          N + VF ++  TG + V +   ++RE +    +   V    SE+          K+ +++ DV+DN P F      AF     EG  P T +I ++  DPD G N Q+ Y +          ++ N  G +  N  +++      +  ++AS   SP   AE  + + IV+IND  P  S  +    +  +  +G+ + +I A D+D   G    I++  +  +  F  +   +G+I++   L         ++ + +     +  + R +S  V+ I V D N+  P   ++    ++  +   G+ ++ + A D D  DNG VT+ L
Sbjct:  134 ETKTTYY--MNVS--ATDQAVPFNRGFCTIYVTLMNE---PDEVVQFTSPTYKAVIIENIATGTEVVRVQARSIDN-LNQLSYKFDQTTYAQALAL-----FKIDEITGAITVKGLVDREKGDFYTLIVVADDGGPKKDSAVVSITVLDENDNSPQFDPTSDS-VVN------VPEDCPTGRRVALVQARDPDDGNNGLVTFSLTAGNPSGIFEIRTTNNTLGEVFLIKSIDREVQELYTLKVQASDSGSPPRRSEYTLTVNVNDVNDNPPVFDKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYITQGNEDLTFRMDRLTGEIAT-RPAPPDREKQSFYKLVVTVEDEGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQDEGPNGTVTYSISAGNVQETFSINNATGLIRVVKELDYEVCLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKPYEGPFEITEGQPGPRVATFKADDKDSGLNGQVEYSIVGGDLLGDFVISSVEGDLRVRKDYELDRENIA---FYNITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLNLPQNISISENTPVSTPITRILASDADTGRNALLTFNITAGNLENAFSINENTGIVYVNRQLDREKISEYKLTITVKDNPENARNSRRDFDVLIVTISDENDNRPLFTQGSYLAELTENSPEGTPITVLNGPVLALDNDIGSNAVVSYRLLGAQINLFTINNSTGVVTVRAGKVIDRESFLNPILDLTLVAEDIGKLNSTARLVLT-------VLDANDNRPIFSPSSVTVHLRENSPPGFSVVKVTATDADSGINQQLSYRIESG------AQDRFLIDAFTGVIRVANVTVDREEKDTYKLIVVATDQGAVPLSGSITVSILIDDVNDCPPEFVNPIQTVSVL---ESAEVGTVVAEVTAIDRDLNPRLEYYIIEILATDDTNSLIPNQQGVFEINFKTGSVMVKS--NLNRELVATYDITISVYDNASEVVDRSVSAPNAKLTVNILDVNDNTPRFRPFGVTAFTERIVEGATPGTTLISVSAVDPDKGPNGQITYSLHNLVPAGYLQLEDNMAGKIIANRTVDYEQVQWLNFTVRASDNGSPRRSAEVPVYLQIVDINDNNPIFSQSSYQKPVFEDIQLGATVLQIKATDADS--GRFALIQYSLVDGEGKF-GINPTTGDIYILSTLDREKKDHYTLTAIARDNPGDIASNRRENSVQVL-ITVLDVNDCRPQFSKSQFSTSVYENEPEGTSVITMSATDLDEGDNGVVTYNL 1407          

HSP 5 Score: 114.39 bits (285), Expect = 3.401e-24
Identity = 87/266 (32.71%), Postives = 133/266 (50.00%), Query Frame = 2
Query:  215 EKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMN--GDTKN--------VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKF--DISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSS---DFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            E KF I+ TTG I +   +DREK++ Y+   I+ +  GD  +        V I +LDVND  P+F+ + F  S+ EN P G+ V   +  D DEG N + +  +  G   + F I   D  +G+   R +L+         +FNL + A D G PPL  + ++K+ V + NDN P F    +  I  IKE+  +  T   V ATDND G++G + Y L  T   +   ++FT+D  +G +     LD EK   +++ I   D   P
Sbjct: 1304 EGKFGINPTTGDIYILSTLDREKKDHYTLTAIARDNPGDIASNRRENSVQVLITVLDVNDCRPQFSKSQFSTSVYENEPEGTSVITMSATDLDEGDNGVVTYNL-EGPGSEAFLI---DKDSGLITSRRLLQS------FERFNLTVVATDKGRPPLWGTTMLKVDVIDVNDNRPVFVRPPNGTILHIKEEIPLKSTVYEVYATDNDEGLNGAVRYNLLKTGAGTKDWEYFTIDSTSGLIQTALRLDREKQAMYNLIIVAYDLGQP 1559          

HSP 6 Score: 87.8113 bits (216), Expect = 3.876e-16
Identity = 75/265 (28.30%), Postives = 123/265 (46.42%), Query Frame = 2
Query:  212 QEKKFIISKTTGVIKVSGLIDREKQNLYSFLII-----------SMNGDTKNVQIKILDVNDNEPKF---NATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFA--IDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDN 958
            Q+  F I+  TG + V   ++RE    Y   I            S++     + + ILDVNDN P+F     T F + I E    G+ +   +  DPD+G N     +I       V A  +   D+  G    ++I  +++DYE +   N  ++A D G P   A + V + + + NDN P F  S Y   + ED ++  T L+++ATD D+G    + Y L +       F ++  TG++Y+  +LD EK   + ++   RDN
Sbjct: 1086 QQGVFEINFKTGSVMVKSNLNRELVATYDITISVYDNASEVVDRSVSAPNAKLTVNILDVNDNTPRFRPFGVTAFTERIVEGATPGTTLISVSAVDPDKGPNG----QITYSLHNLVPAGYLQLEDNMAG----KIIANRTVDYEQVQWLNFTVRASDNGSPRRSAEVPVYLQIVDINDNNPIFSQSSYQKPVFEDIQLGATVLQIKATDADSGRFALIQYSLVD---GEGKFGINPTTGDIYILSTLDREKKDHYTLTAIARDN 1339          

HSP 7 Score: 83.1889 bits (204), Expect = 1.051e-14
Identity = 79/265 (29.81%), Postives = 126/265 (47.55%), Query Frame = 2
Query:  224 FIISKTTGVIKVSG--LIDREK-------QNLYSFLIISMNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFL------DNTSP----SSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNS 961
            F I+ +TGV+ V    +IDRE          L +  I  +N  T  + + +LD NDN P F+ ++    + EN P G  V   T  D D G N   S RI SG  ++ F I   D+  G+  V  +   ++D E    + L++ A D G  PL  S+ V I++ + ND  P+F       S+ E  E+      V A D D  ++  L Y++      D+T+         F ++ KTG+V ++ +L+ E   ++ I+I V DN+
Sbjct:  869 FTINNSTGVVTVRAGKVIDRESFLNPILDLTLVAEDIGKLNS-TARLVLTVLDANDNRPIFSPSSVTVHLRENSPPGFSVVKVTATDADSGINQQLSYRIESGAQDR-FLI---DAFTGVIRVANV---TVDREEKDTYKLIVVATDQGAVPLSGSITVSILIDDVNDCPPEFVNPIQTVSVLESAEVGTVVAEVTAIDRD--LNPRLEYYIIEILATDDTNSLIPNQQGVFEINFKTGSVMVKSNLNRELVATYDITISVYDNA 1123          

HSP 8 Score: 80.4925 bits (197), Expect = 6.023e-14
Identity = 183/866 (21.13%), Postives = 347/866 (40.07%), Query Frame = 2
Query: 2588 VNIWENTTVGIEIMQVFPKYPSVSDE----YQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGE----------MECPLKCSDADSFPNGNLSYRMKIIKPVGMN-NPFEINPTTGCLLIISSLNIWNS---NPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNV-FYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTF-------VIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIE--LAIDNED----------QINIDSWTGLITTKVSLSCAQNVKIRIFVSD---------LGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSV-DGFLHLRFDSQQLILLKDNLNVKNVHY---SLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDS---PKFLEIKENLPSGSHVASFNIRRLKNLE---VVYSIKQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATH----VSNPKIFTVLPLIVKIADENDNEP-YILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEIHLVSSPRV----SAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLI---AG-KFAQIFSVDPITGSVQTQHSVSREE 4975
            ++I ENT V   I ++              + I      +  SI+  TG +++N+Q DRE++S   +T+ +K+   +A        + I        N         L+ L E          +  P+   D D   N  +SYR+     +G   N F IN +TG + + +   I      NP  I++L ++  D G    L +   + + ++DAN++ PI   ++V  ++ + +  G  V              + +  + Q   Y+   IE  +++ F       VIRV ++       +   ++++ATD+G+   S  I + I   + N  PPE V P Q   ++    +  G+ +  V A+D D  LN    Y I   LA D+ +          +IN  + + ++ + ++        I I V D         +  P    +V+ L      P+   F +    T  I + + PG  +  ++    + G       +    V  G+L L  +    I+    ++ + V +   ++    N     S    +Y+ ++   +  + P+FS+ S   P F    E++  G+ V         +     + YS+   E  F INP TG +      DRE ++   + +  IA      +++ +    + +++ + D ND  P +  S  S+ V  + P  E  S+  + ATD D G N  +TY +       F+I+ DSG   L++S R+      + L V   D G  P   + +  +    +     +     + ++     +      + ++  +      N  +RY L+   AG K  + F++D  +G +QT   + RE+
Sbjct:  717 ISISENTPVSTPITRILASDADTGRNALLTFNITAGNLENAFSINENTGIVYVNRQLDREKISEYKLTITVKDNPENARNSRRDFDVLIVTISDENDNRPLFTQGSYLAELTENSPEGTPITVLNGPVLALDNDIGSNAVVSYRL-----LGAQINLFTINNSTGVVTVRAGKVIDRESFLNP--ILDLTLVAEDIGK---LNSTARLVLTVLDANDNRPIFSPSSVTVHLRENSPPGFSV--------VKVTATDADSGINQQLSYR---IESGAQDRFLIDAFTGVIRVANVTVDREEKDTYKLIVVATDQGAVPLSGSITVSILIDDVNDCPPEFVNPIQTVSVLESAEV--GTVVAEVTAIDRD--LNPRLEYYIIEILATDDTNSLIPNQQGVFEINFKTGSVMVKSNLNRELVATYDITISVYDNASEVVDRSVSAPNAKLTVNILDVNDNTPRFRPFGVTA-FTERIVEGATPGTTLISVSAVDPDKGPNGQITYSLHNLVPAGYLQLEDNMAGKIIANRTVDYEQVQWLNFTVRASDNGSPRRSAEVPVYLQIV--DINDNNPIFSQSSYQKPVF----EDIQLGATVLQIKATDADSGRFALIQYSLVDGEGKFGINPTTGDIYILSTLDREKKDH--YTLTAIARDNPGDIASNRRENSVQVLITVLDVNDCRPQFSKSQFSTSVYENEP--EGTSVITMSATDLDEGDNGVVTYNLEGPGSEAFLIDKDSG---LITSRRLLQSFERFNLTVVATDKGRPPLWGTTMLKVDVIDVNDNRPVFVRPPNGTILHIKEEIPLKSTVYEVYATDNDEGLNGAVRYNLLKTGAGTKDWEYFTIDSTSGLIQTALRLDREK 1543          

HSP 9 Score: 79.337 bits (194), Expect = 1.272e-13
Identity = 79/261 (30.27%), Postives = 123/261 (47.13%), Query Frame = 2
Query:  215 EKKFIISKTTGVIKVSGLIDREK-QNLYSFLIISMN---------GDTKNVQIKILDVNDNEPKFNATNFEK--SIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVP-KFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDN 958
            ++ F I+  TG+I+V   +D E     Y+ ++ + +           T  V + + D+NDN P F    +E    I E  P G +V      D D G N      IV GD    F I    S  G   VR      LD E I+ +N+ I A D G+PP  ++ +V+I V + NDN P   ++ + I SI E+  ++    R+ A+D D G +  L  F        + F+++  TG VY+ + LD EK   + ++I V+DN
Sbjct:  539 QETFSINNATGLIRVVKELDYEVCLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTF-PKPYEGPFEITEGQP-GPRVATFKADDKDSGLNGQVEYSIVGGDLLGDFVIS---SVEGDLRVRK--DYELDRENIAFYNITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLNLPQNI-SISENTPVSTPITRILASDADTGRNA-LLTFNITAGNLENAFSINENTGIVYVNRQLDREKISEYKLTITVKDN 790          

HSP 10 Score: 78.1814 bits (191), Expect = 3.571e-13
Identity = 69/242 (28.51%), Postives = 115/242 (47.52%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKN--------VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASL---LVKIIVQNANDNVPKFDISRYIASIKED--QEINITFLR--VRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKS 904
            F+IS   G ++V    + +++N+  + I  M  D  N        V+I++LD+NDN+P         SI EN P+ + +      D D G+N++ +  I +G+ E  F+I+    + GI YV     + LD E IS++ L I   D       +     ++ + + + NDN P F    Y+A + E+  +   IT L   V A DND G +  + Y L       + FT+++ TG V +R  
Sbjct:  651 FVISSVEGDLRVRKDYELDRENIAFYNITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLNLPQNISISENTPVSTPITRILASDADTGRNALLTFNITAGNLENAFSIN---ENTGIVYV----NRQLDREKISEYKLTITVKDNPENARNSRRDFDVLIVTISDENDNRPLFTQGSYLAELTENSPEGTPITVLNGPVLALDNDIGSNAVVSYRL--LGAQINLFTINNSTGVVTVRAG 883          

HSP 11 Score: 77.411 bits (189), Expect = 5.081e-13
Identity = 131/466 (28.11%), Postives = 209/466 (44.85%), Query Frame = 2
Query: 2594 IWENTTVGIEIMQVFPKYPSVSDEYQIIQSQY----SDWLSIHSK-TGQIFLNKQFDREQVSYLVVTVQLKNLIG---SATXXXXXXXXXXXXXKP-YCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDN-GPFKP--LETEVEISVRIIDANNHSPIL----ISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSI---ELAIDNEDQINIDSWTGLITTKVSLSCAQNV--KIRIFVSDLGFPKMTSSVDTLLKPLYE-PKSEEFLIN------KNLTFIIPDHSQPGYVVGDL 3907
            I E  T G  ++ V    P      QI  S +    + +L +     G+I  N+  D EQV +L  TV+  +      SA + ++L I+DINDN P + ++S     FED+  LG     +K +DADS     + Y +     V     F INPTTG + I+S+L+    +      L  I  DN G       E  V++ + ++D N+  P       ST+V+   +    GT V T+   D D G+NG +  +L+ P   + F I+K S    +   + L++    FE  N+ ++ATD+G P       L ++ I+ N N P  V P     +     +   S ++ V A D D+GLN    Y++        + +   IDS +GLI T + L   +     + I   DLG P    ++  L   L +   +E   I       +  T  + +HS+PG VVG++
Sbjct: 1164 IVEGATPGTTLISVSAVDPDKGPNGQITYSLHNLVPAGYLQLEDNMAGKIIANRTVDYEQVQWLNFTVRASDNGSPRRSAEVPVYLQIVDINDNNPIFSQSSYQKPVFEDIQ-LGATVLQIKATDADSGRFALIQYSL-----VDGEGKFGINPTTGDIYILSTLDREKKDH---YTLTAIARDNPGDIASNRRENSVQVLITVLDVNDCRPQFSKSQFSTSVY---ENEPEGTSVITMSATDLDEGDNGVVTYNLEGPGS-EAFLIDKDSG--LITSRRLLQS----FERFNLTVVATDKGRPPLWGTTMLKVDVIDVNDNRPVFVRPPNGTILHIKEEIPLKSTVYEVYATDNDEGLNGAVRYNLLKTGAGTKDWEYFTIDSTSGLIQTALRLDREKQAMYNLIIVAYDLGQPVPYETMLPLQVALDDIDDNEPAFIRPPRGALQYQTLSVREHSKPGTVVGNV 1610          

HSP 12 Score: 76.6406 bits (187), Expect = 8.622e-13
Identity = 78/332 (23.49%), Postives = 150/332 (45.18%), Query Frame = 2
Query:  104 NSNLLIFS-------IKENVPIG----EVVGQIESPGFSP--PFEMHDFQEKKFIISKTTGVIKVSGL-IDREKQNLYSFLIISMN------GDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPD-EGKNSIQSVRIVSGDS--------EKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVI-------QAIDGGHPPLQASLLVKIIVQNANDNVPKF---DISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSK 982
            N N  IFS       ++EN P G    +V       G +    + +    + +F+I   TGVI+V+ + +DRE+++ Y  ++++ +        +  V I I DVND  P+F       S+ E+  +G+ V   T  D D   +     + I++ D         + VF I++   S       +++K +L+ E+++ +++ I       + +D       A L V I+  + NDN P+F    ++ +   I E      T + V A D D G +G++ Y L N  P+      D+  G +   +++D+E+ +  + ++   DN  P  +++
Sbjct:  922 NDNRPIFSPSSVTVHLRENSPPGFSVVKVTATDADSGINQQLSYRIESGAQDRFLIDAFTGVIRVANVTVDREEKDTYKLIVVATDQGAVPLSGSITVSILIDDVNDCPPEFVNPIQTVSVLESAEVGTVVAEVTAIDRDLNPRLEYYIIEILATDDTNSLIPNQQGVFEINFKTGS-------VMVKSNLNRELVATYDITISVYDNASEVVDRSVSAPNAKLTVNIL--DVNDNTPRFRPFGVTAFTERIVEGATPGTTLISVSAVDPDKGPNGQITYSLHNLVPAGYLQLEDNMAGKIIANRTVDYEQVQWLNFTVRASDNGSPRRSAE 1244          

HSP 13 Score: 72.0182 bits (175), Expect = 2.395e-11
Identity = 64/224 (28.57%), Postives = 102/224 (45.54%), Query Frame = 2
Query:  269 IDREKQNLYSFLIISMNGDTK------NVQIKILDVNDNEPKFNAT-NFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQ-EINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFE 916
            IDRE Q LY+  + + +  +        + + + DVNDN P F+    +  S+ EN   G+ V      D D+G NS+ S  I  G+ +  F +D      G    R       D E  S + LV+   D G+P L A+  V + + + NDN P F    Y  +  E    +N   L   A D D G +G + Y + +     + F++++ TG + + K LD+E
Sbjct:  344 IDREVQELYTLKVQASDSGSPPRRSEYTLTVNVNDVNDNPPVFDKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYITQGNEDLTFRMDRL---TGEIATR---PAPPDREKQSFYKLVVTVEDEGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQDEGPNGTVTYSI-SAGNVQETFSINNATGLIRVVKELDYE 560          

HSP 14 Score: 65.855 bits (159), Expect = 1.981e-9
Identity = 57/228 (25.00%), Postives = 110/228 (48.25%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTK-------NVQIKILDVNDNEPKF-----NATNFEK-SIPENYPIGSKV-DLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQA-----------IDGGHPPLQASLL--VKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFY 826
            F I  T+G+I+ +  +DREKQ +Y+ +I++ +            +Q+ + D++DNEP F      A  ++  S+ E+   G+ V +++   D DEG N+I    I +G+ +  F +        I   +L + ++LD E    ++++++A           +     P   S L  V++ +++ ND  P+F    Y A +  D ++    ++V A D D G +  +FY
Sbjct: 1524 FTIDSTSGLIQTALRLDREKQAMYNLIIVAYDLGQPVPYETMLPLQVALDDIDDNEPAFIRPPRGALQYQTLSVREHSKPGTVVGNVSGAVDVDEGSNAIVYYFIATGNQDNNFLL--------IPEGKLTVLKNLDREKEPYYSIIVKASSNRSWTPGNSLGKKFDPATDSTLQEVRVYLEDINDQPPRFTKPEYTAGVATDAKVGSELIKVLAVDADVGNNSLVFY 1743          

HSP 15 Score: 62.3882 bits (150), Expect = 2.113e-8
Identity = 43/138 (31.16%), Postives = 72/138 (52.17%), Query Frame = 2
Query:  569 LILK--QSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIA-SIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFH 973
            LI++  Q LD E  S   LV++A +    P+++S+ V I V++ ND VP F   +Y    ++E   I  +   VRATD D G  G + Y +   S +   F +D  TG +     LD+E   ++++++   D + PF+
Sbjct:   18 LIMRGVQPLDRETNSSHVLVVEAYNSDQGPMRSSVRVIIYVEDVNDEVPVFTQQQYSRLGLRETVGIGTSVTVVRATDRDTGDGGLVTYKI--ISGADGKFDIDASTGLLTTIDYLDYETKTTYYMNVSATDQAVPFN 153          
BLAST of Dachsous vs. Ensembl Mouse
Match: Fat4 (FAT atypical cadherin 4 [Source:MGI Symbol;Acc:MGI:3045256])

HSP 1 Score: 270.781 bits (691), Expect = 1.387e-71
Identity = 603/2626 (22.96%), Postives = 1075/2626 (40.94%), Query Frame = 2
Query:  245 GVIKVSGLIDREKQNLYSFLIISMN------GDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSL-DYEIISQFNLVIQAIDGGHP-PLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNS--PPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDA-ISTSFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSI-NLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEIDSTILNENQHVTFVKTTKRLPTKPI------FIFKIFVLNNLFKINETTGEILSKRSIDCGKYFFNVSMLSLKTNSL---IDQTKLEI------VVKSGRKLPLYFDRGFRKILVTTGKSQCFSEIAVRNRHCGMRIQYSYDLLLKTDGILRINEH-GALCTAENVKHNKLMSTRYLYQIKALDETNSSAVCVVLFAIQPSKVFDVLPTEINITLPIIDSPKFNFSL---------PIGKIIGTFSKLPPAQFIGFIQYHLVP---EELSTGAI-TVDSQSGEILMKKFPIHKNPIRLIVKSV--IRK--PFNVSPLNIVAINFQKLFFARSLY---QFILTKSEIKGNLVKIGQVSM---DSSCTESVSYDLFGVKNDHSHFTIDVATG-VIYGKDLGSISNKTLMFQVSAKAPKSQTSFAQVIIYIED-GIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSDEYQIIQSQYSDWLSIHSKTGQIFLN---------KQFDREQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKP--YCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSD--NGPFKPLETEVEISVRIIDANNHSPILISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSL--SCAQNVKIRIFVSDLGFPKMTSSVD---TLLK-----PLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHV---ASFNIRRLKNLEVVYSIKQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEIHLVSSPRVSAYEL--NVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLD-IRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKL-SCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPPV--NSEIFYVLNPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSN--ITY------QFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDI-SLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVN---YCKDHSAKFSIIDGVNHELVF-LHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNL-KLDTNRPVGSFITKITAKDSD-GPDG-ISYRIRHRKLTNQTLFL---NVAFDSGEIFLSRKLLVSDVGKHEFDIVVD-----DARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALF---LID-EPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKAIFYKIDNFHPISNN----LYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQ--KPAIISNLLQ-----MDKNSFRYSYYLISVAP 7747
            G + +   +DRE Q+ Y  L+++ +        T NV + + DVNDN P FN+TN+     E    GS V   +  D D G N    VR     ++  F +  H  +  I       ++SL      + F+  + A+D G P PL+    V + +++ NDN PKF    Y A++ E        LRV A+D D G +G + Y +   +    F  +D  +G V L   LD+E + ++ + I   D+   P   T  + + I   + N        L+     ++  ++    +V+ V  TD D+ ++      I   +      I P    + L   + ++++ S+  L + A D   P  S+T ++ I++ +      SF          S + N     + +  T   P   I       I +     N F I+E  G I +   ID  + F N+  L++K N     I+  +  +      V      +P++  +       +       + I   +   G   +  Y++L        ++ + G L  A  +  ++L+   Y   + A D             + P +      TE+ + L  +D P F  +          PIG  + +     P      ++Y++V    EE + G + T+  Q+G I        +    L +  V  I K   F  +    V I  Q +     ++      LT  E  G+  KI Q++    D      V+Y L    +D   F ID  +G +I  K L           V A     Q+S  ++ I I D   H P F       +I E+TT G  +  +       +D+   +  + S  +      G  FLN         +  D E   Y ++TV+ ++  G +T       +   ++ P  +  +S +    E+L  LG        +DAD   N  LSY +     +G    F ++       ++ +L   +       NL++ V D    P     +  ++S+ ++D N++ P+ +S  + YI +     T V      D D G N  IE +L  P   + F I  +     +      E +++Y    ++ ++ATD+G P  SS   +V+  ++ N N P  V  +   ++     +L+G++I  V+A D D+G N    Y I +  +   +  IDS TG IT   SL         + +  +D G    T S     TLL      P++E       + +NL  +     Q   V  D +  P +  +  L   N     D    L    +  +    +   ++ H+ L V        +++    IN+IV+ +  + P F+ +      I E+  +G+ V    + +     N  + YSI      F INP TGQ++T  + DRET++     V V +   S   + +   ++V I D NDN P        +  I +PT   + +F +  TDAD G NS+L Y ++  +   F I+   G I + + P   A E+  +V V+D G  PK+ S   ++ F +     K+R    +     + P       +G L  + T SS   + + YY+ +G     F +DP+TG V     +  E+I    +V I          S Y  +++ I +   N+N P F    F  ++ E+ +    LTV A D D G  G++ Y +     +    I+ +TG++ S  PL+  + + Y L + ++D    S  +    KVII + +   +   F+   FS  V ENSP G  + R+      +  N+   Y +        IN  TG++  + PL+ E  +   + + A        S  T S  + + + DINDN P  +     +  P   +    +T++SATD D+ SN  + Y      ++ R + TT  ++   +L  ++ + F   ++      RH   V  SD G PS  +   + I +++ +    Q +  K    V +N   GT + ++  V+   +  +   ++ + DG NH   F L   TG I +A++   D  + + +I  T    G   +     V I V + + + P FSQN   A + E     + V  ++  D D   N  + Y I   + +  F I+++ G V     L++   S +++ I A+          C LTV ++++ND  P + +P+     +  N P G+ +  + A D+D G +  I+Y ++    ++  LF+   N+   + + FL  +       K  + + V      D    S A ++I ++  N +VP          +S +  RG+ +  + A D+D+  +G+V + +   S   G +  +  T  ++   L+D E +E+     L     +       R   I  +TV +    +  P +    +  + I E +  G+ +T FV    DSD    +   ++   S N      ++ ++G + +T  L+    P + L V     G+P    S +L V +E  N      DN  + L++   E+++  +P  +   LQ     +  N   ++YYL+S  P
Sbjct: 1050 GQLYIKSELDRELQDRYVLLVVASDRAVEPLSATVNVTVLLEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNG--EVRYAFEVTQPNFEL--HAVTGEITSTHKFDRESLMRRRGTAVFSFTVTAMDRGLPQPLKDQATVHVYMKDINDNAPKFLKDFYQATVSETATNLTQVLRVSASDVDEGSNGLIHYSILKGNEERQF-AIDSFSGQVTLVGKLDYEATSAYSLLIQAVDSGAIPLNSTCTLSIDILDENDNTPSFPKSTLFV----DVLENMRIGELVSSVTATDSDSGVNADLHYTITGSNNHGTFSISPNTGSIFLAKKL-DFETQSLYKLNITAKDQGRPPRSSTMSVVIQVRDFNDNPPSFPPGDI---FKSIVENIPLGTSVISVTAHDPDADINGQLSYAIIQQMPRGNHFSIDEVKGTIYTSAEID--REFANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFISQNALAADPSAMIGSVLTTIMAADPDEGANGEVEYEILNGDTDTFTVDRYSGDLRVASALVPSQLI---YNLIVSATD-------------LGPERRKST--TELTVILQGLDGPVFTQTKYITILKEGEPIGTNVISIEAASPRGSEAPVEYYIVSVRCEEKTVGRLFTIGRQTGVIQTAAILDREQGACLYLVDVYAIEKSSAFPRTQRAEVEITLQDINDNPPVFPTDTLDLTVEENIGDGSKIMQLTAMDADEGANALVTYALISGADDS--FRIDPESGDLIATKRLDREHRSKYSLLVRADD-GLQSSDMRINITISDVNDHTPRFSRPVYSFDIPEDTTPGSLVAAIL-----ATDDDSGVNGEISYVVEEDDGDGVFFLNLVTGVFNLTRALDYETQQYYILTVRAEDGGGQSTTIRAYFNILDVNDNPPVFSMSSYSTSLMENLP-LGSTVLVFNVTDADDGVNSQLSYSIASGDSLGQ---FAVDKHG----VLKTLKALDRESQSFYNLVIQVHDLPQPPTSRFTSTAQVSIILLDVNDNPPMFLSPKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPSGNK-FSIGTIDGEVHLTGELDREEVSNY----SLTVVATDKGQPPLSSSTEVVVMVLDINDNNP--VFAQAMYRVQIKENILTGTDIIQVSAADNDEGTNGQVRYGI-VGGNTHQEFRIDSVTGAITVAKSLDRETTPAYTLTVQATDRGSSPRTDSCTVAITLLDMNDFVPVFELSPYSVNVPENLGTLPRAILQ--VVARDDDQGPNSQLSYVLLGGNE----DNAFVLTASGELRVTQSLDREARD-HFVLVVTAADAGSPALTGTGTINIIVDDINDNVPTFANNM-YLTSIAEDARTGTDVLLVNASDADAAANAVISYSIIGGNSQFTINPSTGQIITSALLDRETKDNYTLVV-VASDAGSPESLSSSTSVLVTITDVNDNPPR-FQHHPYVTHIPSPTPPGSFVFAVTVTDADIGSNSELHYSLSGRNSEKFHIDPLRGAI-MAAGPLSGASEVTFSVHVKDGGSFPKTDSTTVTVRFANKADFPKVRAKEQTFMFPENQP-------VGTLVTTITGSSLRGETLSYYIASGNLGDTFQIDPLTGQVSISQPLDFEKI-QKYVVWIEARDGGFPPFSSY--EKLDITVLDINDNAPTFEEDPFVSEILENLSPRKILTVSATDKDSGPNGQLDYEIVNGNQESSFTINHATGEIRSIRPLDREKISHYELTVKSSDKG--SPSQSTSVKVIISILDENDNAPRFSQI-FSAYVSENSPLGYTVTRVTTSDEDIGINAISRYSIVDTSLPFTINPNTGDIVISRPLNREDTDRYRIRVSAH------DSGWTVSTDVTIFVTDINDNTPRFSRPSYYLDCPELPELGSRVTQVSATDPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQVLKYQNVSGFSNVNIN-----RHSFIVTASDRGNPSLLSETTVTINTVDSNDNPPQFLQNKYFTPVTKNVKVGTKLIKVTAVDDKDFGLNSEVEYFVSDG-NHLGKFKLDNDTGWISIASSLVSDLNQ-NFLIRVTAKDKGNPPLSSQAVVHITVTEENYHTPEFSQNHISATIPESHSIGSVVRTVSARDRDTAMNGLISYNIISGNEEGIFAINSSTGVVTLAKALDYEMSSKHEMTISATDGGWVARTGYCSLTVSVIDVNDNSP-VFVPDEFFPTVMENAPSGTTVIHLNATDADSGANAVIAYTVQS---SDSDLFVIDPNMGVITTQGFLDFET------KQSYHLTVKAFNVPDEEKCSFATVDIQLKGTNEYVPRFVSKLYYFEVSEAASRGTAVGEVFASDRDMGADGEVHYLIFGNSRKKGFQ-INKMTGQIYVSGLLDREKEERVSLKVLAKNFGN------IRGADIDEVTVNITVLDANDPPVFSLSTYRVQISEGVPIGTHVT-FVSA-FDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTSGLDRESLPVYNLTVLAVDSGTPSATGSASLVVTLEDIN------DNGPV-LTVSEGEVLENKRPGTLVMTLQSTDPDLPPNQGPFNYYLLSTGP 3555          

HSP 2 Score: 262.307 bits (669), Expect = 6.065e-69
Identity = 505/2200 (22.95%), Postives = 895/2200 (40.68%), Query Frame = 2
Query: 2261 FFARSLYQFILTKSEIKGNLVKIGQVSMDSSCTESVSYDLFGVKNDHSHFTIDVATGVIY-GKDLGSISNKTLMFQVSAK----APKSQTSFAQVIIYIED-GIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSD----EYQIIQSQ-YSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKN-----SKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGII-NLLVIVSDNGP-FKPLETEVEISVRIIDA-----NNHSPIL-----ISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSL--ETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTG-LITTKVSLSCAQNVKIRIFV-SDLGFPKMTSSVDTLLKPL--YEPKSEEFLINKNLTFIIPDHSQPGYVV-------------GDLNIFPENYGAKCLFISNTTTSVDGFLH-LRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLK---NLEVVYSIKQPEKY--FVINPVTGQLVTFRMFDRETENQIQFYVEVIATH-VSNP---KIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQI-NPSSDGIFMINGDSGEIHLVSS---PRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIG----QLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAI--TNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCS-PLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGT--VLGRINIVKPPVNSEIFYVLNPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGG-SEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLID-ANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWF------------------GLRGFDN-NTAALFLIDEPQEKGHPYFLG-IQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGN-HSTEITIPESLKSGSKITKFVCKDLDSDKAIFYKIDNFHPISNNL---YLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKEN-KGPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESRIWNLTIMIVKAQKYQNSPSN-----------LYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHD------IQYFLTPHENFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLLIKGSYFYL---RSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIVENP-SENFGINNETGAIYIKNQFIIEKKDKQRVK 8506
            F   +L+  +L    I   +  +     DS     + Y + G  N+H  F+I   TG I+  K L   +       ++AK     P+S T    V+I + D   + P F   D+  +I EN  +G  ++ V    P         Y IIQ     +  SI    G I+ + + DRE  +   +TV+  +         +              N     S+     +  + +G +   +  +D D   NG + Y  +I+   G  + F ++  +G L + S+L      PS +I NL+V  +D GP  +   TE+ + ++ +D        +  IL     I TNV  I   +  G+E            E   + +  ++    + F I    + T VI+  ++      +    ++V  I      P ++    + I   + N NPP  V P     +     +  GS+I  + A+D D+G N++  Y++    D  D   ID  +G LI TK  L      K  + V +D G       ++  +  +  + P+    +     +F IP+ + PG +V             G+++   E      +F  N  T V      L +++QQ             +Y L V        S +   Y N++   V  + P+FS  S     + ENLP GS V  FN+       N ++ YSI   +    F ++   G L T +  DRE+++   FY  VI  H +  P   +  +   + + + D NDN P  LSP  + +  + P   +  +F+  ATD DSGPNS + Y + NPS +  F I    GE+HL        VS Y L V   D G+ P S S    +    I   + +       +  +   Q K   + G    Q+S +      N  +RY ++ G   Q F +D +TG++    S+ RE    +    + V       +   D   + I +   N+  P F  S + V +PE+        L VVA D D G   ++ Y L G   D   F+  ++G+L  +  L+   ++ + L + A D+   S        + I V +   +   F    +   + E++  GT  +L   +      N+ I Y +  G+S   IN +TG++ T+  L  E  +   L +   A    +    ++S  + V I D+NDN P    +P    IP+   P   +  ++ TD+D  SN    +  S   ++  +    +D   G +     +  + ++     V V D G   K  +  + +       + ++  ++  F   EN   GT +  I   +  +  +  + I  G   +   +   TG++ ++    +D EKI K ++W +   GG      Y+K+ I V D++DN P F ++ FV+ + E   P+  ++ ++  D D G N Q++Y I   + +  F I+ A G++++  PL+    S Y+L +K+S K SP      ++ + I++ ND  P+ S    +  +  N P+G  +T++T  D D   GI+   R+  + + +L   +  ++G+I +SR L   D  ++   +   D+ ++ +  + I V D N++ P        ++     + GS++  + A D D   NG+V + + S S +F                   + GF N N      I    ++G+P  L    +T N +D                      P+ + N + T +T  +++K G+K+ K    D D D  +  +++ F    N+L    LD ++G + +  SL   +   FL+ VT    G+P   +   + + + +EN   P    N    +S  +PE     +++  +   D+++        ++     E I     F I+SS  +                + + KA  Y+ S  +           +   GY  + + V +  + +             + EN P  TTV+ L     D      I Y +   ++       +      I ++  LDFET ++Y L +      F +     CS    V+I +   +EY P FV + +   V     + G  +   +ASD+D G  G V Y I  N   + F IN  TG IY+      EK+++  +K
Sbjct: 1315 FPKSTLFVDVLENMRIGELVSSVTATDSDSGVNADLHYTITG-SNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSST--MSVVIQVRDFNDNPPSFPPGDIFKSIVENIPLGTSVISVTAHDPDADINGQLSYAIIQQMPRGNHFSIDEVKGTIYTSAEIDREFANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFISQNALAADPSAMIGSVLTTIMAADPDEGANGEVEY--EILN--GDTDTFTVDRYSGDLRVASALV-----PSQLIYNLIVSATDLGPERRKSTTELTVILQGLDGPVFTQTKYITILKEGEPIGTNVISIEAASPRGSEA---------PVEYYIVSVRCEEKTVGRLFTI---GRQTGVIQTAAILDREQGACLYLVDVYAIEKSSAFP-RTQRAEVEITLQDINDNPP--VFPTDTLDLTVEENIGDGSKIMQLTAMDADEGANALVTYALISGAD--DSFRIDPESGDLIATK-RLDREHRSKYSLLVRADDGLQSSDMRINITISDVNDHTPRFSRPV----YSFDIPEDTTPGSLVAAILATDDDSGVNGEISYVVEEDDGDGVFFLNLVTGVFNLTRALDYETQQ-------------YYILTVRAEDGGGQSTTIRAYFNIL--DVNDNPPVFSMSS-YSTSLMENLPLGSTVLVFNVTDADDGVNSQLSYSIASGDSLGQFAVDK-HGVLKTLKALDRESQS---FYNLVIQVHDLPQPPTSRFTSTAQVSIILLDVNDNPPMFLSPKLTYIPENTPI--DTVVFKAQATDPDSGPNSYIEYTLLNPSGNK-FSIGTIDGEVHLTGELDREEVSNYSLTVVATDKGQPPLSSSTEVVVMVLDINDNNPV------FAQAMYRVQIKENILTGTDIIQVSAADNDEGTNGQVRYGIVGGNTHQEFRIDSVTGAITVAKSLDRE---TTPAYTLTVQATDRGSSPRTDSCTVAITLLDMNDFVPVFELSPYSVNVPENLGTLPRAILQVVARDDDQGPNSQLSYVLLGGNEDNA-FVLTASGELRVTQSLDREARDHFVLVVTAADAG--SPALTGTGTINIIVDDINDNVPTFANNMYLTSIAEDARTGTDVLLVNASDADAAANAVISYSIIGGNSQFTINPSTGQIITSALLDRETKDNYTLVV--VASDAGSPESLSSSTSVLVTITDVNDNPPRFQHHPYVTHIPSPTPPGSFVFAVTVTDADIGSNSELHYSLSGRNSEKFH----IDPLRGAIMAAGPLSGASEVT--FSVHVKDGGSFPKTDSTTVTVRFANKADFPKVRAKEQTFMFPENQPVGTLVTTITGSSL-RGETLSYYIASGNLGDTFQIDPLTGQVSISQ--PLDFEKIQKYVVWIEARDGGFPPFSSYEKLDITVLDINDNAPTFEEDPFVSEILENLSPRK-ILTVSATDKDSGPNGQLDYEIVNGNQESSFTINHATGEIRSIRPLDREKISHYELTVKSSDKGSPSQSTSVKVIISILDENDNAPRFS-QIFSAYVSENSPLGYTVTRVTTSDED--IGINAISRY-SIVDTSLPFTINPNTGDIVISRPLNREDTDRYRIRVSAHDSGWTVSTDVTIFVTDINDNTPRFSRPSYYLDCPELPELGSRVTQVSATDPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQVLKYQNVSGFSNVNINRHSFIVTASDRGNPSLLSETTVTINTVDSNDNP-----------------PQFLQNKYFTPVT--KNVKVGTKLIKVTAVD-DKDFGLNSEVEYFVSDGNHLGKFKLDNDTGWISIASSLVSDLNQNFLIRVTAKDKGNPPLSSQAVVHITVTEENYHTPEFSQNH---ISATIPESHSIGSVVRTVSARDRDTAMNGLISYNIISGNEEGI-----FAINSSTGV----------------VTLAKALDYEMSSKHEMTISATDGGWVARTGYCSLTVSVID--VNDNSPVFVPDEFFPTVMENAPSGTTVIHLNATDADSGANAVIAYTVQSSDSDLFVIDPNMGV---ITTQGFLDFETKQSYHLTV----KAFNVPDEEKCSFA-TVDIQLKGTNEYVPRFVSKLYYFEVSEAASR-GTAVGEVFASDRDMGADGEVHYLIFGNSRKKGFQINKMTGQIYVSGLLDREKEERVSLK 3374          

HSP 3 Score: 197.593 bits (501), Expect = 1.931e-49
Identity = 536/2422 (22.13%), Postives = 981/2422 (40.50%), Query Frame = 2
Query:  212 QEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNG------DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYD-AISTSFDLEILNRSPFQL--------IKILPKMWELKLINDIGNYKSNSINLTLKAVDY-PEPSLSTTQALTIKIHESILFENSFSHSRFQVEIDSTILNENQH-----VTFVKTTKRLPTKPIFIFKIFV------LNNLFKINETTGEILSKRSID--CGKYFFNVSMLSLKTNSLIDQTK---LEIVVKSGRKLPLYFDRGFRKILV--TTGKSQCFSEIAVRNRHCGMRIQYSYDLLLKTDGILRIN-EHGALCTAENVKHNKLMSTRYLYQIKALDETNSSAVCVVLFAIQPSKVFDVLPTEINITLPIIDSPKFNFSLP--------IGKIIGTFSKLPPAQFIGFIQYHLVPEELSTGAITVDSQSGEILMKKFPIHKNPIRLIV----------KSVIRKPFNVSPLNIVAINFQKLFFARSLYQFILTKSEIKGNLVKIGQVS-MDSSCTESVSYDLFGVKNDHSHFTIDVATGV---IYGKDLGSISNKTLMFQVS--AKAPKSQ-TSFAQVIIYIEDGIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSD----EYQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIG---SATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMN--NPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNVFYIHQTAVYGTE-VGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVI----RVKSLETINSYFEPLNVMLI-ATDRGSPS--KSSVINLVINFIESNRNPPEIVMPKQHKQMIFFC---PLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSL--SCAQNVKIRIFVSDLGFPKMTSSVDTLLKPLYEPKSE--EFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINV-IVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLKNLEVVYSIKQPE--KYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSN-PKIFTVLPLIVKIADENDNEPYILSPS--SSIVRISAPTTENASIFQIVATDADSGPNSKLTYQI-NPSSDGIFMINGDSGEIHLV---SSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLT-VVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSCSPL-------NFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKPP---VNSEIFYVLNPGH--SHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSN--ITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSK---CTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFS-IIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQV-SCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKAS--PFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIV-VDDARFSST--AVIEIDVEDKNNHVPILK-ENGRVINLSSSLKRGSKILYLHAIDKDLRDN-GKVTFELVSTSP 7111
            +E++F I   +G + + G +D E  + YS LI +++        T  + I ILD NDN P F  +     + EN  IG  V   T  D D G N+     I   ++   F+I  +  S       + L + LD+E  S + L I A D G PP  +++ V I V++ NDN P F       SI E+  +  + + V A D DA ++G+L Y +    P  + F++D   G +Y    +D E +    +++   D + P  T +  +    I + D   ++ +  +      +      +++  +   D D   +   + EILN              +++   +   +LI           NL + A D  PE   STT+ LT+ +    L    F+ +++      TIL E +      ++    + R    P+  + + V      +  LF I   TG I +   +D   G   + V + +++ +S   +T+   +EI ++     P  F      + V    G      ++   +   G     +Y L+   D   RI+ E G L   + +  ++   ++Y   ++A D   SS + +           ++  +++N   P    P ++F +P        +  I+ T      +   G I Y +V E+   G   ++  +G   + +   ++     I+           + IR  F     NI+ +N     F+ S Y   L ++   G+ V +  V+  D      +SY +    +    F +D   GV   +   D  S S   L+ QV    + P S+ TS AQV I + D    P    S  L  I ENT +   + +     P        EY ++     +  SI +  G++ L  + DRE+VS   +TV   +      S++ ++ + +LDINDN P    +      ++    G     +  +D D   NG + Y +     VG N    F I+  TG + +  SL+   + P+    L V  +D G   P      +++ ++D N+  P      VF +   +V   E +GTL      +    + +    Q  Y     +     N FV+     ++  ++++       V+++ A D GSP+   +  IN++++ I  N       +P     M          +G+++  VNA D D   N++ +YSI   I    Q  I+  TG I T   L      N  + +  SD G P+  SS  ++L  + +       F  +  +T  IP  + PG  V  + +   + G+      + +       H+      ++          V +S++V       F  + +  + V   N+  F  P        F+   EN P G+ V +     L+   + Y I        F I+P+TGQ+   +  D E   +IQ YV  I       P   +   L + + D NDN P        S I+   +P      I  + ATD DSGPN +L Y+I N + +  F IN  +GEI  +      ++S YEL V   D G   +S SV   I     +  +  RF     +       S  G+ + +++ S      N   RY ++       F+++P TG +     ++RE+   ++  +I V   S HD+       + I +   N+N PRFSR  + +  PE   + + +T V A DPD G  G++ Y ++  +  +   I+ +TG++    +        F   NI     I T S+  +      T V I   ++  +   F    +   V +N   GT L ++  V      +NSE+ Y ++ G+     +++  TG +     L  +L +   + + A  K     S Q   A++ + + + N + P  ++N +   IP S+     +  +SA D D   N  I+Y        +     ++ ++  +G + L  ++   M  +H + +  +D G  ++   C+  +  I +N +      VP++    V EN+  GT +  +   +     +A  +  +   + +L  +  + G   +     +D E      L  +  +    E   +  V I +   ++  P F    +   ++E     T V  +   D D+G + +V Y I   S ++ F I+   G +  +  L+   +    L + A +  +       E  + + +++ ND  P  S+    +++    P+G+ +T ++A DSD     S         N+    ++   +G+I ++  L    +  +   ++ VD    S+T  A + + +ED N++ P+L    G V+    + + G+ ++ L + D DL  N G   + L+ST P
Sbjct: 1254 EERQFAIDSFSGQVTLVGKLDYEATSAYSLLIQAVDSGAIPLNSTCTLSIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGVNADLHYTITGSNNHGTFSISPNTGS-------IFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMSVVIQVRDFNDNPPSFPPGDIFKSIVENIPLGTSVISVTAHDPDADINGQLSYAIIQQMPRGNHFSIDEVKGTIYTSAEIDREFANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFISQNALAADPSAMIGSVLTTIMAADPDEGANGEVEYEILNGDTDTFTVDRYSGDLRVASALVPSQLI----------YNLIVSATDLGPERRKSTTE-LTVILQG--LDGPVFTQTKY-----ITILKEGEPIGTNVISIEAASPRGSEAPVEYYIVSVRCEEKTVGRLFTIGRQTGVIQTAAILDREQGACLYLVDVYAIEKSSAFPRTQRAEVEITLQDINDNPPVFPTDTLDLTVEENIGDGSKIMQLTAMDADEGANALVTYALISGADDSFRIDPESGDLIATKRL--DREHRSKYSLLVRADDGLQSSDMRI-----------NITISDVNDHTPRFSRPVYSFDIPEDTTPGSLVAAILATDDD---SGVNGEISY-VVEEDDGDGVFFLNLVTGVFNLTRALDYETQQYYILTVRAEDGGGQSTTIRAYF-----NILDVNDNPPVFSMSSYSTSLMENLPLGSTVLVFNVTDADDGVNSQLSYSI-ASGDSLGQFAVD-KHGVLKTLKALDRESQSFYNLVIQVHDLPQPPTSRFTSTAQVSIILLDVNDNPPMFLSPKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPS-GNKFSIGTIDGEVHLTGELDREEVSNYSLTVVATDKGQPPLSSSTEVVVMVLDINDNNPVFAQAMYRVQIKENILTGTDIIQVSAADNDEGTNGQVRYGI-----VGGNTHQEFRIDSVTGAITVAKSLD-RETTPA--YTLTVQATDRGS-SPRTDSCTVAITLLDMNDFVP------VFELSPYSVNVPENLGTLPRAILQVVARDDDQGPNSQLSY---VLLGGNEDNAFVLTASGELRVTQSLDREARDHFVLVVTAADAGSPALTGTGTINIIVDDINDN-------VPTFANNMYLTSIAEDARTGTDVLLVNASDADAAANAVISYSI---IGGNSQFTINPSTGQIITSALLDRETKDNYTLVVVASDAGSPESLSSSTSVLVTITDVNDNPPRFQHHPYVTH-IPSPTPPGSFVFAVTVTDADIGSNSELHYSLSGRNSEKFHIDPLRGAIMAAGPLSGASEVTFSVHV--KDGGSFPKTDSTTVTVRFANKADF--PKVRAKEQTFM-FPENQPVGTLVTTITGSSLRGETLSYYIASGNLGDTFQIDPLTGQVSISQPLDFE---KIQKYVVWIEARDGGFPPFSSYEKLDITVLDINDNAPTFEEDPFVSEILENLSPR----KILTVSATDKDSGPNGQLDYEIVNGNQESSFTINHATGEIRSIRPLDREKISHYELTVKSSDKGSPSQSTSVKVIISILD-ENDNAPRFSQIFSAYVSE--NSPLGYTVTRVTTSDEDIGINAISRYSIVDTSLP--FTINPNTGDIVISRPLNRED---TDRYRIRV---SAHDSGWTVSTDVTIFVTDINDNTPRFSRPSYYLDCPELPELGSRVTQVSATDPDEGSNGQVFYFIKSQS--EYFRINATTGEIFNKQVLKYQNVSGFSNVNINRHSFIVTASDRGNPSLLSETTVTINTVDSNDNPPQFLQNKYFTPVTKNVKVGTKLIKVTAVDDKDFGLNSEVEYFVSDGNHLGKFKLDNDTGWISIASSLVSDLNQNFLIRVTAKDKGNPPLSSQ---AVVHITVTEENYHTPEFSQNHISATIPESHSIGSVVRTVSARDRDTAMNGLISYNI-----ISGNEEGIFAINSSTGVVTLAKALDYEMSSKHEMTISATDGGWVARTGYCSLTVSVIDVNDNSPV--FVPDEFFPTVMENAPSGTTVIHLNATDADSGANAVIAYTVQSSDSDLFVIDPNMG--VITTQGFLDFETKQSYHLTVKAFNVPDEEKCSFATVDIQLKGTNEYVPRFVSKLYYFEVSEAASRGTAVGEVFASDRDMGADGEVHYLIFGNSRKKGFQINKMTGQIYVSGLLDREKEERVSLKVLAKNFGNIRGADIDEVTVNITVLDANDP-PVFSLSTYRVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTSGLDRESLPVYNLTVLAVDSGTPSATGSASLVVTLEDINDNGPVLTVSEGEVLE---NKRPGTLVMTLQSTDPDLPPNQGPFNYYLLSTGP 3555          

HSP 4 Score: 187.578 bits (475), Expect = 2.419e-46
Identity = 376/1670 (22.51%), Postives = 707/1670 (42.34%), Query Frame = 2
Query: 3014 FEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQC--------FYIE---KLSKNTFVIRVKSLETINSYFEPLNVMLIAT-DRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSL--SCAQNVKIRIFVSDLGFPKMTSSVDTLLKPL------------YEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQ-------LILLKDNLNVKNV-HYSLNVVFNKKN-------LFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRLK---NLEVVYSIKQPEK--YFVINPVTGQLVTFRM--FDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDG--IFMINGDSGEIHLVSS---PRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFL-TVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKL-SCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHF-----SLKVLENSPGGTVLGRINIVKP--PVNSEIFYVL--NPGHSHIQINTTTGELRTNGPLHLELVEF-IELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIV-PEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDK-----IILWTQVSCGGS---EIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDT--NRPVGSFITKITAKDSDGPDGISYRIRHRKLT--NQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDAR---FSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDE-PQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLD--SDKAIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKNSFRYS-----YYLISVAPEQ 7753
            F IN +TG L   ++++   S PS ++NL+V+ S   P  P  TEV + VR  D N+++P+    ++        +  + G+      D   + +I  +    H Y+         F ++     S     + + S   ++    P   +L+   D+G P +   + + +   + N NPP  V    H Q       + GS +  V A D D+G N+   Y ++   D      +D  TGLIT +  L     +   + +  +D G P +T   +  ++ L            Y P +  +         + +++Q G VV  L +   +  A    IS     + G     F+ Q+       LI +   L+ + +  Y+L V  +  +       + + SS   + + VN +    P+F +   + + + E +P GS+V+  +        N  + YSI       +F I+  +G + T      DRE  +QI   +      V +PK+ +   L+V + D ND +P    P    V +         +  + ATD D G N  + + +  + +   +F ++  SG +   SS      + Y L++   D G  P+S +   ++    I   S + +     +          G  +  +S +      N  ++Y + AG  ++ F +   +G + T+ ++ REE       Q+ VV     +    +   + + +    +NPP FS++ +   + E+ A+   + +V A   DL     I Y +          ++P TG+L + S ++  E++ Y LKI+A  S G  TG    T V I V++     L  NA HF     S+  +EN   G  + +   V P   VN  + Y L  NP  +   IN   G +   G L +    + +E+          + SI  T     V + D+NDN P+  +   ++ +  S        K+ A+D D  +N    +  +D      + ++      G L++KS +   ++ R+ L V+ SD  V     TV + + L   +    +       F  +E    G+F+G++  V+     + +      V      LH  TG+I   +  K DRE + +     +  +T  +        ++    V +++ D++DN P F ++ + A ++E     T V+R++  D D G N  + Y I   + + +F ID+ +G V     L++   S Y L+I+A    +  + + C L++ I++ ND  P  S P   L +D   N  +G  ++ +TA DSD   G++  + H  +T  N     +++ ++G IFL++KL       ++ +I   D      SST  + I V D N++ P         ++  ++  G+ ++ + A D D   NG++++ ++   P       D     ++   E  +E  + + L ++  D A+  + R  ++  +T+L+       P  I  ++  +    S   GS +T  +  D D  ++  + Y+I N    ++   +D  SGDL +  +L  S Q  + LIV+   +G   + ++  L+V ++  + GP     KYIT+      + +   I +N++ ++  S R S     YY++SV  E+
Sbjct:   81 FAINSSTGALYTTATID-RESLPSDVVNLVVLSSS--PTYP--TEVRVLVR--DLNDNAPVFPDPSIV-----VTFKEDSGSGRQVILDTATDSDIGSNGVDHHSYRIVSGNEAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPP--VFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQ---DEGTPFQMDPETGLITVREPLDFEARRQYSLTVQATDRGVPSLTGRAEAFIQLLDVNDNDPVVKFRYFPATSRYAS-------VDENAQVGTVVALLTVTDADSPAANGNIS--VQILGGNEQRHFEVQRSKVPNLSLIKVASALDRERIPSYNLTVSVSDNSGAPPTAEVQARSSVASLVIFVNDINDHPPVFEQQVYR-VNLSEEVPPGSYVSGVSATDGDSGLNANLRYSIVSGNGLGWFHISEHSGLVTTSAAGGLDRELASQIVLNISARDQGV-HPKV-SYAQLVVTVLDVNDEKPVFSQPEGYEVSVVENAPTGTELLVLGATDRDLGDNGTVRFSLQEAENDQRLFRLDPVSGRLSTASSLDREEQAFYCLSILATDLGSPPQSSTAQVNVSLLDINDNSPVFYPVQYFAHIQE--NEPGGSYVTTVSATDPDMGPNGTVKYSISAGDRSR-FQIHAKSGVISTKMALDREE---KTAYQLQVVATDGGNLQSPNQAIVTVTVLDTQDNPPVFSQAAYSFVVFENVALGYHVGSVSATTMDLN--ANISYLITTGDQRGMFAMNPVTGQLTTASVIDREEQSFYQLKIVA--SGGAVTGD---TVVNITVKD-----LNDNAPHFLQAVESINAVENWQAGHSIFQAKAVDPDEGVNGRVLYSLKQNP-KNLFTINEQNGNISLLGALDVHAGSYQVEIVASDMGVPQLSSSILLT-----VYVHDVNDNPPVFDQISYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTITDGNNGDAFGIF----PDGQLYIKSELDRELQDRYVLLVVASDRAVEPLSATVNVTVLLEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYAFEVTQPNFELHAVTGEI--TSTHKFDRESLMRRRGTAVFSFTVTAMDRGLPQPLKDQATVHVYMKDINDNAPKFLKDFYQATVSETATNLTQVLRVSASDVDEGSNGLIHYSILKGNEERQFAIDSFSGQVTLVGKLDYEATSAYSLLIQAVDSGAIPLNSTCTLSIDILDENDNTP--SFPKSTLFVDVLENMRIGELVSSVTATDSD--SGVNADL-HYTITGSNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMSVVIQVRDFNDNPPSFPPGDIFKSIVENIPLGTSVISVTAHDPDADINGQLSYAIIQQMPRGNHFSIDEVKGTIYTSAEIDREFANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFISQNA--LAADPSAMIGSVLTTIMAADPDEGANGEVEYEILNGD--TDTFTVDRYSGDLRVASALVPS-QLIYNLIVSATDLGPERRKSTTELTVILQGLD-GPVFTQTKYITI------LKEGEPIGTNVISIEAASPRGSEAPVEYYIVSVRCEE 1674          

HSP 5 Score: 175.637 bits (444), Expect = 9.957e-43
Identity = 598/2828 (21.15%), Postives = 1133/2828 (40.06%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKNVQIKIL------DVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNV-----YLRKSLDFEKSK---SHHISIGVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDAISTSF-DLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEIDSTILNENQHVTFVKTTKRLPTKPIFIFKIFVLNN--LFKINETTGEILSKRSIDCGK---YFFNVSMLSLKTNSLIDQTKLEIVVKSGRKLPLYFDRG--FRKILVTTGKSQCFSEIAVRNRHCGMRIQYSYDLL--LKTDGILRINE-HGALCTAENVKHNKLMSTRYLYQIKALDETNSSAVCVVLFAIQPSKVFDVLPTEINITLPIIDSPKFNFSLP---IGKIIGTFSKLPPAQFI-GFIQYHLVPEELSTGAITVDSQSGEILMKKFPIHKNPI-RLIVKSVIRKPF---NVSPLNIVAINFQKLFFARSLYQFILTKSE-IKGNLVKIGQVSMDSSCTESVSYDLFGVKNDHSH----FTIDVATGVIYGKDLGSISNKTLMFQVSAKAPKSQTSF-----AQVIIYIED-GIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSDE-------YQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPIL-ISTNVFYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKS---SVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLS--GSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVKIRIFVSDLGFPKMTSSVDTLL--------KPLYEPKSEEFLINKNL---TFIIP------DHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLH--LRFDS-QQLILLKDNLNVKNV-HYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGS----HVASFNIRRLKNLEVVYSI--KQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEI---HLVSSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENP-PRFSRSIFKVKLPEDEAITNFLTVVANDPDLG--IFGRIIYSLEGDTFDKKIFIDPSTGKLSCS-PLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLEN-SPGGTVLGRINIVKPPVNSEIFYVLNPGH--SHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNG--VPSKCTTVLIDISLNQDH----QYVQIVPE-----KAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVFLHESTGKIF---------VAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLT-VYDPDIGFNSQVEYFIEFYSSQEEFLIDAN-GDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSD-GPDG-ISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARF---SSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVST-------SPWFGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAID-PQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVC--KDLDSDKAIFYKIDNFHPISNNLYLDFE----SGDLYLTKSLNYSIQPRFLLIVTCAIVGS--PEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKNSF----RYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESRIWNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHDIQYFLTPHENFELTCSQ-----SQSSGCNIKSKSVLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDE 8269
            F I++  G I + G +D    + Y   I++ +     +   IL      DVNDN P F+  ++E ++ E+ P+ S+       D D G N   +  I  G++   F I + D        +L +K  LD E+  ++ L++ A D    PL A++ V +++++ NDN P F+ + Y    +E+Q       +V A D D G +GE+ Y  + T P+ +   V   TG +     + R+SL   +     S  ++   R    P        +      ++ P  ++  +   +SE   ++   T V  V  +D D  S       IL  +  +   I     ++ L+  +    +++ +L ++AVD     L++T  L+I I +      SF  S   V++   +       +   T           + I   NN   F I+  TG I   + +D      Y  N++              + I V+     P  F  G  F+ I+           +   +    +  Q SY ++  +       I+E  G + T+  +  ++  +  +   +KA D+  +  +    +A+   K   +L T++N  +P+  S     + P   IG ++ T     P +   G ++Y ++  +  T   TVD  SG++ +    +    I  LIV +    P    + + L ++        F ++ Y  IL + E I  N++ I   S   S    V Y +  V+ +       FTI   TGVI    +        ++ V   A +  ++F     A+V I ++D   + P F    L + + EN   G +IMQ+       +DE       Y +I S   D   I  ++G +   K+ DRE  S   + V+  + + S+ + +++ I D+ND+ P       +F   + ++ G +   +  +D DS  NG +SY   +++    +  F +N  TG   +  +L+           +L + +++G  +   T +     I+D N++ P+  +S+    + +    G+ V    + D D G N ++  S+        F ++   K+  +  +K+L+  +  F   N+++   D   P  S   S   + I  ++ N NPP  + PK     + + P  +   + +F   A DPD G NS   Y++     N+  I        +T ++      N  + +  +D G P ++SS + ++         P++        I +N+   T II       D    G V          YG            V G  H   R DS    I +  +L+ +    Y+L V    +     + +  + + +  +    P+F   SP  + + ENL +       V + +  +  N ++ Y +     +  FV+   +G+L   +  DRE  +   F + V A    +P +     + + + D NDN P   + +  +  I+        +  + A+DAD+  N+ ++Y I    +  F IN  +G+I    L+       Y L V   D+G      S    +   +    +  RF  +    ++  P     F+   ++ +      N ++ Y L +G+ ++ F +DP+ G++     +S    G SE+      +      S        + + + N+   P+          PE++ +   +T +      G  +   I     GDTF     IDP TG++S S PL+F +   Y + I A D  G       + K+ I V +   +   F    F  ++LEN SP   +           N ++ Y +  G+  S   IN  TGE+R+  PL  E +   ELT+ +  K   +   Q+TS  + + I+D NDN P  ++     ++  ++     +T+++ +D D   N   ++   D +       + ++  +G++ +   +      R+ ++V   D+G  V +  T  + DI+ N        Y    PE       + +V     D    GQ+    + K  S  F I           + +TG+IF         V+  + ++  +   I+  T    G   +     V I+  D +DN P F QNK+   + +     T +I++T V D D G NS+VEYF+   +   +F +D + G +     L       + + + A  K +P + ++  + + +   N   P+ S  + +  +  +  +GS +  ++A+D D   +G ISY I      N+     +   +G + L++ L      KHE  I   D  +   +    + + V D N++ P+   +     +  +   G+ +++L+A D D   N  + + + S+        P  G+      T   FL  E ++  H       LT  A + P +   S   + + LK    Y PR + +      + E+   G+ + +     +D+ +D  + Y I       N+    F+    +G +Y++  L+   + R  L V     G+     I    +++ +   N  P        T  +Q+ E +     ++ +   D +S     R+SY+ I    E      +P + QI  ++ L     D     ++NLT++ V +     +PS    +  L V +E     I +    + +    G + EN+ P T V+ L     D+     P   + L+        S S+   + +   +D E   ++ L ++ + S     S + T  V I+VLD ++
Sbjct:  940 FTINEQNGNISLLGALDVHAGS-YQVEIVASDMGVPQLSSSILLTVYVHDVNDNPPVFDQISYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTITDGNNGDAFGI-FPDG-------QLYIKSELDRELQDRYVLLVVASDRAVEPLSATVNVTVLLEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYAFEVTQPNFELHAV---TGEITSTHKFDRESLMRRRGTAVFSFTVTAMDRGLPQPLKDQATVHVYMKDINDNAPKFLKDFYQATVSETATNL---TQVLRVSASDVDEGSNGLIHYSILKGNEERQFAIDSFSGQVTLVGKLDYEATSAYSLLIQAVDSGAIPLNSTCTLSIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGVNADLHYTITGSNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMSVVIQVRDFNDNPPSFPPGDIFKSIVENIPLGTSVISVTAHDPDADINGQLSYAIIQQMPRGNHFSIDEVKGTIYTSAEI--DREFANLFELTVKANDQ--AVPIETRRYAL---KNVTILVTDLNDNVPMFISQNALAADPSAMIGSVLTTIMAADPDEGANGEVEYEILNGDTDT--FTVDRYSGDLRVASALVPSQLIYNLIVSATDLGPERRKSTTELTVILQGLDGPVFTQTKYITILKEGEPIGTNVISIEAASPRGS-EAPVEYYIVSVRCEEKTVGRLFTIGRQTGVIQTAAILDREQGACLYLVDVYAIEKSSAFPRTQRAEVEITLQDINDNPPVFPTDTLDLTVEENIGDGSKIMQLTAMD---ADEGANALVTYALI-SGADDSFRIDPESGDLIATKRLDREHRSKYSLLVRADDGLQSSDMRINITISDVNDHTPRFSRPVYSFDIPEDTTPGSLVAAILATDDDSGVNGEISY---VVEEDDGDGVFFLNLVTGVFNLTRALDYETQQ----YYILTVRAEDGGGQ--STTIRAYFNILDVNDNPPVFSMSSYSTSLMENLPLGSTVLVFNVTDADDGVNSQLSYSIASGDSLGQFAVD---KHGVLKTLKALDRESQSF--YNLVIQVHDLPQPPTSRFTSTAQVSIILLDVNDNPPMFLSPK-----LTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPSGNKFSIGTIDGEVHLTGELDREEVSNYSLTVVATDKGQPPLSSSTEVVVMVLDINDNNPVFAQAMYRVQIKENILTGTDIIQVSAADNDEGTNGQV---------RYGI-----------VGGNTHQEFRIDSVTGAITVAKSLDRETTPAYTLTVQATDRGSSPRTDSCTVAITLLDMNDFVPVFEL-SPYSVNVPENLGTLPRAILQVVARDDDQGPNSQLSYVLLGGNEDNAFVLT-ASGELRVTQSLDREARD--HFVLVVTAADAGSPALTGTGTINIIVDDINDNVP-TFANNMYLTSIAEDARTGTDVLLVNASDADAAANAVISYSI-IGGNSQFTINPSTGQIITSALLDRETKDNYTLVVVASDAGSPESLSSSTSVLVTITDVNDNPPRFQHHPYVTHIPSPTPPGSFVFA-VTVTDADIGSNSELHYSL-SGRNSEKFHIDPLRGAIMAAGPLS----GASEVT---FSVHVKDGGSFPKTDSTTVTVRFANKADFPKVRAKEQTFMFPENQPVGTLVTTITGSSLRGETLSYYIASGNLGDTFQ----IDPLTGQVSISQPLDFEKIQKYVVWIEARD--GGFPPFSSYEKLDITVLDINDNAPTFEEDPFVSEILENLSPRKILTVSATDKDSGPNGQLDYEIVNGNQESSFTINHATGEIRSIRPLDREKISHYELTVKSSDKGSPS---QSTSVKVIISILDENDNAPRFSQ-IFSAYVSENSPLGYTVTRVTTSDEDIGINAISRYSIVDTSLP-----FTINPNTGDIVISRPLNREDTDRYRIRVSAHDSGWTVSTDVTIFVTDINDNTPRFSRPSYYLDCPELPELGSRVTQVSATDPDEGSNGQV--FYFIKSQSEYFRI-----------NATTGEIFNKQVLKYQNVSGFSNVNINRHSFIV--TASDRGNPSLLSETTVTINTVDSNDNPPQFLQNKYFTPVTKNVKVGTKLIKVTAVDDKDFGLNSEVEYFVSDGNHLGKFKLDNDTGWISIASSLVSDLNQNFLIRVTAKDKGNPPLSSQAVVHITVTEENYHTPEFSQNHISATIPESHSIGSVVRTVSARDRDTAMNGLISYNIIS---GNEEGIFAINSSTGVVTLAKALDYEMSSKHEMTISATDGGWVARTGYCSLTVSVIDVNDNSPVFVPDEFFPTVMENAPSGTTVIHLNATDADSGANAVIAYTVQSSDSDLFVIDPNMGVI-----TTQGFLDFETKQSYH-------LTVKAFNVPDEEKCSFATVDIQLKGTNEYVPRFV-SKLYYFEVSEAASRGTAVGEVFASDRDMGADGEVHYLI-----FGNSRKKGFQINKMTGQIYVSGLLDREKEERVSLKVLAKNFGNIRGADIDEVTVNITVLDANDPPVF---SLSTYRVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYF-IGSGNENGAFSINPQTGQITVTSGL-----DRESLPVYNLTVLAVDS----GTPS-ATGSASLVVTLE----DINDNGPVLTVSE--GEVLENKRPGTLVMTLQSTDPDLPPNQGPFNYYLLSTGPATNYFSLSTAGVLSTTREIDREQIADFYLSVVTRDSGAPQMSSTGT--VHITVLDQND 3611          

HSP 6 Score: 159.458 bits (402), Expect = 6.671e-38
Identity = 475/2135 (22.25%), Postives = 838/2135 (39.25%), Query Frame = 2
Query: 2474 LMFQVSAKAPKSQTSFAQVIIYIED-GIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYPSVSDEYQI---IQSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQ-----LKNLIGSATXXXXXXXXXXXXXKP-----YCKNSKTNFTFEDLSSLGEMECPLKCSDADS-FPNGNLSYRMKIIKPVGMNNP--FEIN----PTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKP-LETEVEISVRII-----DANNHSPILISTNVFYIH--QTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLI-ATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHK-QMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNV--KIRIFVSDLGFPKMTSSVD---TLL-----KPLYEPKSEEFLINKN---------LTFIIPDHSQPGYV-----VGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRL---KNLEVVYSIKQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEIHLVSSPRVSA--YELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQ---RIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFL-TVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKLSC-------SPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINI--VKPPVNSEIFYVLNPGHSHIQ--INTTTGELRTNGPLHLELVEFIELTIHAF-AKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKP-----------------LTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFR-VKENSVDGTFIGQIKMVNYCKDHSAK--FSIIDGVNHELVF-LHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGS--EIRGY--KKVIIHXXXXXXNKPVF-SQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDA-NGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNIND----QRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDG-ISYRIRHRKLTNQTL--FLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFSST------AVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTS-PWFGLRGFDNNTAALFLIDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDS--DKAIFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESR-IWNLTIMIVKAQKYQNSPSNLYENG------YLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKL--------PEWYHDIQY-FLTPHEN-FELTCSQSQSSGCNIKSKSVLDFETHENYRLQLLI--KGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIV-ENPSENFGINNETGAIYI 8461
            L+ +V  K    +  + QV + ++D   + P F  S     + E+  VG  ++QV            I   +Q + + +  +  +TG I + +  D E      +TVQ     + +L G A  +  + +LD+NDN P     Y   +    + ++ + +G +   L  +DADS   NGN+S ++     +G N    FE+     P    + + S+L+     PS   NL V VSDN    P  E +   SV  +     D N+H P+     V+ ++  +    G+ V  +   D D G N  +  S+   +    F+I   S+++ ++   +   ++       V+ I A D+G   K S   LV+  ++ N   P    P+ ++  ++   P  +G+E+  + A D D G N    +S++ A +++    +D  +G ++T  SL   +     + I  +DLG P  +S+     +LL      P++ P      I +N         ++   PD    G V      GD + F     AK   IS           +  D ++              Y L VV          +   + V V     + P+FS+ +  F+ + EN+  G HV S +   +    N+  + +       F +NPVTGQL T  + DRE ++  Q  +      V+     TV+ + VK  D NDN P+ L    SI  +        SIFQ  A D D G N ++ Y +  +   +F IN  +G I L+ +  V A  Y++ +   D G    S S++ +++   +     +    +            S F   ++  S   S  N +I Y +  G     F + P  G +  +  + R      E+    V++    D ++  L     + + ++  N+N P F+ + +     E++   +F+  V A D D G  G + Y+ E         +   TG+++        S +      +++  + A D  GL    KD   V +++++   +   F    +   V E +   T + R++   V    N  I Y +  G+   Q  I++ +G++   G L  E      L I A  +  I   S  T S                     + I   N N P  P                 ++ ++ATDSD   N    +     T    +  + +   +G++FL   +    +  + L +   D G P + +T+ + I +   +      P   IF+ + EN   GT +  +   +   D + +  ++II  +     F + E  G I+   +A+IDRE  +   L  + +      E R Y  K V I V D++DN P+F SQN   A  +      + +  +   DPD G N +VEY I      + F +D  +GD++    L   ++ +Y+L++ A+        +   LTV +  ++     Q   I+I      L    P+G+ +  I A    G +  + Y I   +   +T+     +   +G +  +  +L  + G   + + V     SS       A +EI ++D N++ P+   +   + +  ++  GSKI+ L A+D D   N  VT+ L+S +   F +     +  A   +D  +E    Y L ++  D       R      + + +     + PR          IPE    GS +   +  D DS  +  I Y ++         +L+  +G   LT++L+Y  Q  ++L V     G   + T+      I   N  P +      + SL     +    ++ N+   D        Y I+      +       F +D   +L  +     ES+  +NL I +         P++ + +        L VN   P  +   L            I EN P  T V K         P  Y  I+Y  L P  N F +     +     +     LD E   NY L ++   KG        S +  V + VLD+++  P F    +   ++  I   G  +    A+D D G  G V Y IV  N  + F I++ TGAI +
Sbjct:  218 LLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTPF-QMDPETGLITVREPLDFEARRQYSLTVQATDRGVPSLTGRA--EAFIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQI-----LGGNEQRHFEVQRSKVPNLSLIKVASALD-RERIPS--YNLTVSVSDNSGAPPTAEVQARSSVASLVIFVNDINDHPPVF-EQQVYRVNLSEEVPPGSYVSGVSATDGDSGLNANLRYSIVSGNGLGWFHI---SEHSGLVTTSAAGGLDRELASQIVLNISARDQGVHPKVSYAQLVVTVLDVNDEKPVFSQPEGYEVSVVENAP--TGTELLVLGATDRDLGDNGTVRFSLQEAENDQRLFRLDPVSGRLSTASSLDREEQAFYCLSILATDLGSPPQSSTAQVNVSLLDINDNSPVFYPVQYFAHIQENEPGGSYVTTVSATDPDMGPNGTVKYSISAGDRSRF--QIHAKSGVIST---------KMALDREE-----------KTAYQLQVVATDGGNLQSPNQAIVTVTVLDTQDNPPVFSQAAYSFV-VFENVALGYHVGSVSATTMDLNANISYLITTGDQRGMFAMNPVTGQLTTASVIDREEQSFYQLKIVASGGAVTGD---TVVNITVK--DLNDNAPHFLQAVESINAVEN-WQAGHSIFQAKAVDPDEGVNGRVLYSLKQNPKNLFTINEQNGNISLLGALDVHAGSYQVEIVASDMGVPQLSSSILLTVYVHDVNDNPPVFDQISYEVTLSESEPVNSRFF--KVQASDKDSGANGEIAYTITDGNNGDAFGIFP-DGQLYIKSELDR------ELQDRYVLLVVASDRAVEPLSATVNVTVLLEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYAFE--VTQPNFELHAVTGEITSTHKFDRESLMRRRGTAVFSFTVTAMD-RGLPQPLKDQATVHVYMKDINDNAPKFLKDFYQATVSETATNLTQVLRVSASDVDEGSNGLIHYSILKGNEERQFAIDSFSGQVTLVGKLDYEATSAYSLLIQAVDSGAIPLNSTCTLS---------------------IDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGVNADLHYTI---TGSNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMSVVIQVRDFNDNPPSFPPGDIFKSIVENIPLGTSVISVTAHDPDADINGQLSYAIIQQMPRGNHFSIDEVKGTIYT--SAEIDREFANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFISQNALAA--DPSAMIGSVLTTIMAADPDEGANGEVEYEI-LNGDTDTFTVDRYSGDLRVASAL-VPSQLIYNLIVSATDLGPERRKSTTELTVILQGLDGPVFTQTKYITI------LKEGEPIGTNVISIEAASPRGSEAPVEYYIVSVRCEEKTVGRLFTIGRQTG-VIQTAAILDREQGACLYLVDVYAIEKSSAFPRTQRAEVEITLQDINDNPPVFPTDTLDLTVEENIGDGSKIMQLTAMDADEGANALVTYALISGADDSFRIDPESGDLIATKRLD--REHRSKYSLLVRADDGLQSSDMR------INITISDVNDHTPRF-SRPVYSFDIPEDTTPGSLVAAILATDDDSGVNGEISYVVEE-DDGDGVFFLNLVTGVFNLTRALDYETQQYYILTVRAEDGGG--QSTTIRAYFNILDVNDNPPVFSMSSYSTSLMENLPLGSTVLVFNVTDADDGVNSQLSYSIASGDSLGQ-------FAVDKHGVLKTLKALDRESQSFYNLVIQV---HDLPQPPTSRFTSTAQVSIILLDVNDNPPMFLSPKLT----------YIPENTPIDTVVFKAQATDPDSGPNSY--IEYTLLNPSGNKFSIGTIDGE-----VHLTGELDREEVSNYSLTVVATDKGQ----PPLSSSTEVVVMVLDINDNNPVFAQAMYRVQIKENI-LTGTDIIQVSAADNDEGTNGQVRYGIVGGNTHQEFRIDSVTGAITV 2213          

HSP 7 Score: 134.806 bits (338), Expect = 2.128e-30
Identity = 118/405 (29.14%), Postives = 205/405 (50.62%), Query Frame = 2
Query:  119 IFSIKENVPIGEVVGQIES-PGFSPPF-EMHDFQEKKFIISKTTGVIKVSGLIDREK--QNLYSFLIISMNGDTKNVQIKIL--DVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSI--QSVRIVSGDSEKVFAID--YHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFL-DNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQILW---TGGLSEINRDISPNTIVAHVKLTDYD--AISTSFDLEILNRSPFQLIKI----LPKMWELKLINDIGNYKSNSINLTLKAVD 1273
            +F + E  P G +VG I + PGF+    E H      F I+ +TG +  +  IDRE    ++ + +++S +  T   ++++L  D+NDN P F   +   +  E+   G +V L T  D D G N +   S RIVSG+    F +D   + S  G F + L+ K  LD E+  Q+ L+++  D G P  +  L V + VQ+ NDN P F  S Y A + ED  +  + L+V A D D G + ++ Y L D  +P    F +D +TG + +R+ LDFE  + + +++   D   P  T +    I ++D+NDN P ++  +   T   + ++ +    T+VA + +TD D  A + +  ++IL  +  +  ++    +P +  +K+ + +   +  S NLT+   D
Sbjct:   48 VFQVMEEQPPGTLVGTIPTRPGFTYRLSESHAL----FAINSSTGALYTTATIDRESLPSDVVNLVVLS-SSPTYPTEVRVLVRDLNDNAPVFPDPSIVVTFKEDSGSGRQVILDTATDSDIGSNGVDHHSYRIVSGNEAGRFRLDITLNPSGEGAF-LHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTP----FQMDPETGLITVREPLDFEARRQYSLTVQATDRGVPSLTGRAEAFIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQRSKVPNLSLIKVASALDRERIPSYNLTVSVSD 442          

HSP 8 Score: 121.709 bits (304), Expect = 1.856e-26
Identity = 89/310 (28.71%), Postives = 148/310 (47.74%), Query Frame = 2
Query:  104 NSNLLIFSIKENVPIGEVVGQIES--PGFSPPFEMH---DFQEKKFIISKTTGVIKVSGLIDREK------QNLYSFLIISMN-------GDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTS 979
            NS    F  +E    G  VG++ +    F P  E+    +  +  F +   TG I  +   DRE         ++SF + +M+        D   V + + D+NDN PKF    ++ ++ E     ++V   +  D DEG N +    I+ G+ E+ FAID        F  ++ L   LDYE  S ++L+IQA+D G  PL ++  + I + + NDN P F  S     + E+  I      V ATD+D+GV+ +L Y +  ++ +   F++   TG+++L K LDFE    + ++I  +D   P  +S
Sbjct: 1101 NSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYAFEVTQPNFELHAVTGEITSTHKFDRESLMRRRGTAVFSFTVTAMDRGLPQPLKDQATVHVYMKDINDNAPKFLKDFYQATVSETATNLTQVLRVSASDVDEGSNGLIHYSILKGNEERQFAIDS-------FSGQVTLVGKLDYEATSAYSLLIQAVDSGAIPLNSTCTLSIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGVNADLHYTITGSN-NHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSS 1402          

HSP 9 Score: 119.398 bits (298), Expect = 8.670e-26
Identity = 90/267 (33.71%), Postives = 139/267 (52.06%), Query Frame = 2
Query:  203 HDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKNVQIK----ILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPP---LQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD-NSPPFHTS 979
             D  +  F ++  TGV  ++  +D E Q  Y   + + +G  ++  I+    ILDVNDN P F+ +++  S+ EN P+GS V +  V D D+G NS  S  I SGDS   FA+D H    G+    L   ++LD E  S +NLVIQ  D   PP     ++  V II+ + NDN P F +S  +  I E+  I+    + +ATD D+G +  + Y L N  PS + F++    G V+L   LD E+  ++ +++   D   PP  +S
Sbjct: 1882 EDDGDGVFFLNLVTGVFNLTRALDYETQQYYILTVRAEDGGGQSTTIRAYFNILDVNDNPPVFSMSSYSTSLMENLPLGSTVLVFNVTDADDGVNSQLSYSIASGDSLGQFAVDKH----GV----LKTLKALDRESQSFYNLVIQVHDLPQPPTSRFTSTAQVSIILLDVNDNPPMF-LSPKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLN--PSGNKFSIGTIDGEVHLTGELDREEVSNYSLTVVATDKGQPPLSSS 2137          

HSP 10 Score: 109.768 bits (273), Expect = 7.611e-23
Identity = 88/298 (29.53%), Postives = 147/298 (49.33%), Query Frame = 2
Query:  128 IKENVPIGEVVGQIESP---GFSPPFEMH----DFQEKK----FIISKTTGVIKVSGLIDREKQN-LYSFLIISMNGDTK-------NVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQAS-LLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNS 961
            +KE  PIG  V  IE+    G   P E +      +EK     F I + TGVI+ + ++DRE+   LY   + ++   +         V+I + D+NDN P F     + ++ EN   GSK+   T  D DEG N++ +  ++SG ++  F ID            LI  + LD E  S+++L+++A DG    LQ+S + + I + + ND+ P+F    Y   I ED         + ATD+D+GV+GE+ Y ++       FF ++  TG   L ++LD+E  + + +++   D  
Sbjct: 1638 LKEGEPIGTNVISIEAASPRGSEAPVEYYIVSVRCEEKTVGRLFTIGRQTGVIQTAAILDREQGACLYLVDVYAIEKSSAFPRTQRAEVEITLQDINDNPPVFPTDTLDLTVEENIGDGSKIMQLTAMDADEGANALVTYALISG-ADDSFRIDPESGD-------LIATKRLDREHRSKYSLLVRADDG----LQSSDMRINITISDVNDHTPRFSRPVYSFDIPEDTTPGSLVAAILATDDDSGVNGEISYVVEEDDGDGVFF-LNLVTGVFNLTRALDYETQQYYILTVRAEDGG 1922          

HSP 11 Score: 100.138 bits (248), Expect = 6.458e-20
Identity = 84/308 (27.27%), Postives = 145/308 (47.08%), Query Frame = 2
Query:  107 SNLLIFSIKENVPIGEVVGQI--ESPGFSPPFEMH-----DFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNG--------DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKN-SIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVS-GELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPPFHTS 979
            S L  F + E    G  VG++           E+H     + ++K F I+K TG I VSGL+DREK+   S  +++ N         D   V I +LD ND  P F+ + +   I E  PIG+ V   + FD D   + S  S  I SG+    F+I+           ++ +   LD E +  +NL + A+D G P    S  + + +++ NDN P   +S     + E++      + +++TD D   + G   Y+L +T P++++F++    G +   + +D E+    ++S+  RD+  P  +S
Sbjct: 3302 SKLYYFEVSEAASRGTAVGEVFASDRDMGADGEVHYLIFGNSRKKGFQINKMTGQIYVSGLLDREKEERVSLKVLAKNFGNIRGADIDEVTVNITVLDAND-PPVFSLSTYRVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTG-------QITVTSGLDRESLPVYNLTVLAVDSGTPSATGSASLVVTLEDINDNGPVLTVSE--GEVLENKRPGTLVMTLQSTDPDLPPNQGPFNYYLLSTGPATNYFSL-STAGVLSTTREIDREQIADFYLSVVTRDSGAPQMSS 3598          

HSP 12 Score: 98.2117 bits (243), Expect = 2.406e-19
Identity = 76/273 (27.84%), Postives = 131/273 (47.99%), Query Frame = 2
Query:  122 FSIKENVPIGEVVGQIESPGFSPPFEMHDF-----QEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKN---VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFE 916
            F + ENV +G  VG + +        +        Q   F ++  TG +  + +IDRE+Q+ Y   I++  G       V I + D+NDN P F       +  EN+  G  +      DPDEG N  + +  +  + + +F I+  + +       + L  +LD    S + + I A D G P L +S+L+ + V + NDN P FD   Y  ++ E + +N  F +V+A+D D+G +GE+ Y + + + + D F +    G +Y++  LD E
Sbjct:  800 FVVFENVALGYHVGSVSATTMDLNANISYLITTGDQRGMFAMNPVTGQLTTASVIDREEQSFYQLKIVASGGAVTGDTVVNITVKDLNDNAPHFLQAVESINAVENWQAGHSIFQAKAVDPDEGVNG-RVLYSLKQNPKNLFTINEQNGN-------ISLLGALDVHAGS-YQVEIVASDMGVPQLSSSILLTVYVHDVNDNPPVFDQISYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTITDGN-NGDAFGI-FPDGQLYIKSELDRE 1061          

HSP 13 Score: 78.5666 bits (192), Expect = 1.850e-13
Identity = 86/309 (27.83%), Postives = 132/309 (42.72%), Query Frame = 2
Query:  125 SIKENVPIGEVVGQI-----ESPGFSPPFEMHDF---QEKKFIISKTT----GVIKVSGLIDREKQNLYSFLI-ISMNGD---TKNVQIK---------ILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGG-HPPLQASLLVKIIVQNANDNVPKFDISR-YIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD-NSPP 967
            S+ EN  +G VV  +     +SP  +    +      +++ F + ++      +IKV+  +DRE+   Y+  + +S N     T  VQ +         + D+ND+ P F    +  ++ E  P GS V   +  D D G N+     IVSG+    F I  H        V       LD E+ SQ  L I A D G HP +  + LV + V + ND  P F     Y  S+ E+       L + ATD D G +G + + L         F +D  +G +    SLD E+   + +SI   D  SPP
Sbjct:  366 SVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQRSKVPNLSLIKVASALDRERIPSYNLTVSVSDNSGAPPTAEVQARSSVASLVIFVNDINDHPPVFEQQVYRVNLSEEVPPGSYVSGVSATDGDSGLNANLRYSIVSGNGLGWFHISEHSG-----LVTTSAAGGLDRELASQIVLNISARDQGVHPKVSYAQLV-VTVLDVNDEKPVFSQPEGYEVSVVENAPTGTELLVLGATDRDLGDNGTVRFSLQEAENDQRLFRLDPVSGRLSTASSLDREEQAFYCLSILATDLGSPP 668          

HSP 14 Score: 77.411 bits (189), Expect = 4.727e-13
Identity = 63/249 (25.30%), Postives = 107/249 (42.97%), Query Frame = 2
Query:  215 EKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMN------GDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISI 943
            ++ F +   +G +  +  +DRE+Q  Y   I++ +        T  V + +LD+NDN P F    +   I EN P GS V   +  DPD G N      I +GD  + F I    + +G+   ++    +LD E  + + L + A DGG+       +V + V +  DN P F  + Y   + E+  +      V AT  D   +     +L  T      F ++  TG +     +D E+   + + I
Sbjct:  629 QRLFRLDPVSGRLSTASSLDREEQAFYCLSILATDLGSPPQSSTAQVNVSLLDINDNSPVFYPVQYFAHIQENEPGGSYVTTVSATDPDMGPNGTVKYSISAGDRSR-FQI---HAKSGVISTKM----ALDREEKTAYQLQVVATDGGNLQSPNQAIVTVTVLDTQDNPPVFSQAAYSFVVFENVALGYHVGSVSATTMDLNAN---ISYLITTGDQRGMFAMNPVTGQLTTASVIDREEQSFYQLKI 866          

HSP 15 Score: 66.6254 bits (161), Expect = 7.323e-10
Identity = 76/294 (25.85%), Postives = 124/294 (42.18%), Query Frame = 2
Query:  125 SIKENVPIGEVVGQIESPGFSPPFEMHDF----------QEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDT----------KNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLD---NTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHI 937
            SI EN+P+G  V  I      P  +++            +   F I +  G I  S  IDRE  NL+  L +  N             KNV I + D+NDN P F + N   + P    IGS +      DPDEG N      I++GD++  F +D +   +G   V   L  S   ++I  +NL++ A D G    +++  + +I+Q  +   P F  ++YI  +KE + I    + + A       +   +Y +            FT+  +TG +     LD E+    ++
Sbjct: 1428 SIVENIPLGTSV--ISVTAHDPDADINGQLSYAIIQQMPRGNHFSIDEVKGTIYTSAEIDREFANLFE-LTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFISQNALAADPSAM-IGSVLTTIMAADPDEGANGEVEYEILNGDTD-TFTVDRY---SGDLRVASALVPS---QLI--YNLIVSATDLGPERRKSTTELTVILQGLDG--PVFTQTKYITILKEGEPIGTNVISIEAASPRGSEAPVEYYIVSVRCEEKTVGRLFTIGRQTGVIQTAAILDREQGACLYL 1706          

HSP 16 Score: 55.0694 bits (131), Expect = 2.576e-6
Identity = 82/396 (20.71%), Postives = 155/396 (39.14%), Query Frame = 2
Query: 5981 PSKCTTVLID--ISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAKFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQE------EFLIDANGD-----VKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDD---ARFSSTAVIEIDVEDKNNHVPILK-----ENGRVINLSSSLKRGSKILYLHAIDKDL-RDNGKVTFELVS 7102
            PS C  + +   +SL      VQ   ++ +F+V E    GT +G I            F+     +H L  ++ STG ++  A   IDRE +   ++   V           +V++   +   N PVF     V    E       VI  T  D DIG N    +     S  E      +  ++ +G+     + +   L+      Y L+++   K  P      ++ V + +IND  P     +    +  +  VGS + ++ A D+D  +G +  IR+R L ++     +  ++G I +   L      ++   +   D      +  A   I + D N++ P++K        R  ++  + + G+ +  L   D D    NG ++ +++ 
Sbjct:   19 PSLCQLLRVWGLLSLLPGSARVQAAEQRQVFQVMEEQPPGTLVGTIPT-------RPGFTYRLSESHALFAINSSTGALYTTAT--IDRESLPSDVVNLVVLSSSPTYPTEVRVLVRDLND--NAPVFPDPSIVVTFKEDSGSGRQVILDTATDSDIGSNGVDHHSYRIVSGNEAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADAD--EGTNADIRYR-LQDEGTPFQMDPETGLITVREPLDFEARRQYSLTVQATDRGVPSLTGRAEAFIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILG 400          
BLAST of Dachsous vs. Ensembl Mouse
Match: Dchs1 (dachsous cadherin related 1 [Source:MGI Symbol;Acc:MGI:2685011])

HSP 1 Score: 262.692 bits (670), Expect = 3.822e-69
Identity = 426/1907 (22.34%), Postives = 779/1907 (40.85%), Query Frame = 2
Query: 2999 GMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNVFY-IHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQ-PHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHK------QMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVKIRIFVS--DLGFPKMTSSVDTLLKPLYEPKSEEF--LINKNLTFIIP--------DHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVD--GFLHLRFDSQQLILLKD-NLNVKNVHYSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIRRL----KNLEVVYSI---KQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVK-IADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEIHLV---SSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLTVVANDPDLGIFGRIIYS-LEGDTFDKKIFIDPSTGKL-SCSPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKP--PVNSEIFYVLNPGHSHI-QINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRSIQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNS----NQPQKPLTKLSATDSDKTSN--ITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIVSDNGVPSKCTTVLIDISLNQDHQYVQIVPE---KAIFRVKENSVDGTFIGQIKMVNYCKDHSA-KFSIIDGVNHELVFLHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVIIHXXXXXXNKPVFSQNKFVAFLNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEF-YSSQEEFLID-ANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNINDQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFSSTAVIEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRDNGKVTFELVSTSPWFGLRGFDNNTAALFLIDEPQEKGH--PYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKAIFYKIDNFHPISNNLYLDF-------ESGD-----------LYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQIEKENKGPNLIDNKYITLSLQVPEMIQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESRIWNLTI-----MIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHDIQYF---------LTPHENFELTCSQSQSSGCNIKSKSVLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIVENPSENFGINNETGAIYIK 8464
            G ++PF +   +G L + ++L+   S     + ++ +               + V I++ N+HSP L     F  + +    GT VG +   D D G NG +  SL+Q     + F I   +     ++    E  +S+     +++   D GSP +S+   + +  ++ N N P  +            Q+    P   G+ + T+ A DPD+G N    Y+  L     +  ++   TG + T  SL  A+     + +S  D G P  ++S+  L++ L   +  E   LI  +    +P        +  +PG ++G  ++ P+   +  +         D  G   L   S +L L +  +        +L V        + +  L + V V       P F++D P  L + EN   G+ + +F          N EV Y +   + P     ++  TG L   R  DRET   +   VE      +  +           + DENDN P   SPS   VR+        +   +VA D D G  ++++Y++    DG F ++  +G + +V      + + + L V   D G  P+S + + ++    +  ++   F     ++ L    S  G  +  L  +      N  + Y  ++G   + FS+DP TG + T  ++ REE    E + + V  +      +     + + ++  N++ P F  +   +++PE +      T+ A+DPD G+ G++ Y  L+GD+      +D ++G+  +  PL+   +  + L+I A D  G          V + V +   H   F    +S++V E++P GT+L ++    P    N  + Y L  G +    +  T+GEL T   L  E       ++ A     +   + TT  I        +     P  +P+++ +P      N+P   L  L A D D  +N  I Y+   + P   T+      D  +G + +  S ++       L ++ +D G P++  T ++ + +  + +     P    +A+ R  EN+  GT +   K V+    +    +SI+ G    +  +  STG I V +A  +D E   ++ L  Q   GG+    +  + + + D +DN P F +  +VAFL E +P + P++++   D D G   Q+ Y +     ++  F +D A G + T   L+    +   LV+ A+ + SP +     LTV +++ ND RP I  P   L++  +  +GS I ++T  D D    + Y +      +     ++    G + L+  L       +   ++  D      A + + VED N++VP   ++   + +      GS IL + A D+D   NG +++ L   SP  G R  D N   LF        GH  P  + + L         R      + V LK    + P     H   + + E L  GS +      D D  +   +   ++  IS N    F       E GD           L L + L++    ++ L V  A  G P + ++  ++V +   N  P +      +  + VPE +   A + ++   D +   +     +++   P  +     F++D +      +G L  SR  +        ++V+A      P+  +   +  V + V  + + +      +  L+  + EN+PP T V  L     D   F           P        S + S+G  ++++   D+E   ++RL +    +     + S ++ V + +   DEY P F+  SF   V  G  + G  L    A+D+D G  G+V Y +  + S  FGIN  TGA+Y++
Sbjct: 1034 GASSPFGLESQSGWLWVRTALD-RESQELYTLKVMAVSGSKAELGQQTGTATVRVIILNQNDHSPRLSEEPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSF----QLLVQVQDGGSPPRSATGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVP--PGTLVTTLQAKDPDEGENGTILYT--LTGPGSELFSLHPHTGELHTAASLVRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSTRVVESPDLIEADSAATVPVVLTVTAAEGLRPGSLLG--SVAPQEPASVGVLTYTLVGGADPEGTFALDSASGRLYLARPLDFEAGPAWRALTVRAEGPG-GAGARLLRVQVRVQDENEHAPTFARD-PLALALPENPDPGATLYTFRASDADGPGPNSEVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPSR--VRLPEDQPPGPAALHVVARDPDLGEAARVSYRLAAGGDGHFRLHATTGALSVVRPLDREQRAEHVLTVVALDHGSPPRSSTQLLTVSVVDVNDEAPA-FPQQEYNVILRE-NSPPGTSLLTLKATDPDLGANGQVTYGGVSG---ESFSLDPNTGVLTTLRALDREE---QEEIYLTVYARDRGLPPLLTHITVRVTVEDENDHTPTFGNTHLSLEVPEGQDPQTLTTLRASDPDGGLNGQLQYRILDGDS-SGAFALDLTSGEFGTMRPLDREVEPAFQLQIEARD--GGQPALSATLLVTVTVLDANDHAPVFPVPSYSVEVPEDAPVGTLLLQLQAHDPDDGDNGRVMYYLGAGTAGAFLLEPTSGELSTATALDREHCASYAFSVTAV-DGAAAGPLSTTVPITITVRDVNDHAPAFPT-SPLRLRLPRPGPSLNKPTLALATLRAEDRDAGANASILYRLAGTPPPGTTV------DSYTGEIRVARSPVALGPQDRVLFIVATDLGRPARSATGVVVVGIQGEPERGPRFPRTSSEAVLR--ENAPPGTPVISPKAVHSGGSNGPITYSILSGNERGIFSIQPSTGAITVRSAEGLDFETSPRLRLVLQAESGGA--FAFSVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPATGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQP-WELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQDP---FSIGRYGGRVSLTGPLDFEQCDHYHLQLLAHDGPHEGHANLTVLVEDVNDNVPTFSQSLYQVMMLEHTPPGSAILSVSATDRDSGANGHISYHLA--SPAEGFR-VDPNNGTLFTTVGAMALGHEGPGVVDVVLEARDHGAPGRTAQA-TVHVQLKDQNDHAPSFTLPH-YRVAVSEDLPPGSTLLTLEATDADGSRT--HATVDYSIISGNRGRVFQLEPRLAEVGDGVGPGPQALGCLVLLEPLDFESLTQYNLTVAAADRGQPPRSSAVPVTVTVLDVNDNPPVFTRA--SYRVTVPEDMPVGAELLHVEASDADPGPHGLVHFTLSSGDPLGL-----FELDEN------SGALRLSRPLDCETQAQHQLVVQAAD----PAGTH---FSLVPVTVEVQDVNDHGPAFPLSLLSTSLAENQPPGTLVTTLHAIDGDAGTFGRLRYSLLEAVPGPEGREAFSLNSSTG-ELRARVPFDYEHTGSFRLLVGAADAG----NLSASVTVSVLITGEDEYDPVFLAPSFHFQVPEGA-QRGHSLGHVQATDEDGGADGLVLYSLATS-SPYFGINQTTGALYLR 2864          

HSP 2 Score: 154.836 bits (390), Expect = 1.603e-36
Identity = 145/631 (22.98%), Postives = 269/631 (42.63%), Query Frame = 2
Query:   95 SQQNSNLLIFSIKENVPIGEVVGQIES---PGFSPPFEMH--DFQEKKFI-----ISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDF-FTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNS--PPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDAISTSFDLEILNRS------PFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEIDSTILNENQHVTFVKTTKRLPTKP-----IFIFKIFVLNNLFKINETTGEILSKRSIDCGKYFFNVSMLSLKTNS----LIDQTKLEIVVKSGRKLPLYFDRGFRKILVTTG--KSQCFSEIAVRNRHCG--MRIQYSYDLLLKTDG--ILRINEH-GALCTAENVKHNKLMSTRYLYQIKALD 1882
            S   +  L   I E  P G ++G I +   PG +PP  M+    QE   +     I + +GV++ + ++DRE+++ Y F  ++ +G T  V +++ D+ND+ P F        IPE+  +G++  L    D D G+   Q   +    + + F ++      G     L++   LD E  S + L ++A DGG PP +A  L+ + + + ND+ P F+ SRY A + E        L+V A+D DAG +G + Y ++      D  F++D  TG + L + LDFE+ + H + +  RD    P   ++ V V +   + N    ++  L   G   ++    P  +VA + ++D D      D   +N S       F L      ++ + +   +   + +  NL + A D   P L    A  + + +      +F    ++ E    +      V  V+ T R P +       +        + F I+ T+G I +  ++D  +      ++ + T+     L+    + + ++        F R F    +  G     CF ++   +   G    + YS    L   G    RI+ H G +CT   +  ++  S+ + + + A+D
Sbjct:   34 SWGQAGSLDLQIDEEQPAGTLIGDISAGLPPGTAPP-PMYFISAQEGSGVGTDLAIDEHSGVVRTARVLDRERRDRYRFTAVTPDGATVEVTVRVADINDHAPAFPQARAALQIPEHTALGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPGGAPVPELVIAGELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGANGAVTYEINRRQSEGDGPFSIDAHTGFLRLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHVRDANDNQPSMTVIFLSADGSPRVSEAAPPGQLVARISVSDPD----DGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDVYNLRVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFV--VRVTARDPDQGTNGQITYSLAPGTHTHWFSIDPTSGIITTAATLDY-ELEPQPQLIVVATDGGLPPLVSSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGASGSPPFRIDAHSGDVCTTRTLDRDQGPSS-FDFTVTAID 655          

HSP 3 Score: 139.813 bits (351), Expect = 6.503e-32
Identity = 396/1956 (20.25%), Postives = 740/1956 (37.83%), Query Frame = 2
Query: 3134 PLETEVEISVRIIDANNHSPILISTNV-FYIHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNT------FVIRVKSLETINSYFEPLNVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSI-ELAIDNEDQINIDSWTGLITTKVSLSCAQNV--KIRIFVSDLG-FPKMTSSVDTLL---KPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSVDGFLHLRFDSQQ----LILLKDNLNVKNVH-YSLNVVFNKKNLFSISSNLYINVIVNRVGFSWPLFSKDSPKFLEIKENLPSGSHVASFNIR-------RLKNLEVVYSIKQPEK--YFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAP--TTENASIFQIVATDADSGPNSKLTYQINP----SSDGIFMINGDSGEI----HLVSSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKSKIRFXXXXXXXXXXXPQSKSGFIIGQLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASIYDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAITNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIFIDPSTGKL-SCSPLNF-MEKNIYNLKIIATDSEGLSTGRKD---FTKVIIFVQNTKQHTLAFNATHFSLKVLENSPGGTVLGRINIVKP--PVNSEI-FYVLNPGHSHIQINTTTGELRTNGPLHLELVEFIELTIHAFAKFISTRS----IQTTSAXXXXXXXXXXXXQPIPAENPVKIFIPNSNQPQKPLTKLSATDSDKTSNITYQFDRSDPTTQTLYKMYLLDGKSGNLFXXXXXXXXXXIRHFLKVIV-----SDNGVPSKCTTVLIDISLNQDHQYVQIVPEKAIFRVKENSVDGTFIGQIKMVNYCKDHSAK--FSIIDGVNHELVF-LHESTGKIFVAAAAKIDREKIDKIILWTQVSCGGSEIRGYKKVI-IHXXXXXXNKPVFSQNKFVAF------LNEGQPPKTPVIRLTVYDPDIGFNSQVEYFIEFYSSQEEFLIDANGDVKTNIPLNFHTKSVYDLVIKASSKASPFVFAECRLTVYIVNIN-----------DQRPKISIPNRNLKLDTNRPVGSFITKITAKDSDGPDGISYRIRHRKLTNQTLFLNVAFDSGEIFLSRKLLVSDVGKHEFDIVVDDARFSSTAV----IEIDVEDKNNHVPILKENGRVINLSSSLKRGSKILYLHAIDKDLRD-NGKVTFELVSTSPWFGLRGFDNNTAALFL---IDEPQEKGHPYFLGIQLTDNAIDPQKRLMSIFALTVLLKYPQSYFPRLIGNHSTEITIPESLKSGSKITKFVCKDLDSDKA--IFYKIDNFHPISNNLYLDFESGDLYLTKSLNYSIQPRFLLIVTCAIVGSPEKITSFNLSVQ-IEKENKGPNLIDNKY--------------ITLSLQVPEM-----IQKPAIISNLLQMDKNSFRYSYYLISVAPEQPENIYDPPSFQIDSSNILWWINGDLFESRIWNLTIMIVKAQKYQNSPSNLYENGYLFVNIEVPEKMIGNLRKCVEIKRLTGVINENEPPKTTVLKLPEWYHDIQYFLTPHEN---FELTCSQSQSSGCNIKSKSVLDFETHENYRLQLLIKGSYFYLRSCSHTIMVEISVLDMDEYFPEFVHQSFTQNVEGGIPKLGQILFTAYASDKDRGRFGIVSYQIVENPSENFGINNETGAIYIKNQFIIEKKDKQRVKRSETNEEALKSYRKSFQFRISASSGVKTSYAYVELTMLIPGIKPSMFPTKLTELQI 8674
            P    VE++VR+ D N+H+P          I +    GT       +D D G  G    +L      + F +E             VI  +      S++    + L A D GSP + +   L +  ++ N + P     + H   +    L  GS +  V A D D G N    Y I     + +   +ID+ TG +  +  L   Q    ++ +   D G  P++ S+  T+        +P      ++ + +  + + + PG +V  +++   + G    F     +   G  H    +Q     L+ +   L+ +    Y+L V         + +     + V  V  + P F +     L   E LP  +   SF +R       +  N ++ YS+       +F I+P +G + T    D E E Q Q  V  +AT    P + +   + V + D NDNEP       +    S P  T       Q+ ATDADSGP   L+Y +      S    F I+  SG++     L      S+++  VT  D G +    S+V+   F + +  +  +F     + +LS  QS  G  + ++         +  + Y+++AG    +F++D  +G +     + R     + +VQ+ +  Q         + R+ I+I  G   PP F +  +   +PED A    + ++      G  G +  +L G        +D  +G L +  PL+  +   +  L++ A       +G        ++ + + +   ++ AF A   ++ + +N+  GT +  +  + P    NS I F +L  G     ++ TTG +R  GPL        EL + A       R+    ++     + +  +    + P       ++ +P+       + ++ A   D  S +TY               + L+ +SG L++++++    +  + LKV+      ++ G  +   TV + I LNQ+    ++  E     V EN   GT +G++   +     + +  +S+         F +H  TG+  V     +DRE+     L  QV  GGS  R     + + V D++DN P F Q    A       + +  PP T V  L   DPD G N  + Y +    S+   L    G++ T   L    +  Y L + A  + SP   A  +L V ++              D    + +       +  RP GS +  +  ++      ++Y +        T  L+ A  SG ++L+R L   + G     + V              +++ V+D+N H P    +   + L  +   G+ +    A D D    N +V + L+   P       D  T AL     +D  +E      L ++ TD   +  +R  +  +  V +       P  +    + + +PE    G      V +D D  +A  + Y++        +  L   +G L + + L+   +   +L V     GSP + ++  L+V  ++  ++ P     +Y              +TL    P++     +    +      +D N+   +  L ++  E+ E IY           +  +         + ++T+ +    +  ++P+  + N +L  ++EVPE         +      G +N                  +QY +   ++   F L  +  +       +   LD E    ++LQ  I+       + S T++V ++VLD +++ P F   S++  V    P +G +L    A D D G  G V Y +                      F++E    +    +  + E   SY  S      A++G  ++   + +T+         FPT    L++
Sbjct:  116 PDGATVEVTVRVADINDHAPAFPQARAALQIPEHTALGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPGGAPVPELVIAGELDRENRSHY---MLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHA--VVSESLAPGSPVLQVFASDADAGANGAVTYEINRRQSEGDGPFSIDAHTGFLRLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHVRDANDNQPSMTVIFLSADGSPRVSEAAPPGQLVARISVSDPDDGD---FAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDVYNLRVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQ----LYRPEPLPEVALPGSFVVRVTARDPDQGTNGQITYSLAPGTHTHWFSIDPTSGIITTAATLDYELEPQPQLIV--VATDGGLPPLVSSATVSVALQDVNDNEPQF---QRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGASGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAIDGGGL---KSMVYVKVFVADENDNPPQFYPREYAASLSA-QSTPGTAVLRVHAHDPDQGPHGRLSYHILAGNSPPLFALDAHSGLLTVAWPLGRRA---NSVVQLEIGAQDGGGLQAEPIARVNISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIIQAHNPPGRLGPVTLTLSGGDPRGLFSLDSPSGLLKTLRPLDRELLGPVLELEVRA------GSGTPPVFAVARIRVLLDDVNDNSPAFPAPEDTVLLPQNTAPGTPIYTLRALDPDSGANSRITFNLLAGGDGLFTVDPTTGHVRLMGPLGPPGGPAHELEVEARDGGSPPRTSHFRLRVVIQDLGIHGLAPRFDSPT-----YRVDLPSGTTTGTQILQVQAQAPDG-SPVTYHL-----AADGASSPFGLESQSGWLWVRTALDRESQELYTLKVMAVSGSKAELGQQTGTATVRV-IILNQNDHSPRLSEEPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGE--VTTLQTLDREQQSSFQLLVQVQDGGSPPRSATGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSELFSLHPHTGELHTAASLVRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSTRVVESPDLIEADSAATVPVVLTVTAAEGLRP-GSLLGSVAPQEPASVGVLTYTLVGGADPEGTFALDSA--SGRLYLARPLDF-EAGPAWRALTVRAEGPGGAGARLLRVQVRVQDENEHAPTFARDPLALALPENPDPGATLYTFRASDADGPGPNSEVRYRLLRQEPPVPALRLDARTGALSAPRGLD--RETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAP--VFASPSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLAAGG--DGHFRLHATTGALSVVRPLDREQRAEHVLTVVALDHGSPPRSSTQLLTVSVVDVNDEAPAFPQQEYNVILRENSPPGTSLLTLKATDPDLGANGQVTYGGVSGESFSLDPNTGVLT-TLRALDREEQEEIY-----------LTVYARDRGLPPLLTHITVRVTVEDENDHTPT--FGNTHL--SLEVPEGQDPQTLTTLRASDPDGGLNGQ----------------LQYRILDGDSSGAFALDLTSGE-----FGTMRPLDREVEPAFQLQ--IEARDGGQPALSATLLVTVTVLDANDHAPVFPVPSYSVEVPEDAP-VGTLLLQLQAHDPDDGDNGRVMYYL---------------GAGTAGAFLLEPTSGELSTATALDREHCASYAFSVTAVDGAAAGPLSTTVPITITVRDVNDHAPAFPTSPLRLRL 1962          

HSP 4 Score: 113.62 bits (283), Expect = 4.367e-24
Identity = 75/256 (29.30%), Postives = 118/256 (46.09%), Query Frame = 2
Query:  218 KKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTK------NVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVF--DPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNS 961
            + F +   TGV+     +DRE+Q      + + +           V++ + D ND+ P F  T+    +PE         LTT+   DPD G N     RI+ GDS   FA+D      G         + LD E+   F L I+A DGG P L A+LLV + V +AND+ P F +  Y   + ED  +    L+++A D D G +G + Y+L     ++  F ++  +G +    +LD E   S+  S+   D +
Sbjct: 1685 ESFSLDPNTGVLTTLRALDREEQEEIYLTVYARDRGLPPLLTHITVRVTVEDENDHTPTFGNTHLSLEVPEGQ---DPQTLTTLRASDPDGGLNGQLQYRILDGDSSGAFALDLTSGEFGTM-------RPLDREVEPAFQLQIEARDGGQPALSATLLVTVTVLDANDHAPVFPVPSYSVEVPEDAPVGTLLLQLQAHDPDDGDNGRVMYYLGAG--TAGAFLLEPTSGELSTATALDREHCASYAFSVTAVDGA 1928          

HSP 5 Score: 111.694 bits (278), Expect = 1.959e-23
Identity = 252/1118 (22.54%), Postives = 437/1118 (39.09%), Query Frame = 2
Query: 2477 MFQVSAKAPKSQTSFAQVII---YIEDGIHQPGFDFSDLLVNIWENTTVGIEIMQVFPKYP------SVSDEYQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKP------------VGMNNPFEINPTTGCLLIISSLNIWNSNPSGIINLLVIVSDNGPFKPLETEVEISVRIIDANNHSPILISTNVFY----IHQTAVYGTEVGTLLXXXXXXXXXXXXXXSLKQPHYYQCFYIEKLSKNTFVIRVKSLETINSYFEPL-NVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFT----VNAVDPDKGLNSIFNYSIE--LAIDNEDQINIDSWTGLITTKVSLSCAQNVKIRIFVSDLGFPKMTSSVDTLLKPLYEPKSEEFLINKNLTFIIPDHSQPGYVVGDLNIFPENYGAKCLFISNTTTSV--------DGFLHLRF-------DSQQLILLKDNLNVKNVHYSLNVVFNKKNLFSISS----NLYINVIVNRVGFSWPLFSKDSPKFLEIK------ENLPSGSHVASFNIR----RLKNLEVVYSIKQPEKYFVINPVTGQLVTFRMFDRETENQIQFYVEVIATHVSNPKIFTVLPLIVKIADENDNEPYILSPSSSIVRISAPTTENASIFQIVATDADSGPNSKLTYQINPSSDGIFMINGDSGEIHLV---SSPRVSAYELNVTVRDSGEVPKSVSVVFSIHFQSIKTKS-KIRFXXXXXXXXXXXPQSKSGFIIG-QLSYSQTSSSGNLDIRYYLIAGKFAQIFSVDPITGSVQTQHSVSREEIGNSEIVQIPVVIQSLHDASI------YDLQRIFINIDYGNENPPRFSRSIFKVKLPEDEAI-TNFLTVVANDPDLGIFGRIIYSLEGDTFDKKIF-IDPSTGKLSC-SPLNFMEKNIYNLKIIATDSEGLSTGRKDFTKVIIFVQNTKQHTLAF------NATHFSLKVLENSPGGTVLGRINIVKP--PVNSEIFYVL-NPGHSHIQINTTTGELRT 5578
            M Q+ A    S    AQ ++    ++   H P F+ S     + E+   G  ++QVF          +V+ E    QS+     SI + TG + L +  D EQ     + VQ ++  G A  +L    + ++       +++ + T   LS+ G          +++ P G L  R+ +  P             G    F ++     + ++      +     + NL V  +D+G   PL  E    + + D N+++P        Y    + + A+ G+ V  +  +D D G NG+I  SL    +   F I+  S       + +  T++   EP   ++++ATD G P   S   + +   + N N P      Q ++  +   L  G++  T    V A D D G   + +YS+   L         ID+ +G + T            R    D G     SS D  +  +     +  +  K   F+  ++  P         +P  Y A     S   T+V        D   H R        +S  L  L  +  +  V + L    N      I +     L    I  RV  S    +   P F +++      E++  G+ V          RL  + +  S   P   F ++  +G L T R  DRE    +   +EV A     P +F V  + V + D NDN P   +P  +++ +   T     I+ + A D DSG NS++T+ +    DG+F ++  +G + L+     P   A+EL V  RD G  P++      +  Q +       RF S +  ++L      SG   G Q+   Q  +     + Y+L A   +  F ++  +G +  + ++ RE   + E+  + V+  S   A +        ++ I +N    N++ PR S     + + E++   T+   V A D D G  GR+ YSL+  + D K F I P TG+++    L+  +++ + L +   D  G S  R     V + V +   ++  F            ++V +  P GT++  +    P    N  I Y L  PG     ++  TGEL T
Sbjct:  216 MLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGANGAVTYEINRRQSEGDGPFSIDAHTGFLRLERPLDFEQRRVHELVVQARD--GGAHPELGSAFVTVHVRD--ANDNQPSMTVIFLSADGSPRV------SEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDVYNLRVTATDSG-SPPLRAEAAFVLHVTDVNDNAPAF--DRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQITYSLAPGTHTHWFSIDPTSGI-----ITTAATLDYELEPQPQLIVVATDGGLPPLVSSATVSVALQDVNDNEP------QFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGASGSPPFRIDAHSGDVCT-----------TRTLDRDQG----PSSFDFTVTAIDGGGLKSMVYVK--VFVADENDNP------PQFYPREYAASLSAQSTPGTAVLRVHAHDPDQGPHGRLSYHILAGNSPPLFALDAHSGLLTVAWPLGRRANSVVQLEIGAQDGGGLQAEPIA-RVNISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIIQAHNPPGRLGPVTLTLSGGDPRGLFSLDSPSGLLKTLRPLDRELLGPV-LELEVRAGS-GTPPVFAVARIRVLLDDVNDNSPAFPAPEDTVL-LPQNTAPGTPIYTLRALDPDSGANSRITFNLLAGGDGLFTVDPTTGHVRLMGPLGPPGGPAHELEVEARDGGSPPRTSHFRLRVVIQDLGIHGLAPRFDSPTYRVDL-----PSGTTTGTQILQVQAQAPDGSPVTYHLAADGASSPFGLESQSGWLWVRTALDRE---SQELYTLKVMAVSGSKAELGQQTGTATVRVIILNQ---NDHSPRLSEEPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSFQLLVQVQD--GGSPPRSATGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSELFSLHPHTGELHT 1269          

HSP 6 Score: 108.997 bits (271), Expect = 1.394e-22
Identity = 253/1210 (20.91%), Postives = 468/1210 (38.68%), Query Frame = 2
Query:  347 ILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNS-PPF--HTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYD-AISTSFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVE------IDSTILNENQHVTFVKTTKRLPTKPIFIFKIFVLNNLFKINETTGEILSKRSID---CGKYFFNVSMLSLKTNSLIDQT-KLEIVVKS-GRKLPLYFDRGFRKILVTTGKS-----QCFSEIAVRNRHCGMRIQYSYDLLLKTDGILRINEHGALCTAENVKHNKLMSTRYLYQIKA-LDETNSSAVCVVLFAIQ--PSKVFDVLPTEINITL--------PIIDSPK----------FNFSLPIGKIIGTFSKLPPAQFIGFIQYHLVPEELSTGAITVDSQSGEILMKKFPIHKNP-IRLIVKSVIRKPFNVSPLNIVA--INFQKLFFARSLYQFILTKSE-IKGNLVKIGQVSMDSSCTESVSYDLFGVKNDHSHFTIDVATGVIYGK---DLGSISNKTLMFQVSAKAPKSQTSFAQVIIYIED------GIHQPGFDFSDLLVNIWENTTVGIEIMQV----FPKYPSVSDEYQIIQSQYSDWLSIHSKTGQIFLNKQFDREQVSYLVVTVQLKNLIGSATXXXXXXXXXXXXXKPYCKNSKTNFTFEDLSSLGEMECPLKCSDADSFPNGNLSYRMKIIKPVGMNNPFEINPTTGCLL-IISSLNIWNSNPSGIINLLVIVSDNGPFKPLET-EVEISVRIIDANNHSP-ILISTNVFYIHQTAVYGTEVGTL-LXXXXXXXXXXXXXXSLKQPHYYQCFYIE-KLSK--NTFVIRVKSLETINSYFEPL--------NVMLIATDRGSPSKSSVINLVINFIESNRNPPEIVMPKQHKQMIFFCPLLSGSEIFTVNAVDPDKGLNSIFNYSIELAIDNEDQINIDSWTGLITTKVSLSCAQNVKIRIFV 3757
            + D NDN P F A+     +PE+ P G         DPD G+ +  S R+ +G  +  F +  H ++  +  VR      LD E  ++  L + A+D G PP  ++ L+ + V + ND  P F    Y   ++E+     + L ++ATD D G +G++ Y       S + F++D  TG +   ++LD E+ +  ++++  RD   PP   H +    + D  D      +  +       E+     P T+   ++ +D D  ++      IL+        +     E   +  +      +  L ++A D  +P+LS T  +T+ + ++      F    + VE      + + +L    H        R     +  +        F +  T+GE+ +  ++D   C  Y F+V+ +       +  T  + I V+      P +     R  L   G S        + +   +R  G      Y L         ++ +                 R L+ +   L     SA  VV+  IQ  P +      T     L        P+I SPK            +S+  G   G FS  P                 STGAITV S  G           +P +RL++++     F  S L +     N     F R  Y   L +S  ++G L+++    +D      +SY L   +     F +D ATG I      D    +   L+   + +   +    A + + + D       I QP        + + E+  +G EI QV        P +   Y +  S   D  SI    G++ L    D EQ  +  + +   +       +L + + D+NDN P    S       + +  G     +  +D DS  NG++SY +    P      F ++P  G L   + ++ + +  P G++++++   D+G   P  T +  + V++ D N+H+P   +      + +    G+ + TL     +    +  ++ S+   +  + F +E +L++  +      ++L  +    EPL        N+ + A DRG P +SS + + +  ++ N NPP  V  +   ++     +  G+E+  V A D D G + + ++++  + D      +D  +G +     L C    + ++ V
Sbjct: 1529 VTDENDNAPVF-ASPSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLAAG-GDGHFRL--HATTGALSVVR-----PLDREQRAEHVLTVVALDHGSPPRSSTQLLTVSVVDVNDEAPAFPQQEYNVILRENSPPGTSLLTLKATDPDLGANGQVTY----GGVSGESFSLDPNTGVLTTLRALDREEQEEIYLTVYARDRGLPPLLTHITVRVTVEDENDHTPTFGNTHLSL-----EVPEGQDPQTLTT-LRASDPDGGLNGQLQYRILDGDSSGAFALDLTSGEFGTMRPLDREVEPAFQLQIEARDGGQPALSATLLVTVTVLDANDHAPVFPVPSYSVEVPEDAPVGTLLLQLQAHDPDDGDNGR-----VMYYLGAGTAGAFLLEPTSGELSTATALDREHCASYAFSVTAVDGAAAGPLSTTVPITITVRDVNDHAPAFPTSPLRLRLPRPGPSLNKPTLALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVALGPQDRVLFIVATDLGRPARSATGVVVVGIQGEPERGPRFPRTSSEAVLRENAPPGTPVI-SPKAVHSGGSNGPITYSILSGNERGIFSIQP-----------------STGAITVRSAEG------LDFETSPRLRLVLQAESGGAFAFSVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPATGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQP------WELRVSEDALLGSEIAQVTGNDVDSGPVL--WYVLSPSGPQDPFSIGRYGGRVSLTGPLDFEQCDHYHLQLLAHDGPHEGHANLTVLVEDVNDNVPTFSQSLYQVMMLEHTPPGSAILSVSATDRDSGANGHISYHLA--SPA---EGFRVDPNNGTLFTTVGAMALGHEGP-GVVDVVLEARDHG--APGRTAQATVHVQLKDQNDHAPSFTLPHYRVAVSEDLPPGSTLLTLEATDADGSRTHATVDYSIISGNRGRVFQLEPRLAEVGDGVGPGPQALGCL-VLLEPLDFESLTQYNLTVAAADRGQPPRSSAVPVTVTVLDVNDNPP--VFTRASYRVTVPEDMPVGAELLHVEASDADPGPHGLVHFTLS-SGDPLGLFELDENSGALRLSRPLDCETQAQHQLVV 2670          

HSP 7 Score: 99.7525 bits (247), Expect = 6.843e-20
Identity = 59/217 (27.19%), Postives = 106/217 (48.85%), Query Frame = 2
Query:  329 KNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGK-NSIQSVRIVSGDSEKVFAID--YHDSSNGI-----FYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD 955
              V +++ D ND+ P F   ++  ++ E+ P GS +      D D  + ++     I+SG+  +VF ++    +  +G+         L+L + LD+E ++Q+NL + A D G PP  +++ V + V + NDN P F  + Y  ++ ED  +    L V A+D D G  G + + L +  P    F +D  +G + L + LD E    H + +   D
Sbjct: 2459 ATVHVQLKDQNDHAPSFTLPHYRVAVSEDLPPGSTLLTLEATDADGSRTHATVDYSIISGNRGRVFQLEPRLAEVGDGVGPGPQALGCLVLLEPLDFESLTQYNLTVAAADRGQPPRSSAVPVTVTVLDVNDNPPVFTRASYRVTVPEDMPVGAELLHVEASDADPGPHGLVHFTLSSGDPLG-LFELDENSGALRLSRPLDCETQAQHQLVVQAAD 2674          

HSP 8 Score: 98.9821 bits (245), Expect = 1.200e-19
Identity = 73/265 (27.55%), Postives = 125/265 (47.17%), Query Frame = 2
Query:  194 FEMHDFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMN------GDTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFY-FLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRDNSPP 967
            + +    +  F +  TTG + V   +DRE++  +   +++++        T+ + + ++DVND  P F    +   + EN P G+ +      DPD G N   +   VSG+S   F++   D + G+    L   ++LD E   +  L + A D G PPL   + V++ V++ ND+ P F  +     + E Q+   T   +RA+D D G++G+L Y  LD    SS  F +D  +G     + LD E   +  + I  RD   P
Sbjct: 1575 YRLAAGGDGHFRLHATTGALSVVRPLDREQRAEHVLTVVALDHGSPPRSSTQLLTVSVVDVNDEAPAFPQQEYNVILRENSPPGTSLLTLKATDPDLGANGQVTYGGVSGES---FSL---DPNTGV----LTTLRALDREEQEEIYLTVYARDRGLPPLLTHITVRVTVEDENDHTPTFGNTHLSLEVPEGQDPQ-TLTTLRASDPDGGLNGQLQYRILDGD--SSGAFALDLTSGEFGTMRPLDREVEPAFQLQIEARDGGQP 1826          

HSP 9 Score: 98.9821 bits (245), Expect = 1.231e-19
Identity = 65/212 (30.66%), Postives = 103/212 (48.58%), Query Frame = 2
Query:  335 VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAID--GGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSS---DFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD 955
            V + +LDVNDN P F   ++  ++PE+ P+G+++      D D G + +    + SGD   +F +D +  +       L L + LD E  +Q  LV+QA D  G H  L   + V + VQ+ ND+ P F +S    S+ E+Q        + A D DAG  G L Y L    P     + F+++  TG +  R   D+E + S  + +G  D
Sbjct: 2581 VTVTVLDVNDNPPVFTRASYRVTVPEDMPVGAELLHVEASDADPGPHGLVHFTLSSGDPLGLFELDENSGA-------LRLSRPLDCETQAQHQLVVQAADPAGTHFSL---VPVTVEVQDVNDHGPAFPLSLLSTSLAENQPPGTLVTTLHAIDGDAGTFGRLRYSLLEAVPGPEGREAFSLNSSTGELRARVPFDYEHTGSFRLLVGAAD 2782          

HSP 10 Score: 93.2041 bits (230), Expect = 8.420e-18
Identity = 85/308 (27.60%), Postives = 137/308 (44.48%), Query Frame = 2
Query:  137 NVPIGEVVG------QIESPGFSPPFEMH---DFQEKKFIISKTTGVIKVSGLIDREKQNLYSFLIISMNG---------DTKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNS--IQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIAS------IKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD-NSPPFHTS 979
            ++P G   G      Q ++P  SP    H   D     F +   +G + V   +DRE Q LY+  +++++G          T  V++ IL+ ND+ P+ +      ++ EN P G+ V      D D G N     S++ +S DS K F I  H  +  +  +     Q+LD E  S F L++Q  DGG PP  A+  V + V + NDN P F  +   A       + +          ++A D D G +G + Y L  T P S+ F++   TG ++   SL   +   + +++   D  SPP   S
Sbjct: 1002 DLPSGTTTGTQILQVQAQAPDGSP-VTYHLAADGASSPFGLESQSGWLWVRTALDRESQELYTLKVMAVSGSKAELGQQTGTATVRVIILNQNDHSPRLSEEPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDS-KAFRI--HPQTGEVTTL-----QTLDREQQSSFQLLVQVQDGGSPPRSATGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTL--TGPGSELFSLHPHTGELHTAASLVRAERPHYVLTLSAHDQGSPPRSAS 1298          

HSP 11 Score: 83.1889 bits (204), Expect = 7.244e-15
Identity = 68/274 (24.82%), Postives = 125/274 (45.62%), Query Frame = 2
Query:  125 SIKENVPIGEVVGQIESPGFSP-PFEMHDFQEKK------FIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTKN-----VQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEG---KNSIQSVRIVSG-DSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLR 898
            ++ E++P+G  +  +E+    P P  +  F          F + + +G +++S  +D E Q  +  ++ + +    +     V +++ DVND+ P F  +    S+ EN P G+ V      D D G   +     +  V G +  + F+++   SS G    R+      DYE    F L++ A D G+  L AS+ V +++   ++  P F    +   + E  +   +   V+ATD D G  G + Y L  +SP   +F ++  TG +YLR
Sbjct: 2603 TVPEDMPVGAELLHVEASDADPGPHGLVHFTLSSGDPLGLFELDENSGALRLSRPLDCETQAQHQLVVQAADPAGTHFSLVPVTVEVQDVNDHGPAFPLSLLSTSLAENQPPGTLVTTLHAIDGDAGTFGRLRYSLLEAVPGPEGREAFSLN---SSTGELRARV----PFDYEHTGSFRLLVGAADAGN--LSASVTVSVLITGEDEYDPVFLAPSFHFQVPEGAQRGHSLGHVQATDEDGGADGLVLYSLATSSP---YFGINQTTGALYLR 2864          

HSP 12 Score: 81.2629 bits (199), Expect = 2.656e-14
Identity = 86/381 (22.57%), Postives = 160/381 (41.99%), Query Frame = 2
Query:  224 FIISKTTGVIKVSGLIDREKQNLYSFLIISMNGDTK--------NVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPL---QASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKSLDFEKSKSHHISIGVRD-NSPPFHTSKXXXXXXXXXXXXXXXSIQI--LWTGGLS-EINRDISPNTIVAHVKLTDYDAISTSFDLEILNRSPFQLIKILPKMWELKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKI 1321
            F +  TTG +++ G +       +   + + +G +          V I+ L ++   P+F++  +   +P     G+++       PD    S  +  + +  +   F ++   S +G  +VR     +LD E    + L + A+ G    L     +  V++I+ N ND+ P+        ++ E+Q    +  RV ATD D+G +G L Y L   S  S  F +  +TG V   ++LD E+  S  + + V+D  SPP   +    +  +   +++P  +Q      GGL  ++   + P T+V  ++  D D       L  L     +L  + P   EL     +   +     LTL A D   P  S +  L +++
Sbjct:  935 FTVDPTTGHVRLMGPLGPPGGPAHELEVEARDGGSPPRTSHFRLRVVIQDLGIHGLAPRFDSPTYRVDLPSGTTTGTQILQVQAQAPD---GSPVTYHLAADGASSPFGLE---SQSGWLWVR----TALDRESQELYTLKVMAVSGSKAELGQQTGTATVRVIILNQNDHSPRLSEEPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSFQLLVQVQDGGSPPRSATGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSELFSLHPHTGELHTAASLVRAERPHYVLTLSAHDQGSPPRSASLQLLVQV 1305          

HSP 13 Score: 80.1073 bits (196), Expect = 6.569e-14
Identity = 103/431 (23.90%), Postives = 189/431 (43.85%), Query Frame = 2
Query:  326 TKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHPPLQASLLVKIIVQNANDNVPKFDISRYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYL---RKSLDFEKSKSHHISIGVRDNSPPFHTSKXXXXXXXXXXXXXXXSIQILWTGGLSEINRDISPNTIVAHVKLTDYDAIST--SFDLEILNRSPFQLIKILPKMWE--------------LKLINDIGNYKSNSINLTLKAVDYPEPSLSTTQALTIKIHESILFENSFSHSRFQVEI--DSTILNENQHVTFVKTTKRLPTKPIFIFKIFVLN-----NLFKINETTGEILSKRSIDC 1540
            +  + + ++D NDN P      +E  + E+  +GS++   T  D D G   +  V   SG  +  F+I       G +  R+ L   LD+E    ++L + A DG H   +    + ++V++ NDNVP F  S Y   + E        L V ATD D+G +G + Y L   SP ++ F VD   G ++      +L  E      + +  RD+  P  T++  V + + D ND+ PS  +        ++ D+ P + +  ++ TD D   T  + D  I++ +  ++ ++ P++ E              L L+  +        NLT+ A D  +P  S+   +T+ + +       F+ + ++V +  D  +  E  H   V+ +   P     +   F L+      LF+++E +G +   R +DC
Sbjct: 2253 SATLTVMVIDTNDNRPTI-PQPWELRVSEDALLGSEIAQVTGNDVDSGP-VLWYVLSPSGPQDP-FSI-------GRYGGRVSLTGPLDFEQCDHYHLQLLAHDGPH---EGHANLTVLVEDVNDNVPTFSQSLYQVMMLEHTPPGSAILSVSATDRDSGANGHISYHL--ASP-AEGFRVDPNNGTLFTTVGAMALGHEGPGVVDVVLEARDHGAPGRTAQATVHVQLKDQNDHAPSFTLPHY--RVAVSEDLPPGSTLLTLEATDADGSRTHATVDYSIISGNRGRVFQLEPRLAEVGDGVGPGPQALGCLVLLEPLDFESLTQYNLTVAAADRGQPPRSSAVPVTVTVLDVNDNPPVFTRASYRVTVPEDMPVGAELLH---VEASDADPGPHGLVH--FTLSSGDPLGLFELDENSGALRLSRPLDC 2660          

HSP 14 Score: 78.5666 bits (192), Expect = 1.905e-13
Identity = 61/239 (25.52%), Postives = 105/239 (43.93%), Query Frame = 2
Query:  221 KFIISKTTGVIKVSGLIDREKQNLYSFLIISMNGD------TKNVQIKILDVNDNEPKFNATNFEKSIPENYPIGSKVDLTTVFDPDEGKNSIQSVRIVSGDSEKVFAIDYHDSSNGIFYVRLILKQSLDYEIISQFNLVIQAIDGGHP-PLQASLLVKIIVQNANDNVPKFDIS----RYIASIKEDQEINITFLRVRATDNDAGVSGELFYFLDNTSPSSDFFTVDHKTGNVYLRKS 904
             F +  T+G       +DRE +  +   I + +G       T  V + +LD ND+ P F   ++   +PE+ P+G+ +      DPD+G N      + +G +   F ++    ++G     L