T-box transcription factor TBX2

Overview
NameT-box transcription factor TBX2
Smed IDSMED30032395
Length (bp)2164
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of T-box transcription factor TBX2 (SMED30032395) t-SNE clustered cells

Violin plots show distribution of expression levels for T-box transcription factor TBX2 (SMED30032395) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of T-box transcription factor TBX2 (SMED30032395) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for T-box transcription factor TBX2 (SMED30032395) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032395

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
enteric muscle cellSMED30032395SMESG000061015.1 dd_Smed_v4_11693_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032395SMESG000061015.1 dd_Smed_v4_11693_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30032395SMESG000061015.1 dd_Smed_v4_11693_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the whole animalSMED30032395SMESG000061015.1 dd_Smed_v4_11693_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of T-box transcription factor TBX2 vs. Ensembl Human
Match: TBX2 (T-box transcription factor 2 [Source:HGNC Symbol;Acc:HGNC:11597])

HSP 1 Score: 374.4 bits (960), Expect = 6.059e-119
Identity = 163/208 (78.37%), Postives = 189/208 (90.87%), Query Frame = 2
Query:  335 RNVTEQINDQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKK 958
            R++     + +++DDPKV L  ++LW+QFH  GTEMVITKSGRRMFPP+KV+VSGLDK+AKYI+LMD+VA DDCRYKFHN++WMVAGKADPEMPKRMYIHPDSP TGEQWM K ++FHKLKLTNNISDKHGFTILNSMHKYQPRFH+VRANDI++LPYSTFR+YVF ET FI VTAYQN+KITQLKID+NPFAKGFRDTG G+REK+K
Sbjct:   90 RSLKSLEPEDEVEDDPKVTLEAKELWDQFHKLGTEMVITKSGRRMFPPFKVRVSGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMAKPVAFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTYVFPETDFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRK 297          
BLAST of T-box transcription factor TBX2 vs. Ensembl Human
Match: TBX3 (T-box transcription factor 3 [Source:HGNC Symbol;Acc:HGNC:11602])

HSP 1 Score: 365.155 bits (936), Expect = 2.261e-115
Identity = 163/225 (72.44%), Postives = 192/225 (85.33%), Query Frame = 2
Query:  383 KVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKK-LNGSAISTSSDVDNKGNKDNSEEISECSDVNI 1054
            KV L  ++LW+QFH  GTEMVITKSGRRMFPP+KV+ SGLDK+AKYI+LMD++A DDCRYKFHN++WMVAGKADPEMPKRMYIHPDSP TGEQWM K+++FHKLKLTNNISDKHGFTILNSMHKYQPRFH+VRANDI++LPYSTFR+Y+F ET+FI VTAYQN+KITQLKID+NPFAKGFRDTG G+REK+K L   ++    +   K N  + E  SE +  N 
Sbjct:  104 KVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRKQLTLQSMRVFDERHKKENGTSDESSSEQAAFNC 328          
BLAST of T-box transcription factor TBX2 vs. Ensembl Human
Match: TBX3 (T-box transcription factor 3 [Source:HGNC Symbol;Acc:HGNC:11602])

HSP 1 Score: 353.214 bits (905), Expect = 1.491e-110
Identity = 163/245 (66.53%), Postives = 192/245 (78.37%), Query Frame = 2
Query:  383 KVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGF--------------------TILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKK-LNGSAISTSSDVDNKGNKDNSEEISECSDVNI 1054
            KV L  ++LW+QFH  GTEMVITKSGRRMFPP+KV+ SGLDK+AKYI+LMD++A DDCRYKFHN++WMVAGKADPEMPKRMYIHPDSP TGEQWM K+++FHKLKLTNNISDKHGF                    TILNSMHKYQPRFH+VRANDI++LPYSTFR+Y+F ET+FI VTAYQN+KITQLKID+NPFAKGFRDTG G+REK+K L   ++    +   K N  + E  SE +  N 
Sbjct:  104 KVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFTLAFPSDHATWQGNYSFGTQTILNSMHKYQPRFHIVRANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRKQLTLQSMRVFDERHKKENGTSDESSSEQAAFNC 348          
BLAST of T-box transcription factor TBX2 vs. Ensembl Human
Match: TBX5 (T-box transcription factor 5 [Source:HGNC Symbol;Acc:HGNC:11604])

HSP 1 Score: 245.743 bits (626), Expect = 2.552e-74
Identity = 113/185 (61.08%), Postives = 143/185 (77.30%), Query Frame = 2
Query:  383 KVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRA--NDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDT 931
            KV L +R+LW +FH  GTEM+ITK+GRRMFP YKV+V+GL+ + KYI+LMD+V  DD RYKF +N+W V GKA+P MP R+Y+HPDSP TG  WM++++SF KLKLTNN  D  G  ILNSMHKYQPR H+V+A  N+      + F ++VF ET FI VT+YQN KITQLKI++NPFAKGFR +
Sbjct:   55 KVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKITQLKIENNPFAKGFRGS 239          
BLAST of T-box transcription factor TBX2 vs. Ensembl Human
Match: TBX4 (T-box transcription factor 4 [Source:HGNC Symbol;Acc:HGNC:11603])

HSP 1 Score: 249.98 bits (637), Expect = 1.047e-73
Identity = 112/185 (60.54%), Postives = 146/185 (78.92%), Query Frame = 2
Query:  383 KVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRA--NDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDT 931
            KV L +++LW++FH  GTEM+ITK+GRRMFP YKV+V+G++ + KYI+L+D+V  DD RYKF +N+WMVAGKA+P MP R+Y+HPDSP TG  WM++++SF KLKLTNN  D  G  ILNSMHKYQPR H+V+A  N+      + F ++VF ET FI VT+YQN KITQLKI++NPFAKGFR +
Sbjct:   68 KVGLHEKELWKKFHEAGTEMIITKAGRRMFPSYKVKVTGMNPKTKYILLIDIVPADDHRYKFCDNKWMVAGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNAFGSKNTAFCTHVFPETSFISVTSYQNHKITQLKIENNPFAKGFRGS 252          
BLAST of T-box transcription factor TBX2 vs. Ensembl Celegans
Match: tbx-2 (T-box protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q19691])

HSP 1 Score: 319.701 bits (818), Expect = 6.165e-102
Identity = 143/212 (67.45%), Postives = 178/212 (83.96%), Query Frame = 2
Query:  359 DQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKK----KLNGSAIST 982
            D  + DDPKVEL +R+LW+QF   GTEMVITKSGRR+FP Y+V++SGLDK+++Y ++MD+V  D+ RYKF+N++WM+AGKADPEMPK +YIHPDSP+TGE WM K  +FHKLKLTNNISDKHG+TILNSMHKYQPR H+VR  D   L YSTFR++VF+ET+FI VTAYQNEK+T+LKI++NPFAKGFRD G GKREKK    ++NG A  +
Sbjct:   54 DDGVTDDPKVELDERELWQQFSQCGTEMVITKSGRRIFPAYRVKISGLDKKSQYFVMMDLVPADEHRYKFNNSRWMIAGKADPEMPKTLYIHPDSPSTGEHWMSKGANFHKLKLTNNISDKHGYTILNSMHKYQPRLHVVRCADRHNLMYSTFRTFVFRETEFIAVTAYQNEKVTELKIENNPFAKGFRDAGAGKREKKRQLHRMNGDATQS 265          
BLAST of T-box transcription factor TBX2 vs. Ensembl Celegans
Match: tbx-2 (T-box protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q19691])

HSP 1 Score: 319.701 bits (818), Expect = 6.165e-102
Identity = 143/212 (67.45%), Postives = 178/212 (83.96%), Query Frame = 2
Query:  359 DQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKK----KLNGSAIST 982
            D  + DDPKVEL +R+LW+QF   GTEMVITKSGRR+FP Y+V++SGLDK+++Y ++MD+V  D+ RYKF+N++WM+AGKADPEMPK +YIHPDSP+TGE WM K  +FHKLKLTNNISDKHG+TILNSMHKYQPR H+VR  D   L YSTFR++VF+ET+FI VTAYQNEK+T+LKI++NPFAKGFRD G GKREKK    ++NG A  +
Sbjct:   54 DDGVTDDPKVELDERELWQQFSQCGTEMVITKSGRRIFPAYRVKISGLDKKSQYFVMMDLVPADEHRYKFNNSRWMIAGKADPEMPKTLYIHPDSPSTGEHWMSKGANFHKLKLTNNISDKHGYTILNSMHKYQPRLHVVRCADRHNLMYSTFRTFVFRETEFIAVTAYQNEKVTELKIENNPFAKGFRDAGAGKREKKRQLHRMNGDATQS 265          
BLAST of T-box transcription factor TBX2 vs. Ensembl Celegans
Match: tbx-7 (Putative T-box protein 7 [Source:UniProtKB/Swiss-Prot;Acc:Q95PX3])

HSP 1 Score: 213.001 bits (541), Expect = 4.454e-63
Identity = 97/209 (46.41%), Postives = 141/209 (67.46%), Query Frame = 2
Query:  326 PASRNVTEQINDQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREK 952
            PAS    ++  D  + D+P VEL++R+LW  F   GTEM+ITK GRRMFP  K+++SGLDK + Y ++M++++VD  RYKF N  W+VAG  +       ++HP SP +GE WM   + F   KL+NN  +  G  +LNSMH+Y PRFH+VRA+   +   ++ +++ FKET+FI VTAYQN+ +T+ KID+NPFAKGFR+    ++ K
Sbjct:   10 PASSAFFDRKKDDGVIDNPNVELVNRNLWSTFLECGTEMIITKKGRRMFPLVKLKLSGLDKNSNYTIIMEMISVDKLRYKFWNGNWIVAGVGEHHPLPTCFVHPQSPRSGEWWMTDGVDFKMAKLSNNPFNNDGHIVLNSMHRYNPRFHIVRADSSGQPILASLKTFSFKETEFIAVTAYQNDVVTKCKIDNNPFAKGFRNIDTVRKRK 218          
BLAST of T-box transcription factor TBX2 vs. Ensembl Celegans
Match: tbx-7 (Putative T-box protein 7 [Source:UniProtKB/Swiss-Prot;Acc:Q95PX3])

HSP 1 Score: 212.616 bits (540), Expect = 1.613e-62
Identity = 111/272 (40.81%), Postives = 161/272 (59.19%), Query Frame = 2
Query:  236 NYGNLLMGKQGMTHSSNLANYPFLPP--------DIFN-PASRNVTEQINDQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKKLNGSAISTSSDVDNKGNKDNSE 1024
             YG  L  ++   H   L     LPP          F+ PAS    ++  D  + D+P VEL++R+LW  F   GTEM+ITK GRRMFP  K+++SGLDK + Y ++M++++VD  RYKF N  W+VAG  +       ++HP SP +GE WM   + F   KL+NN  +  G  +LNSMH+Y PRFH+VRA+   +   ++ +++ FKET+FI VTAYQN+ +T+ KID+NPFAKGFR+    ++ K     S    S D + +  +  SE
Sbjct:   12 GYGRSLFSEKHFPHDRQL-----LPPFTTTMSLGSFFSFPASSAFFDRKKDDGVIDNPNVELVNRNLWSTFLECGTEMIITKKGRRMFPLVKLKLSGLDKNSNYTIIMEMISVDKLRYKFWNGNWIVAGVGEHHPLPTCFVHPQSPRSGEWWMTDGVDFKMAKLSNNPFNNDGHIVLNSMHRYNPRFHIVRADSSGQPILASLKTFSFKETEFIAVTAYQNDVVTKCKIDNNPFAKGFRNIDTVRKRKMNQIISTPPASEDEEPEVKRTKSE 278          
BLAST of T-box transcription factor TBX2 vs. Ensembl Celegans
Match: tbx-7 (Putative T-box protein 7 [Source:UniProtKB/Swiss-Prot;Acc:Q95PX3])

HSP 1 Score: 212.616 bits (540), Expect = 1.613e-62
Identity = 111/272 (40.81%), Postives = 161/272 (59.19%), Query Frame = 2
Query:  236 NYGNLLMGKQGMTHSSNLANYPFLPP--------DIFN-PASRNVTEQINDQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKKLNGSAISTSSDVDNKGNKDNSE 1024
             YG  L  ++   H   L     LPP          F+ PAS    ++  D  + D+P VEL++R+LW  F   GTEM+ITK GRRMFP  K+++SGLDK + Y ++M++++VD  RYKF N  W+VAG  +       ++HP SP +GE WM   + F   KL+NN  +  G  +LNSMH+Y PRFH+VRA+   +   ++ +++ FKET+FI VTAYQN+ +T+ KID+NPFAKGFR+    ++ K     S    S D + +  +  SE
Sbjct:   12 GYGRSLFSEKHFPHDRQL-----LPPFTTTMSLGSFFSFPASSAFFDRKKDDGVIDNPNVELVNRNLWSTFLECGTEMIITKKGRRMFPLVKLKLSGLDKNSNYTIIMEMISVDKLRYKFWNGNWIVAGVGEHHPLPTCFVHPQSPRSGEWWMTDGVDFKMAKLSNNPFNNDGHIVLNSMHRYNPRFHIVRADSSGQPILASLKTFSFKETEFIAVTAYQNDVVTKCKIDNNPFAKGFRNIDTVRKRKMNQIISTPPASEDEEPEVKRTKSE 278          
BLAST of T-box transcription factor TBX2 vs. Ensembl Fly
Match: bi (gene:FBgn0000179 transcript:FBtr0308915)

HSP 1 Score: 370.933 bits (951), Expect = 2.704e-115
Identity = 171/227 (75.33%), Postives = 192/227 (84.58%), Query Frame = 2
Query:  320 FNPASRNVTE-QINDQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKKLNGSAISTSSDVD 997
             +PA R +   Q  D  + DDPKV L  +DLWE+FH  GTEMVITKSGR+MFP  K +VSGLD +AKYI+L+D+VA DD RYKFHN++WMVAGKADPEMPKRMYIHPDSPTTGEQWMQK++SFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDI++LPYSTFR+YVFKET+FI VTAYQNEKITQLKID+NPFAKGFRDTG GKREK        +  SD D
Sbjct:  307 LHPAMRPLRALQPEDDGVVDDPKVTLEGKDLWEKFHKLGTEMVITKSGRQMFPQMKFRVSGLDAKAKYILLLDIVAADDYRYKFHNSRWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKVVSFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDILKLPYSTFRTYVFKETEFIAVTAYQNEKITQLKIDNNPFAKGFRDTGAGKREKNYRQALMSNRGSDSD 533          
BLAST of T-box transcription factor TBX2 vs. Ensembl Fly
Match: bi (gene:FBgn0000179 transcript:FBtr0343569)

HSP 1 Score: 370.163 bits (949), Expect = 5.275e-115
Identity = 168/212 (79.25%), Postives = 188/212 (88.68%), Query Frame = 2
Query:  320 FNPASRNVTE-QINDQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREK 952
             +PA R +   Q  D  + DDPKV L  +DLWE+FH  GTEMVITKSGR+MFP  K +VSGLD +AKYI+L+D+VA DD RYKFHN++WMVAGKADPEMPKRMYIHPDSPTTGEQWMQK++SFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDI++LPYSTFR+YVFKET+FI VTAYQNEKITQLKID+NPFAKGFRDTG GKREK
Sbjct:  307 LHPAMRPLRALQPEDDGVVDDPKVTLEGKDLWEKFHKLGTEMVITKSGRQMFPQMKFRVSGLDAKAKYILLLDIVAADDYRYKFHNSRWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKVVSFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDILKLPYSTFRTYVFKETEFIAVTAYQNEKITQLKIDNNPFAKGFRDTGAGKREK 518          
BLAST of T-box transcription factor TBX2 vs. Ensembl Fly
Match: bi (gene:FBgn0000179 transcript:FBtr0300608)

HSP 1 Score: 367.466 bits (942), Expect = 5.136e-114
Identity = 169/217 (77.88%), Postives = 190/217 (87.56%), Query Frame = 2
Query:  320 FNPASRNVTE-QINDQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGF---TILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKK 958
             +PA R +   Q  D  + DDPKV L  +DLWE+FH  GTEMVITKSGR+MFP  K +VSGLD +AKYI+L+D+VA DD RYKFHN++WMVAGKADPEMPKRMYIHPDSPTTGEQWMQK++SFHKLKLTNNISDKHGF   TILNSMHKYQPRFHLVRANDI++LPYSTFR+YVFKET+FI VTAYQNEKITQLKID+NPFAKGFRDTG GKREKK+
Sbjct:  307 LHPAMRPLRALQPEDDGVVDDPKVTLEGKDLWEKFHKLGTEMVITKSGRQMFPQMKFRVSGLDAKAKYILLLDIVAADDYRYKFHNSRWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKVVSFHKLKLTNNISDKHGFVSTTILNSMHKYQPRFHLVRANDILKLPYSTFRTYVFKETEFIAVTAYQNEKITQLKIDNNPFAKGFRDTGAGKREKKQ 523          
BLAST of T-box transcription factor TBX2 vs. Ensembl Fly
Match: bi (gene:FBgn0000179 transcript:FBtr0070672)

HSP 1 Score: 367.466 bits (942), Expect = 5.136e-114
Identity = 169/217 (77.88%), Postives = 190/217 (87.56%), Query Frame = 2
Query:  320 FNPASRNVTE-QINDQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGF---TILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKK 958
             +PA R +   Q  D  + DDPKV L  +DLWE+FH  GTEMVITKSGR+MFP  K +VSGLD +AKYI+L+D+VA DD RYKFHN++WMVAGKADPEMPKRMYIHPDSPTTGEQWMQK++SFHKLKLTNNISDKHGF   TILNSMHKYQPRFHLVRANDI++LPYSTFR+YVFKET+FI VTAYQNEKITQLKID+NPFAKGFRDTG GKREKK+
Sbjct:  307 LHPAMRPLRALQPEDDGVVDDPKVTLEGKDLWEKFHKLGTEMVITKSGRQMFPQMKFRVSGLDAKAKYILLLDIVAADDYRYKFHNSRWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKVVSFHKLKLTNNISDKHGFVSTTILNSMHKYQPRFHLVRANDILKLPYSTFRTYVFKETEFIAVTAYQNEKITQLKIDNNPFAKGFRDTGAGKREKKQ 523          
BLAST of T-box transcription factor TBX2 vs. Ensembl Fly
Match: bi (gene:FBgn0000179 transcript:FBtr0300609)

HSP 1 Score: 367.466 bits (942), Expect = 5.136e-114
Identity = 169/217 (77.88%), Postives = 190/217 (87.56%), Query Frame = 2
Query:  320 FNPASRNVTE-QINDQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGF---TILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKK 958
             +PA R +   Q  D  + DDPKV L  +DLWE+FH  GTEMVITKSGR+MFP  K +VSGLD +AKYI+L+D+VA DD RYKFHN++WMVAGKADPEMPKRMYIHPDSPTTGEQWMQK++SFHKLKLTNNISDKHGF   TILNSMHKYQPRFHLVRANDI++LPYSTFR+YVFKET+FI VTAYQNEKITQLKID+NPFAKGFRDTG GKREKK+
Sbjct:  307 LHPAMRPLRALQPEDDGVVDDPKVTLEGKDLWEKFHKLGTEMVITKSGRQMFPQMKFRVSGLDAKAKYILLLDIVAADDYRYKFHNSRWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKVVSFHKLKLTNNISDKHGFVSTTILNSMHKYQPRFHLVRANDILKLPYSTFRTYVFKETEFIAVTAYQNEKITQLKIDNNPFAKGFRDTGAGKREKKQ 523          
BLAST of T-box transcription factor TBX2 vs. Ensembl Zebrafish
Match: tbx2a (T-box transcription factor 2a [Source:ZFIN;Acc:ZDB-GENE-990917-4])

HSP 1 Score: 371.318 bits (952), Expect = 1.912e-118
Identity = 162/200 (81.00%), Postives = 187/200 (93.50%), Query Frame = 2
Query:  359 DQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKK 958
            ++D++DDPKV L  ++LW+QFH  GTEMVITKSGRRMFPP+KV+V+GLDK+AKYI+LMD+VA DDCRYKFHN++WMVAGKADPEMPKRMYIHPDSP TGEQWM K ++FHKLKLTNNISDKHGFTILNSMHKYQPRFH+VRANDI++LPYSTFR+YVF ET FI VTAYQN+KITQLKID+NPFAKGFRDTG G+REK+K
Sbjct:   76 EEDVEDDPKVTLEAKELWDQFHKIGTEMVITKSGRRMFPPFKVRVNGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMAKPVAFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTYVFPETDFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRK 275          
BLAST of T-box transcription factor TBX2 vs. Ensembl Zebrafish
Match: tbx2a (T-box transcription factor 2a [Source:ZFIN;Acc:ZDB-GENE-990917-4])

HSP 1 Score: 371.318 bits (952), Expect = 2.881e-118
Identity = 162/200 (81.00%), Postives = 187/200 (93.50%), Query Frame = 2
Query:  359 DQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKK 958
            ++D++DDPKV L  ++LW+QFH  GTEMVITKSGRRMFPP+KV+V+GLDK+AKYI+LMD+VA DDCRYKFHN++WMVAGKADPEMPKRMYIHPDSP TGEQWM K ++FHKLKLTNNISDKHGFTILNSMHKYQPRFH+VRANDI++LPYSTFR+YVF ET FI VTAYQN+KITQLKID+NPFAKGFRDTG G+REK+K
Sbjct:   86 EEDVEDDPKVTLEAKELWDQFHKIGTEMVITKSGRRMFPPFKVRVNGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMAKPVAFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTYVFPETDFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRK 285          
BLAST of T-box transcription factor TBX2 vs. Ensembl Zebrafish
Match: tbx3a (T-box transcription factor 3a [Source:ZFIN;Acc:ZDB-GENE-070209-80])

HSP 1 Score: 363.614 bits (932), Expect = 2.855e-115
Identity = 158/192 (82.29%), Postives = 178/192 (92.71%), Query Frame = 2
Query:  383 KVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKK 958
            KV L  ++LWE FH  GTEMVITKSGRRMFPP+KV+ +GLDK+AKYI+LMD+VA DDCRYKFHN++WMVAGKADPEMPKRMYIHPDSP TGEQWM K+++FHKLKLTNNISDKHGFTILNSMHKYQPRFH+VRANDI++LPYSTFR+YVF ET FI VTAYQN+KITQLKIDHNPFAKGFRDTG G+REK+K
Sbjct:   99 KVHLEAKELWELFHKRGTEMVITKSGRRMFPPFKVRCTGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMSKVVNFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTYVFPETDFIAVTAYQNDKITQLKIDHNPFAKGFRDTGNGRREKRK 290          
BLAST of T-box transcription factor TBX2 vs. Ensembl Zebrafish
Match: tbx2b (T-box transcription factor 2b [Source:NCBI gene;Acc:30253])

HSP 1 Score: 360.147 bits (923), Expect = 6.060e-114
Identity = 158/192 (82.29%), Postives = 179/192 (93.23%), Query Frame = 2
Query:  383 KVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKK 958
            KV L  +DLW+QFH  GTEMVITKSGRRMFPP+KV+++GLDK+AKYI+LMD+VA DDCRYKFHN++WMVAGKADPEMPKRMYIHPDSP TGEQWM K ++FHKLKLTNNISDKHGFTILNSMHKYQPRFH+VRANDI++LPYSTFR+YVF ET FI VTAYQN+KITQLKID+NPFAKGFRDTG G+REK+K
Sbjct:   95 KVTLEAKDLWDQFHKLGTEMVITKSGRRMFPPFKVRINGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMAKPVAFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTYVFPETDFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRK 286          
BLAST of T-box transcription factor TBX2 vs. Ensembl Zebrafish
Match: tbx2b (T-box transcription factor 2b [Source:NCBI gene;Acc:30253])

HSP 1 Score: 360.147 bits (923), Expect = 6.060e-114
Identity = 158/192 (82.29%), Postives = 179/192 (93.23%), Query Frame = 2
Query:  383 KVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKK 958
            KV L  +DLW+QFH  GTEMVITKSGRRMFPP+KV+++GLDK+AKYI+LMD+VA DDCRYKFHN++WMVAGKADPEMPKRMYIHPDSP TGEQWM K ++FHKLKLTNNISDKHGFTILNSMHKYQPRFH+VRANDI++LPYSTFR+YVF ET FI VTAYQN+KITQLKID+NPFAKGFRDTG G+REK+K
Sbjct:   95 KVTLEAKDLWDQFHKLGTEMVITKSGRRMFPPFKVRINGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMAKPVAFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTYVFPETDFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRK 286          
BLAST of T-box transcription factor TBX2 vs. Ensembl Xenopus
Match: tbx3 (T-box 3 [Source:NCBI gene;Acc:613116])

HSP 1 Score: 370.933 bits (951), Expect = 8.633e-118
Identity = 169/233 (72.53%), Postives = 195/233 (83.69%), Query Frame = 2
Query:  383 KVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKKLNGSAISTSSDVDNKGNKDNSEEISECSDVNIDIEECLNKT 1081
            KV L  +DLWEQFH  GTEMVITKSGRRMFPP+KV+ SGLDK+AKYI+LMD+VA DDCRYKFHN++WMVAGKADPEMPKRMYIHPDSP TGEQWM K+++FHKLKLTNNISDKHGFTILNSMHKYQPRFH+VRANDI++LPYSTFR+YVF ET+FI VTAYQN+KITQLKID+NPFAKGFRDTG G+REK+K    A+ +    D+   KDN    S+ S       +C  +T
Sbjct:  105 KVHLEGKDLWEQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTYVFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRKQ--LALQSMRPYDDHQKKDNGS--SDESSSEQTAYKCFAQT 333          
BLAST of T-box transcription factor TBX2 vs. Ensembl Xenopus
Match: tbx2 (T-box 2 [Source:NCBI gene;Acc:619588])

HSP 1 Score: 363.614 bits (932), Expect = 3.815e-115
Identity = 164/220 (74.55%), Postives = 189/220 (85.91%), Query Frame = 2
Query:  383 KVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKKLNGSAISTSSDVDNKGNKDNSE-EISEC 1039
            KV L  ++LW+QFH  GTEMVITKSGRRMFPP+KV+VSGLDK+AKYI+LMD+VA DDCRYKFHN++WMVAGKADPEMPKRMYIHPDSP TGEQWM K ++FHKLKLTNNISDKHGFTILNSMHKYQPRFH+VRANDI++LPYSTFR+YVF ET FI VTAYQN+KITQLKID+NPFAKGFRDTG G+REK+K          +   K ++D +E + S C
Sbjct:   96 KVTLEAKELWDQFHKLGTEMVITKSGRRMFPPFKVRVSGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMAKPVAFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTYVFPETDFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRKQLSLPSLRMYEEQCKADRDGAESDASSC 315          
BLAST of T-box transcription factor TBX2 vs. Ensembl Xenopus
Match: TBX4 (T-box 4 [Source:NCBI gene;Acc:100488041])

HSP 1 Score: 249.98 bits (637), Expect = 8.619e-74
Identity = 120/225 (53.33%), Postives = 161/225 (71.56%), Query Frame = 2
Query:  263 QGMTHSSNLANYPFLPPDIFNPASRNVTEQINDQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRA--NDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDT 931
            Q   H+   A  P L     + +  +   Q  +Q I ++ KV L +++LW++FH  GTEM+ITK+GRRMFP YKV+V+G++ + KYI+L+D+V  DD RYKF +N+WMVAGKA+P MP R+Y+HPDSP TG  WM++++SF KLKLTNN  D  G  ILNSMHKYQPR H+V+A  N+      + F ++VF ET FI VT+YQN KITQLKI++NPFAKGFR +
Sbjct:   18 QTAGHAEAAAGSPTLGVAGLSTSLSSPQSQDPEQTI-ENIKVYLHEKELWKKFHEAGTEMIITKAGRRMFPSYKVKVTGMNPKTKYILLIDIVPADDHRYKFCDNKWMVAGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNAFGSKNTAFCTHVFSETSFISVTSYQNHKITQLKIENNPFAKGFRGS 241          
BLAST of T-box transcription factor TBX2 vs. Ensembl Xenopus
Match: TBX4 (T-box 4 [Source:NCBI gene;Acc:100488041])

HSP 1 Score: 248.44 bits (633), Expect = 1.502e-73
Identity = 112/185 (60.54%), Postives = 146/185 (78.92%), Query Frame = 2
Query:  383 KVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRA--NDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDT 931
            KV L +++LW++FH  GTEM+ITK+GRRMFP YKV+V+G++ + KYI+L+D+V  DD RYKF +N+WMVAGKA+P MP R+Y+HPDSP TG  WM++++SF KLKLTNN  D  G  ILNSMHKYQPR H+V+A  N+      + F ++VF ET FI VT+YQN KITQLKI++NPFAKGFR +
Sbjct:   22 KVYLHEKELWKKFHEAGTEMIITKAGRRMFPSYKVKVTGMNPKTKYILLIDIVPADDHRYKFCDNKWMVAGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNAFGSKNTAFCTHVFSETSFISVTSYQNHKITQLKIENNPFAKGFRGS 206          
BLAST of T-box transcription factor TBX2 vs. Ensembl Xenopus
Match: rtraf (RNA transcription, translation and transport factor [Source:Xenbase;Acc:XB-GENE-973282])

HSP 1 Score: 248.054 bits (632), Expect = 2.664e-73
Identity = 113/185 (61.08%), Postives = 143/185 (77.30%), Query Frame = 2
Query:  383 KVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRA--NDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDT 931
            KV L +R+LW +FH  GTEM+ITK+GRRMFP YKV+V+GL+ + KYI+LMD+V  DD RYKF +N+W V GKA+P MP R+Y+HPDSP TG  WM++++SF KLKLTNN  D  G  ILNSMHKYQPR H+V+A  N+      + F ++VF ET FI VT+YQN KITQLKI++NPFAKGFR +
Sbjct:   55 KVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFSETAFIAVTSYQNHKITQLKIENNPFAKGFRGS 239          
BLAST of T-box transcription factor TBX2 vs. Ensembl Mouse
Match: Tbx3 (T-box 3 [Source:MGI Symbol;Acc:MGI:98495])

HSP 1 Score: 376.326 bits (965), Expect = 9.062e-120
Identity = 160/200 (80.00%), Postives = 188/200 (94.00%), Query Frame = 2
Query:  359 DQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKK 958
            ++D++DDPKV L  ++LW+QFH  GTEMVITKSGRRMFPP+KV+ SGLDK+AKYI+LMD++A DDCRYKFHN++WMVAGKADPEMPKRMYIHPDSP TGEQWM K+++FHKLKLTNNISDKHGFTILNSMHKYQPRFH+VRANDI++LPYSTFR+Y+F ET+FI VTAYQN+KITQLKID+NPFAKGFRDTG G+REK+K
Sbjct:   96 EEDVEDDPKVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRK 295          
BLAST of T-box transcription factor TBX2 vs. Ensembl Mouse
Match: Tbx3 (T-box 3 [Source:MGI Symbol;Acc:MGI:98495])

HSP 1 Score: 376.326 bits (965), Expect = 9.062e-120
Identity = 160/200 (80.00%), Postives = 188/200 (94.00%), Query Frame = 2
Query:  359 DQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKK 958
            ++D++DDPKV L  ++LW+QFH  GTEMVITKSGRRMFPP+KV+ SGLDK+AKYI+LMD++A DDCRYKFHN++WMVAGKADPEMPKRMYIHPDSP TGEQWM K+++FHKLKLTNNISDKHGFTILNSMHKYQPRFH+VRANDI++LPYSTFR+Y+F ET+FI VTAYQN+KITQLKID+NPFAKGFRDTG G+REK+K
Sbjct:   96 EEDVEDDPKVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRK 295          
BLAST of T-box transcription factor TBX2 vs. Ensembl Mouse
Match: Tbx2 (T-box 2 [Source:MGI Symbol;Acc:MGI:98494])

HSP 1 Score: 372.474 bits (955), Expect = 2.287e-118
Identity = 169/230 (73.48%), Postives = 197/230 (85.65%), Query Frame = 2
Query:  275 HSSNLANYPFLPPDIFNPAS--RNVTEQINDQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKK 958
            H S L  +P        PA+  R++     + +++DDPKV L  ++LW+QFH  GTEMVITKSGRRMFPP+KV+VSGLDK+AKYI+LMD+VA DDCRYKFHN++WMVAGKADPEMPKRMYIHPDSP TGEQWM K ++FHKLKLTNNISDKHGFTILNSMHKYQPRFH+VRANDI++LPYSTFR+YVF ET FI VTAYQN+KITQLKID+NPFAKGFRDTG G+REK+K
Sbjct:   76 HVSALGPHP--------PAAHLRSLKSLEPEDEVEDDPKVTLEAKELWDQFHKLGTEMVITKSGRRMFPPFKVRVSGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMAKPVAFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTYVFPETDFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRK 297          
BLAST of T-box transcription factor TBX2 vs. Ensembl Mouse
Match: Tbx3 (T-box 3 [Source:MGI Symbol;Acc:MGI:98495])

HSP 1 Score: 363.999 bits (933), Expect = 7.265e-115
Identity = 160/220 (72.73%), Postives = 188/220 (85.45%), Query Frame = 2
Query:  359 DQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGF--------------------TILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKK 958
            ++D++DDPKV L  ++LW+QFH  GTEMVITKSGRRMFPP+KV+ SGLDK+AKYI+LMD++A DDCRYKFHN++WMVAGKADPEMPKRMYIHPDSP TGEQWM K+++FHKLKLTNNISDKHGF                    TILNSMHKYQPRFH+VRANDI++LPYSTFR+Y+F ET+FI VTAYQN+KITQLKID+NPFAKGFRDTG G+REK+K
Sbjct:   96 EEDVEDDPKVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFTLAFPSDHATWQGNYSFGTQTILNSMHKYQPRFHIVRANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRK 315          
BLAST of T-box transcription factor TBX2 vs. Ensembl Mouse
Match: Tbx4 (T-box 4 [Source:MGI Symbol;Acc:MGI:102556])

HSP 1 Score: 250.366 bits (638), Expect = 7.352e-74
Identity = 112/185 (60.54%), Postives = 146/185 (78.92%), Query Frame = 2
Query:  383 KVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRA--NDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDT 931
            KV L +++LW++FH  GTEM+ITK+GRRMFP YKV+V+G++ + KYI+L+D+V  DD RYKF +N+WMVAGKA+P MP R+Y+HPDSP TG  WM++++SF KLKLTNN  D  G  ILNSMHKYQPR H+V+A  N+      + F ++VF ET FI VT+YQN KITQLKI++NPFAKGFR +
Sbjct:   73 KVGLHEKELWKKFHEAGTEMIITKAGRRMFPSYKVKVTGMNPKTKYILLIDIVPADDHRYKFCDNKWMVAGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNAFGSKNTAFCTHVFPETSFISVTSYQNHKITQLKIENNPFAKGFRGS 257          
BLAST of T-box transcription factor TBX2 vs. UniProt/SwissProt
Match: sp|Q6PCL0|TBX2B_XENLA (T-box transcription factor TBX2-B OS=Xenopus laevis OX=8355 GN=tbx2-b PE=2 SV=2)

HSP 1 Score: 375.555 bits (963), Expect = 6.564e-119
Identity = 169/236 (71.61%), Postives = 199/236 (84.32%), Query Frame = 2
Query:  335 RNVTEQINDQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKKLNGSAISTSSDVDNKGNKDNSE-EISEC 1039
            R++     ++++ DDPKV L  ++LW+QFH  GTEMVITKSGRRMFPP+KV+VSGLDK+AKYI+LMD+VA DDCRYKFHN++WMVAGKADPEMPKRMYIHPDSP TGEQWM K ++FHKLKLTNNISDKHGFTILNSMHKYQPRFH+VRANDI++LPYSTFR+YVF ET FI VTAYQN+KITQLKIDHNPFAKGFRDTG G+REK+K          +   K ++D +E + S C
Sbjct:   80 RSLKSLEPEEEVDDDPKVNLEAKELWDQFHKIGTEMVITKSGRRMFPPFKVRVSGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMAKPVAFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTYVFPETDFIAVTAYQNDKITQLKIDHNPFAKGFRDTGNGRREKRKQLSLPSLRMYEEQCKADRDGAESDASSC 315          
BLAST of T-box transcription factor TBX2 vs. UniProt/SwissProt
Match: sp|Q13207|TBX2_HUMAN (T-box transcription factor TBX2 OS=Homo sapiens OX=9606 GN=TBX2 PE=1 SV=3)

HSP 1 Score: 374.4 bits (960), Expect = 2.910e-118
Identity = 163/208 (78.37%), Postives = 189/208 (90.87%), Query Frame = 2
Query:  335 RNVTEQINDQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKK 958
            R++     + +++DDPKV L  ++LW+QFH  GTEMVITKSGRRMFPP+KV+VSGLDK+AKYI+LMD+VA DDCRYKFHN++WMVAGKADPEMPKRMYIHPDSP TGEQWM K ++FHKLKLTNNISDKHGFTILNSMHKYQPRFH+VRANDI++LPYSTFR+YVF ET FI VTAYQN+KITQLKID+NPFAKGFRDTG G+REK+K
Sbjct:   90 RSLKSLEPEDEVEDDPKVTLEAKELWDQFHKLGTEMVITKSGRRMFPPFKVRVSGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMAKPVAFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTYVFPETDFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRK 297          
BLAST of T-box transcription factor TBX2 vs. UniProt/SwissProt
Match: sp|Q863A2|TBX2_CANLF (T-box transcription factor TBX2 OS=Canis lupus familiaris OX=9615 GN=TBX2 PE=3 SV=2)

HSP 1 Score: 373.244 bits (957), Expect = 7.648e-118
Identity = 163/208 (78.37%), Postives = 189/208 (90.87%), Query Frame = 2
Query:  335 RNVTEQINDQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKK 958
            R++     + +++DDPKV L  ++LW+QFH  GTEMVITKSGRRMFPP+KV+VSGLDK+AKYI+LMD+VA DDCRYKFHN++WMVAGKADPEMPKRMYIHPDSP TGEQWM K ++FHKLKLTNNISDKHGFTILNSMHKYQPRFH+VRANDI++LPYSTFR+YVF ET FI VTAYQN+KITQLKID+NPFAKGFRDTG G+REK+K
Sbjct:   90 RSLKSLEPEDEVEDDPKVTLEAKELWDQFHKLGTEMVITKSGRRMFPPFKVRVSGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMAKPVAFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTYVFPETDFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRK 297          
BLAST of T-box transcription factor TBX2 vs. UniProt/SwissProt
Match: sp|Q60707|TBX2_MOUSE (T-box transcription factor TBX2 OS=Mus musculus OX=10090 GN=Tbx2 PE=1 SV=3)

HSP 1 Score: 372.474 bits (955), Expect = 1.600e-117
Identity = 169/230 (73.48%), Postives = 197/230 (85.65%), Query Frame = 2
Query:  275 HSSNLANYPFLPPDIFNPAS--RNVTEQINDQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKK 958
            H S L  +P        PA+  R++     + +++DDPKV L  ++LW+QFH  GTEMVITKSGRRMFPP+KV+VSGLDK+AKYI+LMD+VA DDCRYKFHN++WMVAGKADPEMPKRMYIHPDSP TGEQWM K ++FHKLKLTNNISDKHGFTILNSMHKYQPRFH+VRANDI++LPYSTFR+YVF ET FI VTAYQN+KITQLKID+NPFAKGFRDTG G+REK+K
Sbjct:   76 HVSALGPHP--------PAAHLRSLKSLEPEDEVEDDPKVTLEAKELWDQFHKLGTEMVITKSGRRMFPPFKVRVSGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMAKPVAFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTYVFPETDFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRK 297          
BLAST of T-box transcription factor TBX2 vs. UniProt/SwissProt
Match: sp|O73718|TBX3_CHICK (T-box transcription factor TBX3 (Fragment) OS=Gallus gallus OX=9031 GN=TBX3 PE=2 SV=1)

HSP 1 Score: 361.303 bits (926), Expect = 4.214e-117
Identity = 158/192 (82.29%), Postives = 180/192 (93.75%), Query Frame = 2
Query:  383 KVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKK 958
            KV L  ++LWEQFH  GTEMVITKSGRRMFPP+KV+ +GLDK+AKYI+LMD+VA DDCRYKFHN++WMVAGKADPEMPKRMYIHPDSP TGEQWM K+++FHKLKLTNNISDKHGFTILNSMHKYQPRFH+VRANDI++LPYSTFR+YVF ET+FI VTAYQN+KITQLKID+NPFAKGFRDTG G+REK+K
Sbjct:  106 KVHLEAKELWEQFHKRGTEMVITKSGRRMFPPFKVRCTGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTYVFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRK 297          
BLAST of T-box transcription factor TBX2 vs. TrEMBL
Match: A0A5P8I4J3 (T-box 2/3c protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1282.7 bits (3318), Expect = 0.000e+0
Identity = 638/638 (100.00%), Postives = 638/638 (100.00%), Query Frame = 2
Query:  116 MAFNPFLGIHSYHSNRNVTDHPFINSATAXXXXXXXXXXXNYGNLLMGKQGMTHSSNLANYPFLPPDIFNPASRNVTEQINDQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKKLNGSAISTSSDVDNKGNKDNSEEISECSDVNIDIEECLNKTDLKQINDKNPDFNELSINICSSKLKRKHLNFEVSPLDANHNKASKKLKNQEDNFNLTPDSSSQSTSIGKHKQDTQLEFEKSLRGNISPNKNTELFEHPDSTDNLHSANSVSIKDNFPPPNVTVLPSSANSFIHQPWLISPGLNTSRSSHLINSANKLIPPMFSYSSIPSIQKDLNDFHDSNSSFKTLSLNSLSQKFPSIFMSNHNSINNIFLPSMFQNNILKSRFKTHPSYLHPSPSPRTNQANFSTLAFAAAMASLTKSSDFFNHKFQESEPFIKEDNKFTEKNSVNVKKKRIKADLSNIDTLISHPNSPSNNDE 2029
            MAFNPFLGIHSYHSNRNVTDHPFINSATASFLPSLSSFPLNYGNLLMGKQGMTHSSNLANYPFLPPDIFNPASRNVTEQINDQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKKLNGSAISTSSDVDNKGNKDNSEEISECSDVNIDIEECLNKTDLKQINDKNPDFNELSINICSSKLKRKHLNFEVSPLDANHNKASKKLKNQEDNFNLTPDSSSQSTSIGKHKQDTQLEFEKSLRGNISPNKNTELFEHPDSTDNLHSANSVSIKDNFPPPNVTVLPSSANSFIHQPWLISPGLNTSRSSHLINSANKLIPPMFSYSSIPSIQKDLNDFHDSNSSFKTLSLNSLSQKFPSIFMSNHNSINNIFLPSMFQNNILKSRFKTHPSYLHPSPSPRTNQANFSTLAFAAAMASLTKSSDFFNHKFQESEPFIKEDNKFTEKNSVNVKKKRIKADLSNIDTLISHPNSPSNNDE
Sbjct:    1 MAFNPFLGIHSYHSNRNVTDHPFINSATASFLPSLSSFPLNYGNLLMGKQGMTHSSNLANYPFLPPDIFNPASRNVTEQINDQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKKLNGSAISTSSDVDNKGNKDNSEEISECSDVNIDIEECLNKTDLKQINDKNPDFNELSINICSSKLKRKHLNFEVSPLDANHNKASKKLKNQEDNFNLTPDSSSQSTSIGKHKQDTQLEFEKSLRGNISPNKNTELFEHPDSTDNLHSANSVSIKDNFPPPNVTVLPSSANSFIHQPWLISPGLNTSRSSHLINSANKLIPPMFSYSSIPSIQKDLNDFHDSNSSFKTLSLNSLSQKFPSIFMSNHNSINNIFLPSMFQNNILKSRFKTHPSYLHPSPSPRTNQANFSTLAFAAAMASLTKSSDFFNHKFQESEPFIKEDNKFTEKNSVNVKKKRIKADLSNIDTLISHPNSPSNNDE 638          
BLAST of T-box transcription factor TBX2 vs. TrEMBL
Match: F1CDF0 (TBX2/3c (Fragment) OS=Schmidtea polychroa OX=50054 PE=2 SV=1)

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 283/288 (98.26%), Postives = 285/288 (98.96%), Query Frame = 2
Query:  497 GLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKKLNGSAISTSSDVDNKGNKDNSEEISECSDVNIDIEECLNKTDLKQINDKNPDFNELSINICSSKLKRKHLNFEVSPLDANHNKASKKLKNQEDNFNLTPDSSSQSTSIGKHKQDTQLEFEKSLRGNISPNKNTE 1360
            GLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKKLNGSAISTSSDVDNKGNKDNSEEISECSDVNIDIEECLNK DLKQINDKNPDFNELSINICSSKLKRKHL+FE SPLDANHNKASKKLKNQE+NFNLTPDSSSQSTSIGKHKQDTQLEFEKSL GNISPNKNTE
Sbjct:    1 GLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKKLNGSAISTSSDVDNKGNKDNSEEISECSDVNIDIEECLNKNDLKQINDKNPDFNELSINICSSKLKRKHLSFEASPLDANHNKASKKLKNQEENFNLTPDSSSQSTSIGKHKQDTQLEFEKSLHGNISPNKNTE 288          
BLAST of T-box transcription factor TBX2 vs. TrEMBL
Match: K1Q595 (T-box transcription factor TBX2 OS=Crassostrea gigas OX=29159 GN=CGI_10016325 PE=4 SV=1)

HSP 1 Score: 391.734 bits (1005), Expect = 1.042e-128
Identity = 182/247 (73.68%), Postives = 210/247 (85.02%), Query Frame = 2
Query:  365 DIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKKLNGSAISTSSDV---------DNKGNKDNSEEISECSDVNIDIEECLNK 1078
            D +DDPKVE+  ++LWEQFH  GTEMVITKSGRRMFPPYKV+VSGLDKRAKYI+LMD+VAVDDCRYKFHN++WMVAGKADPEMPKRMYIHPDSP+TGEQWMQK++SFHKLKLTNNISDKHG+TILNSMHKYQPRFHLVRANDI++LPYS FR+YVFKET+FI VTAYQNEKITQLKID+NPFAKGFRD+G GKREKK+L  S+I  SS           D + ++D+   + E  DV  D    L++
Sbjct:    6 DAQDDPKVEIESKELWEQFHNLGTEMVITKSGRRMFPPYKVRVSGLDKRAKYILLMDIVAVDDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPSTGEQWMQKVVSFHKLKLTNNISDKHGYTILNSMHKYQPRFHLVRANDILKLPYSAFRTYVFKETEFIAVTAYQNEKITQLKIDNNPFAKGFRDSGSGKREKKRLLMSSIHQSSTAYTDEGSRVDDPQSDEDDEICVDETDDVTEDTVSILSR 252          
BLAST of T-box transcription factor TBX2 vs. TrEMBL
Match: A0A1S3H0C4 (T-box protein 2 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106150959 PE=4 SV=1)

HSP 1 Score: 402.905 bits (1034), Expect = 2.073e-127
Identity = 191/257 (74.32%), Postives = 214/257 (83.27%), Query Frame = 2
Query:  359 DQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKKLNGSAISTSSDVDNKGNKDNS-----EEISECSDVNIDIEECLNKTD-LKQINDKNP 1111
            + D++DDPKVEL  RDLW+QFH  GTEMVITKSGRRMFP YKV+VSGLDKRAKYI+LMD+VAVDDCRYKFHN++WMVAGKADPEMPKRMYIHPDSP TGEQWMQKI+SFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDI++LPYS FR+YVFKET FI VTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKK+L     S ++   NK + D+S     E+  E   V  D EE     D L++ +  +P
Sbjct:   86 EADVQDDPKVELEGRDLWDQFHNIGTEMVITKSGRRMFPAYKVKVSGLDKRAKYILLMDIVAVDDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMQKIVSFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDILKLPYSAFRTYVFKETAFIAVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKRLMAQQ-SLAAHPPNKMDPDDSLHSDDEDNEEICVVEEDEEEATRIADQLRESSGHSP 341          
BLAST of T-box transcription factor TBX2 vs. TrEMBL
Match: V4AP94 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_116991 PE=4 SV=1)

HSP 1 Score: 387.111 bits (993), Expect = 2.230e-127
Identity = 178/222 (80.18%), Postives = 202/222 (90.99%), Query Frame = 2
Query:  299 PFLPPDIF-NPASRNVTEQIN--DQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKK 955
            P LP ++F +P        +   D D++DDPKV+L ++DLWEQFH +GTEMVITKSGRRMFPP+KV+VSGLDK+AKYI+LMD+VAVDDCRYKFHN++WMVAGKADPEMPKRMYIHPDSP+TGEQWMQKI+SFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDI++LPYS FR+YVFKE +FI VTAYQNEKITQLKI+HNPFAKGFRDTGGGKREKK
Sbjct:    5 PLLPGELFPHPDHFRTMRGLEPPDNDVQDDPKVDLEEKDLWEQFHKFGTEMVITKSGRRMFPPFKVKVSGLDKKAKYILLMDIVAVDDCRYKFHNSKWMVAGKADPEMPKRMYIHPDSPSTGEQWMQKIVSFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDILKLPYSAFRTYVFKEMEFIAVTAYQNEKITQLKINHNPFAKGFRDTGGGKREKK 226          
BLAST of T-box transcription factor TBX2 vs. Ensembl Cavefish
Match: tbx3a (T-box transcription factor 3 [Source:NCBI gene;Acc:103021647])

HSP 1 Score: 363.229 bits (931), Expect = 5.441e-115
Identity = 158/192 (82.29%), Postives = 178/192 (92.71%), Query Frame = 2
Query:  383 KVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKK 958
            KV L  ++LWE FH  GTEMVITKSGRRMFPP+KV+ +GLDK+AKYI+LMD+VA DDCRYKFHN++WMVAGKADPEMPKRMYIHPDSP TGEQWM K+++FHKLKLTNNISDKHGFTILNSMHKYQPRFH+VRANDI++LPYSTFR+YVF ET FI VTAYQN+KITQLKIDHNPFAKGFRDTG G+REK+K
Sbjct:  107 KVHLEAKELWELFHKCGTEMVITKSGRRMFPPFKVRCTGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMSKVVNFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTYVFPETDFIAVTAYQNDKITQLKIDHNPFAKGFRDTGNGRREKRK 298          
BLAST of T-box transcription factor TBX2 vs. Ensembl Cavefish
Match: tbx2b (T-box transcription factor 2 [Source:NCBI gene;Acc:103034102])

HSP 1 Score: 360.533 bits (924), Expect = 3.307e-114
Identity = 158/192 (82.29%), Postives = 180/192 (93.75%), Query Frame = 2
Query:  383 KVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKK 958
            KV L  +DLW+QFH  GTEMVITKSGRRMFPP+KV+++GLDK+AKYI+LMD+VA DDCRYKFHN++WMVAGKADPEMPKRMYIHPDSP TGEQWM K ++FHKLKLTNNISDKHGFTILNSMHKYQPRFH+VRANDI++LPYSTFR+YVF ET+FI VTAYQN+KITQLKID+NPFAKGFRDTG G+REK+K
Sbjct:   94 KVTLEAKDLWDQFHKLGTEMVITKSGRRMFPPFKVRINGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMAKPVAFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTYVFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRK 285          
BLAST of T-box transcription factor TBX2 vs. Ensembl Cavefish
Match: tbx4 (T-box transcription factor 4 [Source:NCBI gene;Acc:103036927])

HSP 1 Score: 253.832 bits (647), Expect = 3.682e-75
Identity = 118/205 (57.56%), Postives = 156/205 (76.10%), Query Frame = 2
Query:  359 DQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRA--NDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKKLNG 967
            DQ+I++  KV L +R+LW++FH  GTEM+ITK+GRRMFP YKV+V+G++ + KYI+L+D+V  DD RYKF +N+WMVAGKA+P MP R+Y+HPDSP TG  WM++++SF KLKLTNN  D  G  ILNSMHKYQPR H+V+A  N+      + + ++VF ET FI VT+YQN KITQLKI++NPFAKGFR +  G     +L G
Sbjct:   47 DQNIENI-KVLLHERELWKKFHEAGTEMIITKAGRRMFPSYKVKVTGMNPKTKYILLIDIVPADDHRYKFCDNKWMVAGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNAFGSKNTAYCTHVFHETTFISVTSYQNHKITQLKIENNPFAKGFRGSDEGDLRVSRLQG 250          
BLAST of T-box transcription factor TBX2 vs. Ensembl Cavefish
Match: tbx4 (T-box transcription factor 4 [Source:NCBI gene;Acc:103036927])

HSP 1 Score: 253.832 bits (647), Expect = 3.682e-75
Identity = 118/205 (57.56%), Postives = 156/205 (76.10%), Query Frame = 2
Query:  359 DQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRA--NDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKKLNG 967
            DQ+I++  KV L +R+LW++FH  GTEM+ITK+GRRMFP YKV+V+G++ + KYI+L+D+V  DD RYKF +N+WMVAGKA+P MP R+Y+HPDSP TG  WM++++SF KLKLTNN  D  G  ILNSMHKYQPR H+V+A  N+      + + ++VF ET FI VT+YQN KITQLKI++NPFAKGFR +  G     +L G
Sbjct:   47 DQNIENI-KVLLHERELWKKFHEAGTEMIITKAGRRMFPSYKVKVTGMNPKTKYILLIDIVPADDHRYKFCDNKWMVAGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNAFGSKNTAYCTHVFHETTFISVTSYQNHKITQLKIENNPFAKGFRGSDEGDLRVSRLQG 250          
BLAST of T-box transcription factor TBX2 vs. Ensembl Cavefish
Match: tbx20 (T-box transcription factor 20 [Source:NCBI gene;Acc:103046636])

HSP 1 Score: 240.736 bits (613), Expect = 1.175e-71
Identity = 106/186 (56.99%), Postives = 144/186 (77.42%), Query Frame = 2
Query:  392 LIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKF--HNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRAND----IMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDT 931
            L  ++LW++FH  GTEM+ITKSGRRMFP  +V  SG++   +YI+LMD++AVD+ RY++  H + W+VAGKADP +P R+Y+HPDSP TGEQ +++++SF K+KLTNN  D+HG  ILNSMHKYQPR H+++  +    ++ L    FRS++F ETQF  VTAYQN+ IT+LKID NPFAKGFRD+
Sbjct:   98 LETKELWDKFHELGTEMIITKSGRRMFPTIRVSFSGVEPDCRYIVLMDIIAVDNKRYRYAYHRSSWLVAGKADPPLPARLYVHPDSPFTGEQLLKQMVSFEKVKLTNNELDQHGHIILNSMHKYQPRVHIIKKKEHTASLLNLKSDEFRSFIFTETQFTAVTAYQNQLITKLKIDSNPFAKGFRDS 283          
BLAST of T-box transcription factor TBX2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004087.1 (pep scaffold:Pmarinus_7.0:GL483204:5206:18999:-1 gene:ENSPMAG00000003745.1 transcript:ENSPMAT00000004087.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 216.853 bits (551), Expect = 7.234e-67
Identity = 102/174 (58.62%), Postives = 130/174 (74.71%), Query Frame = 2
Query:  422 HAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKF--HNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRAND----IMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFR 925
            H  GTEM+ITKSGRRMFP  +V   G++  AKYI+LMD+V VD+ RY++  H + W+VAGKADP +P R+Y+HPDSP  GEQ  ++++SF KLKLTNN  D+HG  ILNSMHKYQPR H+++  D    ++ L    FR++VF ET F  VTAYQN+ IT+LKID NPFAKGFR
Sbjct:    1 HELGTEMIITKSGRRMFPTIRVSFGGVEPDAKYIVLMDIVPVDNKRYRYAYHRSSWLVAGKADPPLPARLYVHPDSPFAGEQLHKQMVSFEKLKLTNNELDQHGHIILNSMHKYQPRVHIIKKMDHTSSLVNLKSEEFRTFVFPETVFTAVTAYQNQLITKLKIDSNPFAKGFR 174          
BLAST of T-box transcription factor TBX2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008915.1 (pep scaffold:Pmarinus_7.0:GL481372:6049:9031:1 gene:ENSPMAG00000008071.1 transcript:ENSPMAT00000008915.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 165.236 bits (417), Expect = 1.007e-47
Identity = 84/178 (47.19%), Postives = 115/178 (64.61%), Query Frame = 2
Query:  404 DLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHN--NQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYS-TFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRD 928
            +LW +FHA GTEM+ITKSG +        V  L  R + I   ++V  D+ +YK+     +W  +G A+  MP R+Y+HP SP++G QWM++ +SFHK KLTNN   K G  IL+SMHKYQP F++VR  D   +  + +  ++ F +T FI VTAYQN  IT+LKI  NPFAKGFR+
Sbjct:    9 ELWRKFHAIGTEMIITKSGSKW-------VIALSPRGRQIK-XELVPADEVKYKWREAEERWEASGPAELSMPSRLYVHPSSPSSGAQWMRQPVSFHKAKLTNNALSKSGHLILHSMHKYQPCFYVVRDTDWRGVAAAHSPLTFSFPDTTFIAVTAYQNSLITKLKIATNPFAKGFRE 178          
BLAST of T-box transcription factor TBX2 vs. Ensembl Sea Lamprey
Match: TBR1 (T-box brain transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:11590])

HSP 1 Score: 174.096 bits (440), Expect = 7.259e-47
Identity = 93/187 (49.73%), Postives = 119/187 (63.64%), Query Frame = 2
Query:  389 ELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPK-RMYIHPDSPTTGEQWMQKIISFHKLKLTNN---ISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYST---FRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRD 928
            +L +R LW +FH + T  +IT+ G RMFP     VSGLD  A Y + +DVV  D   ++F   +W+  GKAD  +   RMY+HPDSP TG  WM++ ISF KLKLTNN    ++     +L S+HKYQPR H+V  N+      +     +++ F ETQFI VTAYQN  ITQLKIDHNPFAKGFRD
Sbjct:  115 DLCNRALWIKFHRHFTNRLITRVGMRMFPFLSFTVSGLDPTAHYNIFVDVVLADPNHWRFQGGKWVPCGKADTNVQGNRMYLHPDSPNTGAHWMRQEISFGKLKLTNNKGGTNNTGQMIVLQSLHKYQPRLHVVEVNEEGVEDATQPGRAQTFTFPETQFIAVTAYQNTDITQLKIDHNPFAKGFRD 301          
BLAST of T-box transcription factor TBX2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007664.1 (pep scaffold:Pmarinus_7.0:GL477495:60408:67857:-1 gene:ENSPMAG00000006925.1 transcript:ENSPMAT00000007664.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 174.096 bits (440), Expect = 1.831e-45
Identity = 78/180 (43.33%), Postives = 116/180 (64.44%), Query Frame = 2
Query:  383 KVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDI---MRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFA 913
            +V L +R++WE+FH++GTEM++TK+GRRMFP  + +V GLD ++ Y+M +DVV VD  RY++    WM   +  P++P  +Y+H +    G  WM + ISF ++KLTN    + G   L  M KY  RFH++RAN +   +RL      +++F +T+F  VTAYQN  IT LKI H+P A
Sbjct:    3 QVTLDNREVWERFHSWGTEMILTKTGRRMFPYCRYKVRGLDPQSCYLMAIDVVPVDGHRYRWGEGCWMPIERGKPQIPDSVYVHQEGVAPGSFWMYESISFSEVKLTNTALGQDGVISLIPMFKYVTRFHIIRANKVPRHLRLDADNVHTFIFPQTEFFAVTAYQNTAITHLKISHSPLA 182          
BLAST of T-box transcription factor TBX2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004398.1 (pep scaffold:Pmarinus_7.0:GL481394:165233:166024:1 gene:ENSPMAG00000004017.1 transcript:ENSPMAT00000004398.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.916 bits (263), Expect = 2.897e-27
Identity = 54/130 (41.54%), Postives = 81/130 (62.31%), Query Frame = 2
Query:  239 YGNLLMGKQGMTHSSNLANYPFLPPDIFNPASRNVTEQINDQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYK--FHNNQWMVAGKADPEMPKR 622
            YG+   G+ G  H  ++      P D++    RN     +DQ++       L  ++LW++FH  GTEM+ITKSGRRMFP  +V +SG++  A+YI+LMD++ VD  RY+  +H + W+VAGKADP +P R
Sbjct:    2 YGSAEAGEVG-AHKEDII---LAPKDLYQ--RRNSAAPCSDQELAR-IACALETKELWDKFHELGTEMIITKSGRRMFPTIRVSLSGVEPDARYIVLMDIIPVDQKRYRYAYHRSCWLVAGKADPPLPSR 124          
BLAST of T-box transcription factor TBX2 vs. Ensembl Nematostella
Match: EDO41888 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S327])

HSP 1 Score: 291.197 bits (744), Expect = 1.382e-94
Identity = 131/191 (68.59%), Postives = 159/191 (83.25%), Query Frame = 2
Query:  383 KVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYST-FRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREK 952
            ++ L ++DLW+ FHA  TEMVITK+GRRMFPP K ++SGLD RAKY  L+D++  DDCRYKFHN +WMVAGKADPE+ K +YIHPDSP+TG QWMQK ISFHK+KLTNNI+DKHG+TILNSMHKYQPR H+VRA+D  + P +  F+++ F ET FI VTAYQNEKITQLKID+NPFAKGFR+ G G R +
Sbjct:    5 EILLDNKDLWQSFHAEKTEMVITKAGRRMFPPIKARISGLDPRAKYFFLLDIIPADDCRYKFHNCRWMVAGKADPELDKPLYIHPDSPSTGTQWMQKTISFHKMKLTNNIADKHGYTILNSMHKYQPRIHIVRADDGYKYPLNQPFKTFTFPETTFIAVTAYQNEKITQLKIDNNPFAKGFREEGAGHRRR 195          
BLAST of T-box transcription factor TBX2 vs. Ensembl Nematostella
Match: EDO41889 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S328])

HSP 1 Score: 237.269 bits (604), Expect = 1.885e-73
Identity = 107/187 (57.22%), Postives = 144/187 (77.01%), Query Frame = 2
Query:  383 KVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRAND--IMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGG 937
            +VEL +R+LWE+FH  GTEM+ITK+GRRMFP  +V +SGL+ + +Y++ MD+V  D+ RYK+HN +W + GKA+  +P R++IHPDSP TG QWM+++ISF KLKLTNN +D+ G  ILNSMHKYQPR H++   D  +  +   TF +Y F+ET F+ VTAYQN +ITQLKI++NPFAKGFR  GG
Sbjct:   34 QVELENRELWEKFHEIGTEMIITKNGRRMFPVIRVNISGLNPKEEYVLAMDLVPADENRYKYHNTEWAITGKAENLIPSRIFIHPDSPGTGSQWMRQVISFQKLKLTNNHNDQAGHVILNSMHKYQPRIHIIPTKDYNVFSMKKGTFYTYQFQETTFMAVTAYQNPRITQLKIENNPFAKGFR--GG 218          
BLAST of T-box transcription factor TBX2 vs. Ensembl Nematostella
Match: EDO35086 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMK2])

HSP 1 Score: 231.876 bits (590), Expect = 4.902e-72
Identity = 108/189 (57.14%), Postives = 143/189 (75.66%), Query Frame = 2
Query:  401 RDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYK--FHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRA----------NDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDT 931
            ++LW++F+  GTEM++TK+GRRMFPP++V++ GL+   KYI++MD V VDD RY+  FH+++W+VAGKADP +P R++IHPDSP TG QWM++I+SF KLKLTNN+ D +G  ILNSMHKYQPRFH+V            ND+ R      +++VF E+QF+ VTAYQN  ITQLKI  NPFAKGFRD 
Sbjct:    2 KNLWDEFYTLGTEMIVTKAGRRMFPPFQVRLYGLEPNVKYILMMDFVPVDDKRYRYAFHSSKWLVAGKADPSVPGRVHIHPDSPCTGAQWMKQIVSFDKLKLTNNLMDDNGHIILNSMHKYQPRFHVVLVTSDKNANANLNDVNR---DHIKTFVFPESQFMAVTAYQNHMITQLKIASNPFAKGFRDC 187          
BLAST of T-box transcription factor TBX2 vs. Ensembl Nematostella
Match: EDO37185 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGG8])

HSP 1 Score: 231.491 bits (589), Expect = 1.338e-71
Identity = 107/188 (56.91%), Postives = 141/188 (75.00%), Query Frame = 2
Query:  386 VELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKF--HNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRAND----IMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDT 931
            VEL  R+LWE+F   GTEM+ITK+GRRMFP  ++ VSG+  +A Y++L+D+V VDD RY++  H + W+VAGKADP  P R+Y+HPDSP TGEQ +++IISF K+KLTNN +D +G  ILNSMHKYQPR H++R  D    ++ L     +++ F  T FI VTAYQN+ IT+LKID NPFAKGFRD+
Sbjct:    9 VELEGRELWERFSELGTEMIITKAGRRMFPTLRISVSGVQPKANYMVLLDIVPVDDKRYRYAYHRSTWLVAGKADPPAPVRLYMHPDSPFTGEQLLKQIISFEKVKLTNNDTDHNGHLILNSMHKYQPRIHVIRKRDHTASVINLKSERMKTFTFPSTTFIAVTAYQNQLITRLKIDSNPFAKGFRDS 196          
BLAST of T-box transcription factor TBX2 vs. Ensembl Nematostella
Match: EDO46664 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPC8])

HSP 1 Score: 230.72 bits (587), Expect = 1.732e-71
Identity = 108/192 (56.25%), Postives = 143/192 (74.48%), Query Frame = 2
Query:  383 KVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKF--HNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDI------MRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTG 934
            +VEL   DLW +F+  GTEM+ITK+GRRMFP  +V+VSGLD  A YI++MDV+ +D  RY++  H+++W+VAG AD  MP R+YIHPDSP  GE+WM++I+SF K+KLTNN  D+ G  IL+SMHKYQPR H++R  D       +  P S  +++ F ET F  VTAYQN++IT+LKID NPFAKGFRD+G
Sbjct:    2 RVELQMHDLWRRFYELGTEMIITKAGRRMFPAIRVKVSGLDLHAHYILVMDVIPLDGKRYRYAYHSSKWVVAGNADAPMPGRVYIHPDSPALGEEWMRQIVSFDKVKLTNNELDQQGHIILHSMHKYQPRIHIIRKKDTSEASIDIDRPCSERKTFTFSETVFTTVTAYQNQQITRLKIDSNPFAKGFRDSG 193          
BLAST of T-box transcription factor TBX2 vs. Ensembl Medaka
Match: TBX2 (T-box transcription factor 2 [Source:NCBI gene;Acc:100049371])

HSP 1 Score: 372.474 bits (955), Expect = 7.845e-119
Identity = 160/200 (80.00%), Postives = 187/200 (93.50%), Query Frame = 2
Query:  359 DQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKK 958
            ++++ DDPKV L  +DLW+QFH  GTEMVITKSGRRMFPP+KV+++GLDK+AKYI+LMD+VA DDCRYKFHN++WMVAGKADPEMPKRMYIHPDSP TGEQWM K ++FHKLKLTNNISDKHGFTILNSMHKYQPRFH+VRANDI++LPYSTFR+YVF ET+F+ VTAYQN+KITQLKID+NPFAKGFRDTG G+REK+K
Sbjct:   86 EEEVDDDPKVTLEAKDLWDQFHKLGTEMVITKSGRRMFPPFKVRINGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMAKPVAFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTYVFPETEFVAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRK 285          
BLAST of T-box transcription factor TBX2 vs. Ensembl Medaka
Match: tbx3a (T-box transcription factor 3 [Source:NCBI gene;Acc:100049473])

HSP 1 Score: 355.525 bits (911), Expect = 6.106e-112
Identity = 158/197 (80.20%), Postives = 178/197 (90.36%), Query Frame = 2
Query:  383 KVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGF-----TILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKK 958
            KV L  ++LWE FH  GTEMVITKSGRRMFPP+KV+ +GLDK+AKYI+LMD+VA DDCRYKFHN++WMVAGKADPEMPKRMYIHPDSP TGEQWM K+++FHKLKLTNNISDKHGF     TILNSMHKYQPRFH+VRANDI++LPYSTFR+YVF ET FI VTAYQN+KITQLKIDHNPFAKGFRDTG G+REK+K
Sbjct:  105 KVHLEAKELWELFHKKGTEMVITKSGRRMFPPFKVRCTGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMSKVVNFHKLKLTNNISDKHGFVSSTNTILNSMHKYQPRFHIVRANDILKLPYSTFRTYVFPETDFIAVTAYQNDKITQLKIDHNPFAKGFRDTGNGRREKRK 301          
BLAST of T-box transcription factor TBX2 vs. Ensembl Medaka
Match: tbx2a (T-box transcription factor TBX3-like [Source:NCBI gene;Acc:101156111])

HSP 1 Score: 303.908 bits (777), Expect = 4.538e-94
Identity = 135/202 (66.83%), Postives = 169/202 (83.66%), Query Frame = 2
Query:  461 RRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKKLNGSAISTSSDVDNKGNKDNSEEISECSDVNIDIEE 1066
            RRMFPP+KV+V GL++RAKYI+LMD+V+VDD RYKF N++W VAGKADPEMPKRMYIHPDSP+ GEQWM K+++FHKLKLTNN+SDKHGFTILNSMHKYQPRFH+V+A+DIM+LP+STFR+YVF ET+FI VTAYQN+KIT+LKID+NPFAKGFRD G G+REK+          S +D    ++N  ++ +C+D     E+
Sbjct:   86 RRMFPPFKVRVEGLNERAKYILLMDIVSVDDYRYKFQNSRWTVAGKADPEMPKRMYIHPDSPSRGEQWMSKLVAFHKLKLTNNVSDKHGFTILNSMHKYQPRFHIVKASDIMKLPFSTFRTYVFPETEFIAVTAYQNDKITKLKIDNNPFAKGFRDIGNGRREKR---------GSQLDMSFLQENQSDVCDCADSEDSCEQ 278          
BLAST of T-box transcription factor TBX2 vs. Ensembl Medaka
Match: tbx4 (T-box transcription factor 4 [Source:NCBI gene;Acc:101172998])

HSP 1 Score: 255.373 bits (651), Expect = 7.432e-76
Identity = 122/225 (54.22%), Postives = 160/225 (71.11%), Query Frame = 2
Query:  299 PFLPPDIFNPASRNVTEQINDQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRA--NDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKKLNG 967
            P   P   +PA    +    DQ+I +  KV L +R+LW +FH  GTEM+ITK+GRRMFP YKV+VSG++ + KYI+L+D+V  DD RYKF +N+WMVAGKA+P MP R+Y+HPDSP TG  WM++++SF KLKLTNN  D  G  ILNSMHKYQPR H+V+A  N+      + + ++VF ET FI VT+YQN KITQLKI++NPFAKGFR +  G     ++ G
Sbjct:   27 PCQSPLRMSPAPTVPSSSGPDQNI-ESMKVVLHERELWRRFHEAGTEMIITKAGRRMFPSYKVKVSGMNPKTKYILLVDIVPADDHRYKFCDNKWMVAGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNAFGSKNTAYCTHVFHETSFISVTSYQNHKITQLKIENNPFAKGFRGSEDGDLRVSRIQG 250          
BLAST of T-box transcription factor TBX2 vs. Ensembl Medaka
Match: tbx5a (T-box transcription factor TBX5-A [Source:NCBI gene;Acc:101161908])

HSP 1 Score: 247.669 bits (631), Expect = 3.126e-73
Identity = 113/185 (61.08%), Postives = 143/185 (77.30%), Query Frame = 2
Query:  383 KVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRA--NDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDT 931
            KV L +R+LW +FH  GTEM+ITK+GRRMFP +KV+V+GL+ + KYI+LMDVV  DD RYKF +N+W V GKA+P MP R+Y+HPDSP TG  WM++++SF KLKLTNN  D  G  ILNSMHKYQPR H+V+A  N+      + F ++VF ET FI VT+YQN KITQLKI++NPFAKGFR +
Sbjct:   54 KVYLHERELWMKFHEVGTEMIITKAGRRMFPSFKVKVTGLNPKTKYILLMDVVPADDHRYKFADNKWSVTGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRIHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKITQLKIENNPFAKGFRGS 238          
BLAST of T-box transcription factor TBX2 vs. Planmine SMEST
Match: SMESG000061015.1 (SMESG000061015.1)

HSP 1 Score: 1280.77 bits (3313), Expect = 0.000e+0
Identity = 637/638 (99.84%), Postives = 638/638 (100.00%), Query Frame = 2
Query:  116 MAFNPFLGIHSYHSNRNVTDHPFINSATAXXXXXXXXXXXNYGNLLMGKQGMTHSSNLANYPFLPPDIFNPASRNVTEQINDQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKKLNGSAISTSSDVDNKGNKDNSEEISECSDVNIDIEECLNKTDLKQINDKNPDFNELSINICSSKLKRKHLNFEVSPLDANHNKASKKLKNQEDNFNLTPDSSSQSTSIGKHKQDTQLEFEKSLRGNISPNKNTELFEHPDSTDNLHSANSVSIKDNFPPPNVTVLPSSANSFIHQPWLISPGLNTSRSSHLINSANKLIPPMFSYSSIPSIQKDLNDFHDSNSSFKTLSLNSLSQKFPSIFMSNHNSINNIFLPSMFQNNILKSRFKTHPSYLHPSPSPRTNQANFSTLAFAAAMASLTKSSDFFNHKFQESEPFIKEDNKFTEKNSVNVKKKRIKADLSNIDTLISHPNSPSNNDE 2029
            MAFNPFLGIHSYHSNRNVTDHPFINSATASFLPSLSSFPLNYGNLLMGKQGMTHSSNLANYPFLPPDIFNPASRNVTEQINDQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKKLNGSAISTSSDVDNKGNKDNSEEISECSDVNIDIEECLNKTDLKQINDKNPDFNELSINICSSKLKRKHLNFEVSPLDANHNKASKKLKNQEDNFNLTPDSSSQSTSIGKHKQDTQLEFEKSLRGNISPNKNTELFEHPDSTDNLHSANSVSIKDNFPPPNVTVLPSSANSFIHQPWLISPGLNTSRSSHLINS+NKLIPPMFSYSSIPSIQKDLNDFHDSNSSFKTLSLNSLSQKFPSIFMSNHNSINNIFLPSMFQNNILKSRFKTHPSYLHPSPSPRTNQANFSTLAFAAAMASLTKSSDFFNHKFQESEPFIKEDNKFTEKNSVNVKKKRIKADLSNIDTLISHPNSPSNNDE
Sbjct:    1 MAFNPFLGIHSYHSNRNVTDHPFINSATASFLPSLSSFPLNYGNLLMGKQGMTHSSNLANYPFLPPDIFNPASRNVTEQINDQDIKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKKLNGSAISTSSDVDNKGNKDNSEEISECSDVNIDIEECLNKTDLKQINDKNPDFNELSINICSSKLKRKHLNFEVSPLDANHNKASKKLKNQEDNFNLTPDSSSQSTSIGKHKQDTQLEFEKSLRGNISPNKNTELFEHPDSTDNLHSANSVSIKDNFPPPNVTVLPSSANSFIHQPWLISPGLNTSRSSHLINSSNKLIPPMFSYSSIPSIQKDLNDFHDSNSSFKTLSLNSLSQKFPSIFMSNHNSINNIFLPSMFQNNILKSRFKTHPSYLHPSPSPRTNQANFSTLAFAAAMASLTKSSDFFNHKFQESEPFIKEDNKFTEKNSVNVKKKRIKADLSNIDTLISHPNSPSNNDE 638          
BLAST of T-box transcription factor TBX2 vs. Planmine SMEST
Match: SMESG000080056.1 (SMESG000080056.1)

HSP 1 Score: 250.366 bits (638), Expect = 2.172e-73
Identity = 119/212 (56.13%), Postives = 157/212 (74.06%), Query Frame = 2
Query:  368 IKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKH-GFTILNSMHKYQPRFHLVRANDIMRLPYSTF-RSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKK--KLNGSAISTSSD 991
            IKD  + +L + DLW++F+   TEMVITKSGRRMFP +KVQ+SGLD ++KY++ ++V+  DD R+KFHN +W +AGKADPE  + +Y H +SP +GE WMQK + F+K+KLTNN +DK     +LNSMHKY  R HL R +D  ++ +  +   ++FK T+FI VTAYQN+KITQLKIDHNPFAKGFRD G G+REKK  KL  +  STS D
Sbjct:  130 IKDSIEAKLCEDDLWKRFNNLTTEMVITKSGRRMFPAFKVQLSGLDPKSKYVLALEVMPCDDNRFKFHNGKWTLAGKADPESNRLVYFHCESPASGESWMQKAVWFNKVKLTNNPTDKDPQHLVLNSMHKYVMRLHLFRTDDTSKIRFCLYPEVFLFKTTEFIAVTAYQNDKITQLKIDHNPFAKGFRDNGSGRREKKRMKLQQTISSTSPD 341          
BLAST of T-box transcription factor TBX2 vs. Planmine SMEST
Match: SMESG000080056.1 (SMESG000080056.1)

HSP 1 Score: 250.366 bits (638), Expect = 2.623e-73
Identity = 119/212 (56.13%), Postives = 157/212 (74.06%), Query Frame = 2
Query:  368 IKDDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKH-GFTILNSMHKYQPRFHLVRANDIMRLPYSTF-RSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKK--KLNGSAISTSSD 991
            IKD  + +L + DLW++F+   TEMVITKSGRRMFP +KVQ+SGLD ++KY++ ++V+  DD R+KFHN +W +AGKADPE  + +Y H +SP +GE WMQK + F+K+KLTNN +DK     +LNSMHKY  R HL R +D  ++ +  +   ++FK T+FI VTAYQN+KITQLKIDHNPFAKGFRD G G+REKK  KL  +  STS D
Sbjct:  137 IKDSIEAKLCEDDLWKRFNNLTTEMVITKSGRRMFPAFKVQLSGLDPKSKYVLALEVMPCDDNRFKFHNGKWTLAGKADPESNRLVYFHCESPASGESWMQKAVWFNKVKLTNNPTDKDPQHLVLNSMHKYVMRLHLFRTDDTSKIRFCLYPEVFLFKTTEFIAVTAYQNDKITQLKIDHNPFAKGFRDNGSGRREKKRMKLQQTISSTSPD 348          
BLAST of T-box transcription factor TBX2 vs. Planmine SMEST
Match: SMESG000023378.1 (SMESG000023378.1)

HSP 1 Score: 231.106 bits (588), Expect = 1.229e-69
Identity = 116/228 (50.88%), Postives = 162/228 (71.05%), Query Frame = 2
Query:  287 LANYPFLPPDIFNPASRNV-TEQINDQDIK--DDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRM---YIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREK 952
            L + P+L  + F+  S NV   Q  D  ++  D P VEL D++LW +F    TEMVITK+GRRMFP +KV++ GLD  AKY++L+D+V  ++ RYK+++NQW+ +GKA  E+ + +   +IHPDSPTTGE+WM K ISFHK+KL+N   DK    ILNSMHKY P+ +LVRA +++   Y  +  + F ETQFI VTAYQN++IT+LKI++NPFAKGFR+    K+E+
Sbjct:    3 LFSRPWLKQNSFDDISTNVLAAQQYDWRVRSLDHPVVELEDKELWTEFFNKTTEMVITKTGRRMFPSFKVRIKGLDPTAKYVLLLDIVLSNENRYKYYHNQWIKSGKA--EISQHLHSPFIHPDSPTTGEEWMSKSISFHKIKLSNTRVDKDDVIILNSMHKYIPKLYLVRAQNLLYTNYCHWDEFSFYETQFIAVTAYQNDQITKLKINYNPFAKGFRENCSLKKER 228          
BLAST of T-box transcription factor TBX2 vs. Planmine SMEST
Match: SMESG000023378.1 (SMESG000023378.1)

HSP 1 Score: 229.95 bits (585), Expect = 5.182e-69
Identity = 116/228 (50.88%), Postives = 162/228 (71.05%), Query Frame = 2
Query:  287 LANYPFLPPDIFNPASRNV-TEQINDQDIK--DDPKVELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKFHNNQWMVAGKADPEMPKRM---YIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREK 952
            L + P+L  + F+  S NV   Q  D  ++  D P VEL D++LW +F    TEMVITK+GRRMFP +KV++ GLD  AKY++L+D+V  ++ RYK+++NQW+ +GKA  E+ + +   +IHPDSPTTGE+WM K ISFHK+KL+N   DK    ILNSMHKY P+ +LVRA +++   Y  +  + F ETQFI VTAYQN++IT+LKI++NPFAKGFR+    K+E+
Sbjct:   24 LFSRPWLKQNSFDDISTNVLAAQQYDWRVRSLDHPVVELEDKELWTEFFNKTTEMVITKTGRRMFPSFKVRIKGLDPTAKYVLLLDIVLSNENRYKYYHNQWIKSGKA--EISQHLHSPFIHPDSPTTGEEWMSKSISFHKIKLSNTRVDKDDVIILNSMHKYIPKLYLVRAQNLLYTNYCHWDEFSFYETQFIAVTAYQNDQITKLKINYNPFAKGFRENCSLKKER 249          
The following BLAST results are available for this feature:
BLAST of T-box transcription factor TBX2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TBX26.059e-11978.37T-box transcription factor 2 [Source:HGNC Symbol;A... [more]
TBX32.261e-11572.44T-box transcription factor 3 [Source:HGNC Symbol;A... [more]
TBX31.491e-11066.53T-box transcription factor 3 [Source:HGNC Symbol;A... [more]
TBX52.552e-7461.08T-box transcription factor 5 [Source:HGNC Symbol;A... [more]
TBX41.047e-7360.54T-box transcription factor 4 [Source:HGNC Symbol;A... [more]
back to top
BLAST of T-box transcription factor TBX2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbx-26.165e-10267.45T-box protein 2 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
tbx-26.165e-10267.45T-box protein 2 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
tbx-74.454e-6346.41Putative T-box protein 7 [Source:UniProtKB/Swiss-... [more]
tbx-71.613e-6240.81Putative T-box protein 7 [Source:UniProtKB/Swiss-... [more]
tbx-71.613e-6240.81Putative T-box protein 7 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of T-box transcription factor TBX2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bi2.704e-11575.33gene:FBgn0000179 transcript:FBtr0308915[more]
bi5.275e-11579.25gene:FBgn0000179 transcript:FBtr0343569[more]
bi5.136e-11477.88gene:FBgn0000179 transcript:FBtr0300608[more]
bi5.136e-11477.88gene:FBgn0000179 transcript:FBtr0070672[more]
bi5.136e-11477.88gene:FBgn0000179 transcript:FBtr0300609[more]
back to top
BLAST of T-box transcription factor TBX2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbx2a1.912e-11881.00T-box transcription factor 2a [Source:ZFIN;Acc:ZDB... [more]
tbx2a2.881e-11881.00T-box transcription factor 2a [Source:ZFIN;Acc:ZDB... [more]
tbx3a2.855e-11582.29T-box transcription factor 3a [Source:ZFIN;Acc:ZDB... [more]
tbx2b6.060e-11482.29T-box transcription factor 2b [Source:NCBI gene;Ac... [more]
tbx2b6.060e-11482.29T-box transcription factor 2b [Source:NCBI gene;Ac... [more]
back to top
BLAST of T-box transcription factor TBX2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbx38.633e-11872.53T-box 3 [Source:NCBI gene;Acc:613116][more]
tbx23.815e-11574.55T-box 2 [Source:NCBI gene;Acc:619588][more]
TBX48.619e-7453.33T-box 4 [Source:NCBI gene;Acc:100488041][more]
TBX41.502e-7360.54T-box 4 [Source:NCBI gene;Acc:100488041][more]
rtraf2.664e-7361.08RNA transcription, translation and transport facto... [more]
back to top
BLAST of T-box transcription factor TBX2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tbx39.062e-12080.00T-box 3 [Source:MGI Symbol;Acc:MGI:98495][more]
Tbx39.062e-12080.00T-box 3 [Source:MGI Symbol;Acc:MGI:98495][more]
Tbx22.287e-11873.48T-box 2 [Source:MGI Symbol;Acc:MGI:98494][more]
Tbx37.265e-11572.73T-box 3 [Source:MGI Symbol;Acc:MGI:98495][more]
Tbx47.352e-7460.54T-box 4 [Source:MGI Symbol;Acc:MGI:102556][more]
back to top
BLAST of T-box transcription factor TBX2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6PCL0|TBX2B_XENLA6.564e-11971.61T-box transcription factor TBX2-B OS=Xenopus laevi... [more]
sp|Q13207|TBX2_HUMAN2.910e-11878.37T-box transcription factor TBX2 OS=Homo sapiens OX... [more]
sp|Q863A2|TBX2_CANLF7.648e-11878.37T-box transcription factor TBX2 OS=Canis lupus fam... [more]
sp|Q60707|TBX2_MOUSE1.600e-11773.48T-box transcription factor TBX2 OS=Mus musculus OX... [more]
sp|O73718|TBX3_CHICK4.214e-11782.29T-box transcription factor TBX3 (Fragment) OS=Gall... [more]
back to top
BLAST of T-box transcription factor TBX2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5P8I4J30.000e+0100.00T-box 2/3c protein OS=Schmidtea mediterranea OX=79... [more]
F1CDF00.000e+098.26TBX2/3c (Fragment) OS=Schmidtea polychroa OX=50054... [more]
K1Q5951.042e-12873.68T-box transcription factor TBX2 OS=Crassostrea gig... [more]
A0A1S3H0C42.073e-12774.32T-box protein 2 isoform X2 OS=Lingula unguis OX=75... [more]
V4AP942.230e-12780.18Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of T-box transcription factor TBX2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbx3a5.441e-11582.29T-box transcription factor 3 [Source:NCBI gene;Acc... [more]
tbx2b3.307e-11482.29T-box transcription factor 2 [Source:NCBI gene;Acc... [more]
tbx43.682e-7557.56T-box transcription factor 4 [Source:NCBI gene;Acc... [more]
tbx43.682e-7557.56T-box transcription factor 4 [Source:NCBI gene;Acc... [more]
tbx201.175e-7156.99T-box transcription factor 20 [Source:NCBI gene;Ac... [more]
back to top
BLAST of T-box transcription factor TBX2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004087.17.234e-6758.62pep scaffold:Pmarinus_7.0:GL483204:5206:18999:-1 g... [more]
ENSPMAT00000008915.11.007e-4747.19pep scaffold:Pmarinus_7.0:GL481372:6049:9031:1 gen... [more]
TBR17.259e-4749.73T-box brain transcription factor 1 [Source:HGNC Sy... [more]
ENSPMAT00000007664.11.831e-4543.33pep scaffold:Pmarinus_7.0:GL477495:60408:67857:-1 ... [more]
ENSPMAT00000004398.12.897e-2741.54pep scaffold:Pmarinus_7.0:GL481394:165233:166024:1... [more]
back to top
BLAST of T-box transcription factor TBX2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of T-box transcription factor TBX2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO418881.382e-9468.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418891.885e-7357.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350864.902e-7257.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371851.338e-7156.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466641.732e-7156.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of T-box transcription factor TBX2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TBX27.845e-11980.00T-box transcription factor 2 [Source:NCBI gene;Acc... [more]
tbx3a6.106e-11280.20T-box transcription factor 3 [Source:NCBI gene;Acc... [more]
tbx2a4.538e-9466.83T-box transcription factor TBX3-like [Source:NCBI ... [more]
tbx47.432e-7654.22T-box transcription factor 4 [Source:NCBI gene;Acc... [more]
tbx5a3.126e-7361.08T-box transcription factor TBX5-A [Source:NCBI gen... [more]
back to top
BLAST of T-box transcription factor TBX2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061015.10.000e+099.84SMESG000061015.1[more]
SMESG000080056.12.172e-7356.13SMESG000080056.1[more]
SMESG000080056.12.623e-7356.13SMESG000080056.1[more]
SMESG000023378.11.229e-6950.88SMESG000023378.1[more]
SMESG000023378.15.182e-6950.88SMESG000023378.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032395 ID=SMED30032395|Name=T-box transcription factor TBX2|organism=Schmidtea mediterranea sexual|type=transcript|length=2164bp
CTTCCGATCTGAGAAACAGCTGTGAACACCAGTGCGTACATCTTCATACT
AAAATTATTTCCTAGCTCATCTGAAGAAACTCTATTTAGACGTCAAGCAT
TGAATTTATTTATGAATGGCTTTTAATCCTTTTTTGGGTATCCATTCTTA
CCACTCAAATAGAAATGTTACAGATCATCCATTCATCAATTCGGCAACGG
CTTCGTTTCTGCCGAGTTTGTCGAGCTTTCCGTTGAATTACGGCAACTTA
CTGATGGGAAAACAAGGAATGACCCATTCTTCAAATTTGGCAAATTATCC
ATTCCTACCTCCAGATATTTTTAATCCGGCCTCGAGAAATGTTACGGAGC
AAATTAATGATCAAGATATCAAAGACGATCCAAAAGTCGAACTTATAGAT
AGAGATTTGTGGGAGCAATTTCATGCTTATGGCACCGAAATGGTTATTAC
AAAAAGCGGAAGACGAATGTTTCCTCCTTATAAAGTCCAAGTTAGTGGTT
TGGATAAGCGTGCAAAATACATAATGCTCATGGATGTTGTGGCAGTTGAT
GACTGCAGGTATAAATTCCACAACAACCAGTGGATGGTTGCCGGTAAAGC
TGATCCAGAAATGCCTAAAAGAATGTATATCCACCCGGATTCACCAACAA
CTGGAGAACAATGGATGCAAAAGATCATATCTTTCCACAAACTGAAACTT
ACAAACAATATATCAGACAAGCATGGCTTTACAATTCTGAATTCTATGCA
TAAATATCAACCACGTTTTCACTTGGTGCGAGCAAATGACATAATGAGAT
TACCTTACAGCACGTTTCGGTCATACGTCTTCAAAGAAACTCAATTCATA
GGCGTAACAGCTTATCAAAACGAAAAGATTACTCAACTTAAAATTGATCA
TAACCCTTTTGCAAAAGGATTCCGTGATACAGGTGGAGGAAAAAGAGAAA
AAAAGAAATTGAATGGTTCTGCAATTTCGACTTCTTCTGATGTAGATAAT
AAAGGAAATAAAGATAACAGCGAAGAAATCAGTGAATGCAGTGACGTTAA
CATTGACATTGAAGAATGTTTAAATAAGACAGATTTAAAACAAATAAATG
ATAAAAATCCAGATTTCAATGAGTTGTCCATAAATATATGCAGTTCAAAG
TTGAAAAGAAAACATTTAAACTTTGAAGTATCGCCGTTAGATGCCAATCA
TAATAAAGCCTCGAAAAAATTGAAAAATCAAGAAGACAATTTTAATCTGA
CCCCTGATTCATCGTCTCAGTCAACTTCAATTGGAAAACACAAACAAGAT
ACTCAATTGGAATTCGAAAAATCCCTTCGTGGAAACATTTCCCCAAATAA
AAATACTGAATTATTTGAACATCCAGATTCGACAGATAATCTACACAGTG
CAAATTCAGTGTCGATTAAAGACAATTTCCCTCCTCCTAATGTGACAGTT
TTGCCCAGTTCAGCTAACAGTTTCATACACCAGCCTTGGTTAATTTCACC
GGGTTTAAACACTAGTCGATCAAGTCATTTAATTAATTCTGCAAATAAAT
TAATTCCCCCGATGTTTTCTTATTCATCAATTCCCTCAATTCAAAAAGAT
CTAAATGACTTTCACGATTCTAATTCTTCTTTCAAAACGTTATCTCTAAA
TTCTCTTAGTCAAAAATTCCCGTCGATTTTCATGTCAAATCACAATTCCA
TAAACAACATTTTCTTACCGTCGATGTTTCAAAACAATATCTTAAAATCG
CGATTCAAAACCCATCCGTCTTATTTGCACCCATCACCGTCACCGAGAAC
AAATCAAGCGAACTTTTCAACGTTGGCATTTGCAGCCGCAATGGCTTCTT
TAACAAAATCATCAGATTTTTTCAACCACAAATTCCAGGAATCTGAGCCA
TTTATTAAAGAAGACAATAAGTTTACAGAAAAGAATTCAGTCAATGTAAA
AAAGAAACGTATTAAAGCAGATTTATCCAACATTGATACTCTAATAAGCC
ACCCGAACAGCCCGTCTAATAATGATGAATGATGAATATTTCGTCTCTAA
ATCTGTGATACTTTAAAAATTTTAAAACATTCCTTTTCACAATAATTGAT
GCTCAACATAAAAATATTGGACAACTAATGTGTAAATATCGATCATTAAT
ACATTTCATTCACC
back to top

protein sequence of SMED30032395-orf-1

>SMED30032395-orf-1 ID=SMED30032395-orf-1|Name=SMED30032395-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=639bp
MAFNPFLGIHSYHSNRNVTDHPFINSATASFLPSLSSFPLNYGNLLMGKQ
GMTHSSNLANYPFLPPDIFNPASRNVTEQINDQDIKDDPKVELIDRDLWE
QFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYK
FHNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNIS
DKHGFTILNSMHKYQPRFHLVRANDIMRLPYSTFRSYVFKETQFIGVTAY
QNEKITQLKIDHNPFAKGFRDTGGGKREKKKLNGSAISTSSDVDNKGNKD
NSEEISECSDVNIDIEECLNKTDLKQINDKNPDFNELSINICSSKLKRKH
LNFEVSPLDANHNKASKKLKNQEDNFNLTPDSSSQSTSIGKHKQDTQLEF
EKSLRGNISPNKNTELFEHPDSTDNLHSANSVSIKDNFPPPNVTVLPSSA
NSFIHQPWLISPGLNTSRSSHLINSANKLIPPMFSYSSIPSIQKDLNDFH
DSNSSFKTLSLNSLSQKFPSIFMSNHNSINNIFLPSMFQNNILKSRFKTH
PSYLHPSPSPRTNQANFSTLAFAAAMASLTKSSDFFNHKFQESEPFIKED
NKFTEKNSVNVKKKRIKADLSNIDTLISHPNSPSNNDE*
back to top
Aliases
The feature 'T-box transcription factor TBX2' has the following synonyms
Synonym
Spol-TBX2/3c
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000141dorsal region of the whole animal
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036960T-box_sf
IPR002070TF_Brachyury
IPR001699TF_T-box
IPR018186TF_T-box_CS
IPR008967p53-like_TF_DNA-bd
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0000978RNA polymerase II core promoter proximal region sequence-specific DNA binding
GO:0001078transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding
GO:0003677DNA binding
GO:0005515protein binding
GO:0043565sequence-specific DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005667transcription factor complex
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0001947heart looping
GO:0003007heart morphogenesis
GO:0003148outflow tract septum morphogenesis
GO:0003151outflow tract morphogenesis
GO:0003203endocardial cushion morphogenesis
GO:0003256regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation
GO:0006351transcription, DNA-templated
GO:0007219Notch signaling pathway
GO:0007275multicellular organism development
GO:0007521muscle cell fate determination
GO:0007569cell aging
GO:0008016regulation of heart contraction
GO:0008284positive regulation of cell proliferation
GO:0035050embryonic heart tube development
GO:0035909aorta morphogenesis
GO:0036302atrioventricular canal development
GO:0042733embryonic digit morphogenesis
GO:0045892negative regulation of transcription, DNA-templated
GO:0048596embryonic camera-type eye morphogenesis
GO:0048738cardiac muscle tissue development
GO:0060021palate development
GO:0060045positive regulation of cardiac muscle cell proliferation
GO:0060465pharynx development
GO:0060560developmental growth involved in morphogenesis
GO:0060596mammary placode formation
GO:0090398cellular senescence
GO:1901208negative regulation of heart looping
GO:1901211negative regulation of cardiac chamber formation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002070Transcription factor, BrachyuryPRINTSPR00938BRACHYURYcoord: 151..171
score: 33.33
coord: 212..229
score: 44.95
IPR001699Transcription factor, T-boxPRINTSPR00937TBOXcoord: 106..130
score: 67.65
coord: 171..184
score: 67.08
coord: 263..271
score: 89.13
coord: 188..197
score: 74.13
coord: 207..221
score: 74.2
coord: 242..255
score: 74.07
IPR001699Transcription factor, T-boxSMARTSM00425tbox5coord: 88..276
e-value: 2.2E-125
score: 432.6
IPR001699Transcription factor, T-boxPFAMPF00907T-boxcoord: 91..271
e-value: 2.6E-83
score: 278.8
IPR001699Transcription factor, T-boxPANTHERPTHR11267T-BOX PROTEIN-RELATEDcoord: 57..589
IPR001699Transcription factor, T-boxPROSITEPS50252TBOX_3coord: 93..271
score: 76.662
IPR001699Transcription factor, T-boxCDDcd00182TBOXcoord: 88..273
e-value: 8.23342E-118
score: 346.882
IPR036960T-box superfamilyGENE3DG3DSA:2.60.40.820coord: 85..277
e-value: 8.8E-98
score: 327.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 369..396
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 269..303
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 372..393
NoneNo IPR availablePANTHERPTHR11267:SF107OPTOMOTOR-BLIND PROTEINcoord: 57..589
IPR018186Transcription factor, T-box, conserved sitePROSITEPS01264TBOX_2coord: 172..190
IPR018186Transcription factor, T-box, conserved sitePROSITEPS01283TBOX_1coord: 98..117
IPR008967p53-like transcription factor, DNA-bindingSUPERFAMILYSSF49417p53-like transcription factorscoord: 89..271