slc24a-1

Overview
Nameslc24a-1 (AKN21562.1)
Smed IDSMED30032389
Length (bp)2111
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc24a-1 (SMED30032389) t-SNE clustered cells

Violin plots show distribution of expression levels for slc24a-1 (SMED30032389) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc24a-1 (SMED30032389) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc24a-1 (SMED30032389) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032389

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30032389SMESG000010390.1 dd_Smed_v4_5868_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30032389SMESG000010390.1 dd_Smed_v4_5868_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30032389SMESG000010390.1 dd_Smed_v4_5868_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30032389SMESG000010390.1 dd_Smed_v4_5868_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032389SMESG000010390.1 dd_Smed_v4_5868_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032389SMESG000010390.1 dd_Smed_v4_5868_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30032389SMESG000010390.1 dd_Smed_v4_5868_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30032389SMESG000010390.1 dd_Smed_v4_5868_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032389SMESG000010390.1 dd_Smed_v4_5868_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30032389SMESG000010390.1 dd_Smed_v4_5868_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30032389SMESG000010390.1 dd_Smed_v4_5868_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30032389SMESG000010390.1 dd_Smed_v4_5868_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc24a-1 vs. Ensembl Human
Match: SLC24A5 (solute carrier family 24 member 5 [Source:HGNC Symbol;Acc:HGNC:20611])

HSP 1 Score: 320.857 bits (821), Expect = 3.771e-101
Identity = 184/478 (38.49%), Postives = 275/478 (57.53%), Query Frame = 1
Query:  211 KANCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNCTINNENL--SDEAFLMSNEVAEDLHTTSTGIEMINSGTESDED--YESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKC--LTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFG 1626
               C       FPE  F+++ R+ G +II+FLI +YMF+ ++IVC++YF+P LE I E+L L  DVAG TFMAAGSSAPEL T  +GVFI K DI +  ++GSA YNL+ +     L + TV  L+ WPLFRDCA Y+IS   +  +IYDN VYWYE  + +  YG+Y+++  F+  +    + ++ K  P C    + +  S++  LM  E          G   I   + +D    YE                S +  +   G +       +   +P+    R     ++ L  P+   L ++ PDC+++F++ +F ITF  S IWI  ++YI++WM+T+ G TL IPD+VMGLT +AAG+S+PD IASVLV R+G+GDMA+SN VGSNVFD+L C+G+PW IK   +    P  + S+GL Y TI+L +++  L    H   WK+ +  G + ++ Y+    +  +YEL + G
Sbjct:   43 STQCVISPSSEFPEGFFTRQERRDGGIIIYFLIIVYMFMAISIVCDEYFLPSLEIISESLGLSQDVAGTTFMAAGSSAPELVTAFLGVFITKGDIGISTILGSAIYNLLGICAACGLLSNTVSTLSCWPLFRDCAAYTISAAAVLGIIYDNQVYWYEGALLLLIYGLYVLVLCFDIKIN---QYIIKKCSPCCACLAKAMERSEQQPLMGWE--------DEGQPFIRRQSRTDSGIFYEDSGY------------SQLSISLH-GLSQVSEDPPSVFNMPEADLKR----IFWVLSLPIITLLFLTTPDCRKKFWKNYFVITFFMSAIWISAFTYILVWMVTITGETLEIPDTVMGLTLLAAGTSIPDTIASVLVARKGKGDMAMSNIVGSNVFDML-CLGIPWFIKTAFINGSAPAEVNSRGLTYITISLNISIIFLFLAVHFNGWKLDRKLGIVCLLSYLGLATLSVLYELGIIG 491          
BLAST of slc24a-1 vs. Ensembl Human
Match: SLC24A5 (solute carrier family 24 member 5 [Source:HGNC Symbol;Acc:HGNC:20611])

HSP 1 Score: 261.922 bits (668), Expect = 1.487e-79
Identity = 159/419 (37.95%), Postives = 236/419 (56.32%), Query Frame = 1
Query:  388 LKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNCTINNENL--SDEAFLMSNEVAEDLHTTSTGIEMINSGTESDED--YESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKC--LTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFG 1626
            L L  DVAG TFMAAGSSAPEL T  +GVFI K DI +  ++GSA YNL+ +     L + TV  L+ WPLFRDCA Y+IS   +  +IYDN VYWYE  + +  YG+Y+++  F+  +    + ++ K  P C    + +  S++  LM  E          G   I   + +D    YE                S +  +   G +       +   +P+    R     ++ L  P+   L ++ PDC+++F++ +F ITF  S IWI  ++YI++WM+T+ G TL IPD+VMGLT +AAG+S+PD IASVLV R+G+GDMA+SN VGSNVFD+L C+G+PW IK   +    P  + S+GL Y TI+L +++  L    H   WK+ +  G + ++ Y+    +  +YEL + G
Sbjct:   42 LGLSQDVAGTTFMAAGSSAPELVTAFLGVFITKGDIGISTILGSAIYNLLGICAACGLLSNTVSTLSCWPLFRDCAAYTISAAAVLGIIYDNQVYWYEGALLLLIYGLYVLVLCFDIKIN---QYIIKKCSPCCACLAKAMERSEQQPLMGWE--------DEGQPFIRRQSRTDSGIFYEDSGY------------SQLSISLH-GLSQVSEDPPSVFNMPEADLKR----IFWVLSLPIITLLFLTTPDCRKKFWKNYFVITFFMSAIWISAFTYILVWMVTITGETLEIPDTVMGLTLLAAGTSIPDTIASVLVARKGKGDMAMSNIVGSNVFDML-CLGIPWFIKTAFINGSAPAEVNSRGLTYITISLNISIIFLFLAVHFNGWKLDRKLGIVCLLSYLGLATLSVLYELGIIG 431          
BLAST of slc24a-1 vs. Ensembl Human
Match: SLC24A4 (solute carrier family 24 member 4 [Source:HGNC Symbol;Acc:HGNC:10978])

HSP 1 Score: 192.586 bits (488), Expect = 1.254e-52
Identity = 89/188 (47.34%), Postives = 134/188 (71.28%), Query Frame = 1
Query: 1090 YPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTL--GKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPEC 1647
            +PL F LCV+IP+C +  + K+F +TFI + +WI ++SYIM+W++T+IG+TLGIPD +MG+TF+AAG+SVPD +AS++V R+G GDMAVSN +GSNVFDIL+ +GVPW ++ + +  G  + I S+GL+Y+ + L  +V   V   HL  W++ +  G  ++++Y  FL    M E NVF  V+ P C
Sbjct:  367 WPLIFLLCVTIPNCSKPRWEKFFMVTFITATLWIAVFSYIMVWLVTIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNTIGSNVFDILVGLGVPWGLQTMVVNYGSTVKINSRGLVYSVVLLLGSVALTVLGIHLNKWRLDRKLGVYVLVLYAIFLCFSIMIEFNVFTFVNLPMC 554          

HSP 2 Score: 184.496 bits (467), Expect = 9.980e-50
Identity = 85/156 (54.49%), Postives = 112/156 (71.79%), Query Frame = 1
Query:  217 NCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEA 684
            NC+  AI  FP DLFS K RQ GA+++H L  +YMF  LAIVC+D+FVP LE ICE L L  DVAGATFMAAGSS PEL  ++IGVFI   D+ +G +VGSA +N++ +IG+  LFA  V++L WW + RD  +Y+IS+I+L + IYD  + W+E 
Sbjct:   12 NCTDPAIHEFPTDLFSNKERQHGAVLLHILGALYMFYALAIVCDDFFVPSLEKICERLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVRLTWWAVCRDSVYYTISVIVLIVFIYDEQIVWWEG 167          

HSP 3 Score: 52.7582 bits (125), Expect = 2.198e-6
Identity = 40/118 (33.90%), Postives = 63/118 (53.39%), Query Frame = 1
Query: 1243 LGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVV 1596
            L + + V G TF+AAGSS P+  ASV+ V    GD+ V   VGS VF+IL  +GV  L     +        +  +Y TI++      +V I  +Y  ++    G +LII+YV ++++
Sbjct:   69 LHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVRLTWWAVCRDSVYYTISV------IVLIVFIYDEQIVWWEGLVLIILYVFYILI 180          
BLAST of slc24a-1 vs. Ensembl Human
Match: SLC24A4 (solute carrier family 24 member 4 [Source:HGNC Symbol;Acc:HGNC:10978])

HSP 1 Score: 192.971 bits (489), Expect = 1.992e-52
Identity = 89/188 (47.34%), Postives = 134/188 (71.28%), Query Frame = 1
Query: 1090 YPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTL--GKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPEC 1647
            +PL F LCV+IP+C +  + K+F +TFI + +WI ++SYIM+W++T+IG+TLGIPD +MG+TF+AAG+SVPD +AS++V R+G GDMAVSN +GSNVFDIL+ +GVPW ++ + +  G  + I S+GL+Y+ + L  +V   V   HL  W++ +  G  ++++Y  FL    M E NVF  V+ P C
Sbjct:  412 WPLIFLLCVTIPNCSKPRWEKFFMVTFITATLWIAVFSYIMVWLVTIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNTIGSNVFDILVGLGVPWGLQTMVVNYGSTVKINSRGLVYSVVLLLGSVALTVLGIHLNKWRLDRKLGVYVLVLYAIFLCFSIMIEFNVFTFVNLPMC 599          

HSP 2 Score: 184.882 bits (468), Expect = 1.417e-49
Identity = 85/156 (54.49%), Postives = 112/156 (71.79%), Query Frame = 1
Query:  217 NCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEA 684
            NC+  AI  FP DLFS K RQ GA+++H L  +YMF  LAIVC+D+FVP LE ICE L L  DVAGATFMAAGSS PEL  ++IGVFI   D+ +G +VGSA +N++ +IG+  LFA  V++L WW + RD  +Y+IS+I+L + IYD  + W+E 
Sbjct:   76 NCTDPAIHEFPTDLFSNKERQHGAVLLHILGALYMFYALAIVCDDFFVPSLEKICERLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVRLTWWAVCRDSVYYTISVIVLIVFIYDEQIVWWEG 231          

HSP 3 Score: 52.7582 bits (125), Expect = 2.138e-6
Identity = 40/118 (33.90%), Postives = 63/118 (53.39%), Query Frame = 1
Query: 1243 LGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVV 1596
            L + + V G TF+AAGSS P+  ASV+ V    GD+ V   VGS VF+IL  +GV  L     +        +  +Y TI++      +V I  +Y  ++    G +LII+YV ++++
Sbjct:  133 LHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVRLTWWAVCRDSVYYTISV------IVLIVFIYDEQIVWWEGLVLIILYVFYILI 244          
BLAST of slc24a-1 vs. Ensembl Human
Match: SLC24A4 (solute carrier family 24 member 4 [Source:HGNC Symbol;Acc:HGNC:10978])

HSP 1 Score: 192.971 bits (489), Expect = 2.772e-52
Identity = 89/188 (47.34%), Postives = 134/188 (71.28%), Query Frame = 1
Query: 1090 YPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTL--GKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPEC 1647
            +PL F LCV+IP+C +  + K+F +TFI + +WI ++SYIM+W++T+IG+TLGIPD +MG+TF+AAG+SVPD +AS++V R+G GDMAVSN +GSNVFDIL+ +GVPW ++ + +  G  + I S+GL+Y+ + L  +V   V   HL  W++ +  G  ++++Y  FL    M E NVF  V+ P C
Sbjct:  431 WPLIFLLCVTIPNCSKPRWEKFFMVTFITATLWIAVFSYIMVWLVTIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNTIGSNVFDILVGLGVPWGLQTMVVNYGSTVKINSRGLVYSVVLLLGSVALTVLGIHLNKWRLDRKLGVYVLVLYAIFLCFSIMIEFNVFTFVNLPMC 618          

HSP 2 Score: 184.882 bits (468), Expect = 2.191e-49
Identity = 85/156 (54.49%), Postives = 112/156 (71.79%), Query Frame = 1
Query:  217 NCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEA 684
            NC+  AI  FP DLFS K RQ GA+++H L  +YMF  LAIVC+D+FVP LE ICE L L  DVAGATFMAAGSS PEL  ++IGVFI   D+ +G +VGSA +N++ +IG+  LFA  V++L WW + RD  +Y+IS+I+L + IYD  + W+E 
Sbjct:   76 NCTDPAIHEFPTDLFSNKERQHGAVLLHILGALYMFYALAIVCDDFFVPSLEKICERLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVRLTWWAVCRDSVYYTISVIVLIVFIYDEQIVWWEG 231          

HSP 3 Score: 52.7582 bits (125), Expect = 2.305e-6
Identity = 40/118 (33.90%), Postives = 63/118 (53.39%), Query Frame = 1
Query: 1243 LGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVV 1596
            L + + V G TF+AAGSS P+  ASV+ V    GD+ V   VGS VF+IL  +GV  L     +        +  +Y TI++      +V I  +Y  ++    G +LII+YV ++++
Sbjct:  133 LHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVRLTWWAVCRDSVYYTISV------IVLIVFIYDEQIVWWEGLVLIILYVFYILI 244          
BLAST of slc24a-1 vs. Ensembl Celegans
Match: ncx-4 (Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:Q1ZXT5])

HSP 1 Score: 296.204 bits (757), Expect = 5.016e-91
Identity = 182/532 (34.21%), Postives = 279/532 (52.44%), Query Frame = 1
Query:  163 PINNDKSYISRQLLSYKANCSPKAID-----NFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAK---------MLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMINSGT-------------------ESDEDYESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKK------KARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCL--------TLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELN 1617
            P+N  K +    L +   + +P A D      FP D FS + RQ+G +++H    IYMF+ LAIVC+++FVP L+ + E L L  DVAGATFMAAG SAPE  T++IGVFIA++++ +G +VGSA +N++ V+    LF+K+++ L WWPLFRD + Y +++ +L     D ++ + EA+     Y +Y  +  FN  LE   K            T+ L     +N N +D A L  +E+          + +++SGT                   +S+ED  S         +      +++ +     +  +    + LE  ++K         W     Y L  P+   + V+IPD ++   R  +  TFI S +WI  +SY+M+W    IG T  IP  ++GLT +AAG+S+PD I SV+V R+G GDMAVS++VGSN+FD+ + + +PWL+  L            PI + SKGLL +   LF+ +  LVF   L  WKM K FG ++I+ YV F V     E +
Sbjct:   55 PVNASKPFWKTLLPTCNRSLAPPAPDVNDDGQFPPDPFSLEQRQNGFVVLHMCGLIYMFVSLAIVCDEFFVPSLDVLTEKLSLSDDVAGATFMAAGGSAPEFFTSVIGVFIAQNNVGIGTIVGSATFNILCVLAFCTLFSKSILDLTWWPLFRDVSIYMLALAMLVFFFMDEMITFPEALAMFSIYIVYCTVMKFNGQLEQLVKKGSDSEEASAHETQKLAADVPHNNNNNDLAQLEGSELRRRSSARRQSVPILHSGTMFRNGIMQLMNQTLEQLPEDSEEDDSSRSRSNVNIESHDMHRLNVNQSMPDRRSSQIEEIKSLLEEQEEKPLDMTWPETWVKRLTYVLLAPVVIPMWVTIPDVRKSHNRGLYPATFIISILWIAFFSYLMVWWANTIGETFVIPTEIIGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDVCVGLPIPWLLYFLIEYIKHPNEPLSPISVSSKGLLCSVGMLFIMLIVLVFAIFLSGWKMNKIFGILMIVSYVFFCVFSVSLETD 586          
BLAST of slc24a-1 vs. Ensembl Celegans
Match: ncx-5 (Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:G5EC02])

HSP 1 Score: 166.777 bits (421), Expect = 2.014e-43
Identity = 106/290 (36.55%), Postives = 155/290 (53.45%), Query Frame = 1
Query:   73 KKRSYISIWTFLLMFGCLFIFYANYKHDINP---INNDKSYISRQLLSYK-ANCSPK-------AIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKM-LVTKYLPNCTINNENLSDEAFLMSNEVAEDL--HTTSTGIEMINSGTE 900
            K R+ I+I         L +     K+D+     I N+ S   R+ + Y+  +C P+           FP D+FS + R+ G +I+H  + IYMF+ LA+VC+++FVP L  I E L +  DVAGATFMAAG SAPE  T++ GVF+A+D++ +G +VGSA +N++ V+    LF++ V+ L WWPLFRD +FY++S+ LL +   D ++ W EA+V    Y  Y     FN  LEL  K  L  K      I  E + D A   +      L          MI+ G E
Sbjct:   16 KLRTQIAILLLSGSLFFLIVLLPLVKNDVPADVSIENEISKRHRRSVEYEFDDCRPRIQTTSNANSSQFPADIFSLQTRRRGGVIVHIGLLIYMFVALAVVCDEFFVPSLSVITEVLAISDDVAGATFMAAGGSAPEFFTSLFGVFVAQDNVGVGTIVGSATFNILCVLAFCTLFSRQVLHLTWWPLFRDMSFYTLSLFLLLIFFGDEVIEWQEALVMFSMYIAYGFFMKFNGFLELKTKQFLFRKVGIGSEIAPETIVDAAAGCTPRSPHSLGAQGPRRSFPMIHGGQE 305          

HSP 2 Score: 145.591 bits (366), Expect = 2.828e-36
Identity = 75/180 (41.67%), Postives = 112/180 (62.22%), Query Frame = 1
Query: 1093 PLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLG-------KPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYE 1611
            P+ F L  ++PD ++   RK+F ITFI + +WI  YSY+M+W    IG T GIP  +MGLT +AAG+S+PD I SV+V R+G GDMAVS+++GSN+FD+ + + +PWLI    +G       + I + S GL+ +   LF  +  L+    +  WKM K FG ++I  Y  F ++C + E
Sbjct:  466 PITFPLAYTLPDVRKPSLRKFFAITFIGAILWIAAYSYLMVWWANTIGETFGIPTEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSIGSNLFDVCVGLPIPWLIH-FAIGVFKSEPTQNISVTSNGLVCSLGLLFAMLIVLLTCVAISRWKMDKFFGLLMIFSYCGFCMLCILLE 644          
BLAST of slc24a-1 vs. Ensembl Celegans
Match: ncx-4 (Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:Q1ZXT5])

HSP 1 Score: 108.227 bits (269), Expect = 3.174e-27
Identity = 62/136 (45.59%), Postives = 85/136 (62.50%), Query Frame = 1
Query: 1210 MIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCL--------TLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLV 1593
            M+W    IG T  IP  ++GLT +AAG+S+PD I SV+V R+G GDMAVS++VGSN+FD+ + + +PWL+  L            PI + SKGLL +   LF+ +  LVF   L  WKM K FG ++I+ YV F V
Sbjct:    1 MVWWANTIGETFVIPTEIIGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDVCVGLPIPWLLYFLIEYIKHPNEPLSPISVSSKGLLCSVGMLFIMLIVLVFAIFLSGWKMNKIFGILMIVSYVFFCV 136          
BLAST of slc24a-1 vs. Ensembl Celegans
Match: ncx-7 (Putative sodium/calcium exchanger 7 [Source:UniProtKB/Swiss-Prot;Acc:P34322])

HSP 1 Score: 71.2478 bits (173), Expect = 1.356e-12
Identity = 49/157 (31.21%), Postives = 87/157 (55.41%), Query Frame = 1
Query: 1168 FINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLGKPILI-----YSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVF 1623
            FI S  WI + S  ++ ++T++G    +   V+GLT +A  +S+ D IA V VV++G   MA++ A+G  +F++L+  G+P+ I  L  GK I +     Y   +L+  I+L  T+ G+     +  +++ +    +LI IY+AF+V   + E  V 
Sbjct:  518 FIMSIAWIYLISSEVVNVVTMLGVVSRVSHEVLGLTILAWSNSIGDLIADVSVVKQGYPRMAMAAAIGGPLFNLLMGFGLPFTIAKLQ-GKYISMTINPTYRLLILFLAISLLATLIGI----PVQKFRLQRPHAAVLISIYIAFIVFVILSETGVL 669          

HSP 2 Score: 58.151 bits (139), Expect = 1.810e-8
Identity = 37/134 (27.61%), Postives = 67/134 (50.00%), Query Frame = 1
Query:  289 LIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVF---IAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLA--LVIYDNLVYW 675
            +I+  +  + +FI ++   +D+F P +  I  +L++   VAG TFMA G+ AP++  +I  V      K D+ALG + G   +    V+  S +   +   +  +   RD  FY +++  LA   V Y+ +  W
Sbjct:   91 IIVGVIYMLVLFIMVSSAADDFFSPSISSIVAHLRISESVAGVTFMAFGNGAPDVFGSIASVLSSPTPKADLALGELFGGGLFVTTMVV--STIILTSPFDVEVFSTIRDLLFYLVALSFLAFCFVFYNRVTLW 222          
BLAST of slc24a-1 vs. Ensembl Celegans
Match: ncx-9 (Mitochondrial sodium/calcium exchanger protein [Source:UniProtKB/Swiss-Prot;Acc:O16242])

HSP 1 Score: 70.0922 bits (170), Expect = 3.608e-12
Identity = 51/174 (29.31%), Postives = 96/174 (55.17%), Query Frame = 1
Query: 1120 IPDCKERFFRK--WFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLGKPI-----LIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNV 1620
            +P  KE+ + K  + ++ F+ S  WI   S  ++ ++T+IG   G+   ++GLT +A  + + D +A + VV++G   MA++ A+G  +F++LI  G+P+ I     GK +      +Y   +L+  I+L +T F  +FI     + + +    +LI I+V FL+  C+ E +V
Sbjct:  529 LPLSKEQKYYKEIYSYLGFLMSIAWIYATSNEIVSVVTMIGVVTGLSMELLGLTIMAWSNCIGDIVADIAVVKQGYPKMAMAAAIGGPLFNLLIGFGLPFTIAAAQ-GKEMELLINPVYRLLMLFLGISL-VTTFVALFIQR---FTVRRPHAVLLIFIFVVFLIFICLAEFHV 697          

HSP 2 Score: 56.6102 bits (135), Expect = 5.047e-8
Identity = 34/126 (26.98%), Postives = 69/126 (54.76%), Query Frame = 1
Query:  322 FIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIA---KDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFY--SISIILLALVIYDNLVYWYEA 684
            F+ ++ + +D+F P +  I  +L++   +AG TF+A G+ AP++ ++I  V      K D+ALG + G++ +    V+ +  +F K+  ++   P  RD  FY  +++ I+   + +D +  W  A
Sbjct:  115 FVIMSSIADDFFCPAISGIVSHLRMSESIAGVTFLAFGNGAPDVFSSISSVLTTPKPKADLALGDLFGTSIFVTTVVLAI-IIFTKS-FKVAIIPTLRDLIFYMTTLAFIVFCFLKFDKIEVWMPA 238          
BLAST of slc24a-1 vs. Ensembl Fly
Match: zyd (gene:FBgn0265767 transcript:FBtr0340198)

HSP 1 Score: 314.694 bits (805), Expect = 3.233e-99
Identity = 191/500 (38.20%), Postives = 286/500 (57.20%), Query Frame = 1
Query:  217 NCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMINSGTESDEDYE------------------SGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLG-KP----ILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPEC 1647
            NC+  AID+FP DLFS+  RQSGA+++H + ++Y+F+ LA+VC++YFVP +E IC  L +  DVAGATFMAA +SAPEL   +IG FI + DI +G +VGSA +N++ V     + A   I L+WWPL RD   Y +++ +L  V++D  V WYEA++ +  Y +Y+ + YF+K+ +  AK LV   +  C  N  N+     L + E A+   T+  G   I+  T +                        G ++     + +   S +  A            ++ L  P  K    +  F + + +P+     ++IPDCK+    K F +TFI   +WIG  SY++ WMIT+IG TL IPDSVMG+TF+AAG+SVP+A++SV+V + G G M + N++GSN FDIL+C+GVPWLIK +    +P    + I S GL Y+ ITL  T+F L        +K+ K  G   +++Y+ F+V   + ELNVF  V+ P C
Sbjct:    5 NCTQPAIDDFPRDLFSEAQRQSGAVVLHVIASLYLFVALAVVCDEYFVPAVEKICAALNMSNDVAGATFMAAATSAPELFVNVIGTFITEGDIGVGTIVGSAVFNILAVAACCGIGAGMTIPLDWWPLTRDSIAYGVTVAILICVMHDERVEWYEALILVSLYAVYLAVMYFDKTFQKCAKELVENRI--CQ-NMANIQLNGGL-NKEQAKATSTSGAGTTAISITTSTMTTTLSTTHSAGGGGGAVGLCSGPGAIVQMAPLDDAEAESHVAVAAADEGRK--EEGYSLLSYPKDKSC--FAQFTWLIIWPIHLLFRIAIPDCKKAKNNKIFPLTFIMCIVWIGSLSYVVAWMITIIGDTLKIPDSVMGITFLAAGTSVPEAVSSVIVAKRGHGSMGICNSIGSNTFDILLCLGVPWLIKAVFFPIQPGQNYVAINSAGLEYSAITLLSTLFLLYLTFSTNKFKLDKKVGTACLVMYLVFMVFASLIELNVFFRVNLPTC 496          
BLAST of slc24a-1 vs. Ensembl Fly
Match: CG12061 (gene:FBgn0040031 transcript:FBtr0332625)

HSP 1 Score: 253.447 bits (646), Expect = 1.157e-76
Identity = 160/501 (31.94%), Postives = 255/501 (50.90%), Query Frame = 1
Query:  130 IFYANYKHDINPINNDKSYIS---RQLLSYK---ANCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMINSGTESDEDYESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYEL 1614
            +F+     D  P  N+  Y     R  + Y     NC+  AI  FP  +   + +   A+++  L+++Y+F+ LAIVC+DY VP +E +C  L++  DVAGATF+AA +SAPEL    +G F+   DI LG +VGS+ +N++ + G+  +F +   +L+WWP+ RD A+Y I+I  L  V++D+LV WYEA   +  Y  Y++   F++ ++                   NL       S  + ED  T                  E   L G R+   +   ++ +F + T                      WW      + YP    L  ++P  +  FF     ++ I++ +WI + SY++ W +T++G+ L IPD++MGLT +AAG+SVP+  +S +V ++G G MA+ NA+GSN FDIL+C+G+PWL+K L   + I I S  L   T  L +T   L        + M K+ GY+ II Y  FL++ C  E+
Sbjct:    1 MFFDWSSTDFKPNGNEWEYYPFAYRHDMRYDIDARNCTLPAIVEFPNLM---RQKSWIAIVVSTLVSMYLFVILAIVCDDYLVPAMERLCYTLRMTYDVAGATFLAASTSAPELFVNFVGTFVTNGDIGLGTIVGSSVFNILVIAGVCGIFTQPT-KLDWWPVTRDTAWYLIAIASLTYVLWDSLVMWYEAFALLLLYISYVIQLSFDRRIQ-------------------NLVRHEHAESELLDEDPMTR-----------------EEEPLKGFRDHVCAKPKTEYNFYQWT----------------------WW-----AIKYPAELMLACTVPSARSIFF-----LSMISAILWISLISYLLTWFLTILGYNLNIPDAIMGLTVLAAGTSVPEVASSYIVSKKGYGSMAICNAIGSNTFDILVCLGLPWLLKILIYQQKIDIDSTALTITTAMLVVTAAVLYLGLLARRFVMGKTVGYLSIIFYALFLIIACTLEI 429          
BLAST of slc24a-1 vs. Ensembl Fly
Match: zyd (gene:FBgn0265767 transcript:FBtr0340199)

HSP 1 Score: 240.736 bits (613), Expect = 1.721e-71
Identity = 163/470 (34.68%), Postives = 239/470 (50.85%), Query Frame = 1
Query:  394 LQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTK-----YLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMINSGTESDEDYESGKLIGTRNRNGSC---------------------------CSS-----------DIDFAKKTGCAMC----LRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLG-KP----ILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPEC 1647
            +  DVAGATFMAA +SAPEL   +IG FI + DI +G +VGSA +N++ V     + A   I L+WWPL RD   Y +++ +L  V++D  V WYEA++ +  Y +Y+ + YF+K+ +  AK  V +        NC+I+ +N        SNE   +L        M N       + E  K   T     +                            CS            D +       A          ++ L  P  K    +  F + + +P+     ++IPDCK+    K F +TFI   +WIG  SY++ WMIT+IG TL IPDSVMG+TF+AAG+SVP+A++SV+V + G G M + N++GSN FDIL+C+GVPWLIK +    +P    + I S GL Y+ ITL  T+F L        +K+ K  G   +++Y+ F+V   + ELNVF  V+ P C
Sbjct:    1 MSNDVAGATFMAAATSAPELFVNVIGTFITEGDIGVGTIVGSAVFNILAVAACCGIGAGMTIPLDWWPLTRDSIAYGVTVAILICVMHDERVEWYEALILVSLYAVYLAVMYFDKTFQKCAKGGVKQARSRSRSSNCSIHTKN--------SNEKEPELVENRICQNMANIQLNGGLNKEQAKATSTSGAGTTAISITTSTMTTTLSTTHSAGGGGGAVGLCSGPGAIVQMAPLDDAEAESHVAVAAADEGRKEEGYSLLSYPKDKSC--FAQFTWLIIWPIHLLFRIAIPDCKKAKNNKIFPLTFIMCIVWIGSLSYVVAWMITIIGDTLKIPDSVMGITFLAAGTSVPEAVSSVIVAKRGHGSMGICNSIGSNTFDILLCLGVPWLIKAVFFPIQPGQNYVAINSAGLEYSAITLLSTLFLLYLTFSTNKFKLDKKVGTACLVMYLVFMVFASLIELNVFFRVNLPTC 460          
BLAST of slc24a-1 vs. Ensembl Fly
Match: zyd (gene:FBgn0265767 transcript:FBtr0113769)

HSP 1 Score: 240.736 bits (613), Expect = 1.721e-71
Identity = 163/470 (34.68%), Postives = 239/470 (50.85%), Query Frame = 1
Query:  394 LQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTK-----YLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMINSGTESDEDYESGKLIGTRNRNGSC---------------------------CSS-----------DIDFAKKTGCAMC----LRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLG-KP----ILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPEC 1647
            +  DVAGATFMAA +SAPEL   +IG FI + DI +G +VGSA +N++ V     + A   I L+WWPL RD   Y +++ +L  V++D  V WYEA++ +  Y +Y+ + YF+K+ +  AK  V +        NC+I+ +N        SNE   +L        M N       + E  K   T     +                            CS            D +       A          ++ L  P  K    +  F + + +P+     ++IPDCK+    K F +TFI   +WIG  SY++ WMIT+IG TL IPDSVMG+TF+AAG+SVP+A++SV+V + G G M + N++GSN FDIL+C+GVPWLIK +    +P    + I S GL Y+ ITL  T+F L        +K+ K  G   +++Y+ F+V   + ELNVF  V+ P C
Sbjct:    1 MSNDVAGATFMAAATSAPELFVNVIGTFITEGDIGVGTIVGSAVFNILAVAACCGIGAGMTIPLDWWPLTRDSIAYGVTVAILICVMHDERVEWYEALILVSLYAVYLAVMYFDKTFQKCAKGGVKQARSRSRSSNCSIHTKN--------SNEKEPELVENRICQNMANIQLNGGLNKEQAKATSTSGAGTTAISITTSTMTTTLSTTHSAGGGGGAVGLCSGPGAIVQMAPLDDAEAESHVAVAAADEGRKEEGYSLLSYPKDKSC--FAQFTWLIIWPIHLLFRIAIPDCKKAKNNKIFPLTFIMCIVWIGSLSYVVAWMITIIGDTLKIPDSVMGITFLAAGTSVPEAVSSVIVAKRGHGSMGICNSIGSNTFDILLCLGVPWLIKAVFFPIQPGQNYVAINSAGLEYSAITLLSTLFLLYLTFSTNKFKLDKKVGTACLVMYLVFMVFASLIELNVFFRVNLPTC 460          
BLAST of slc24a-1 vs. Ensembl Fly
Match: zyd (gene:FBgn0265767 transcript:FBtr0347557)

HSP 1 Score: 240.736 bits (613), Expect = 1.721e-71
Identity = 163/470 (34.68%), Postives = 239/470 (50.85%), Query Frame = 1
Query:  394 LQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTK-----YLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMINSGTESDEDYESGKLIGTRNRNGSC---------------------------CSS-----------DIDFAKKTGCAMC----LRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLG-KP----ILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPEC 1647
            +  DVAGATFMAA +SAPEL   +IG FI + DI +G +VGSA +N++ V     + A   I L+WWPL RD   Y +++ +L  V++D  V WYEA++ +  Y +Y+ + YF+K+ +  AK  V +        NC+I+ +N        SNE   +L        M N       + E  K   T     +                            CS            D +       A          ++ L  P  K    +  F + + +P+     ++IPDCK+    K F +TFI   +WIG  SY++ WMIT+IG TL IPDSVMG+TF+AAG+SVP+A++SV+V + G G M + N++GSN FDIL+C+GVPWLIK +    +P    + I S GL Y+ ITL  T+F L        +K+ K  G   +++Y+ F+V   + ELNVF  V+ P C
Sbjct:    1 MSNDVAGATFMAAATSAPELFVNVIGTFITEGDIGVGTIVGSAVFNILAVAACCGIGAGMTIPLDWWPLTRDSIAYGVTVAILICVMHDERVEWYEALILVSLYAVYLAVMYFDKTFQKCAKGGVKQARSRSRSSNCSIHTKN--------SNEKEPELVENRICQNMANIQLNGGLNKEQAKATSTSGAGTTAISITTSTMTTTLSTTHSAGGGGGAVGLCSGPGAIVQMAPLDDAEAESHVAVAAADEGRKEEGYSLLSYPKDKSC--FAQFTWLIIWPIHLLFRIAIPDCKKAKNNKIFPLTFIMCIVWIGSLSYVVAWMITIIGDTLKIPDSVMGITFLAAGTSVPEAVSSVIVAKRGHGSMGICNSIGSNTFDILLCLGVPWLIKAVFFPIQPGQNYVAINSAGLEYSAITLLSTLFLLYLTFSTNKFKLDKKVGTACLVMYLVFMVFASLIELNVFFRVNLPTC 460          
BLAST of slc24a-1 vs. Ensembl Zebrafish
Match: slc24a4b (solute carrier family 24 member 4b [Source:ZFIN;Acc:ZDB-GENE-081031-75])

HSP 1 Score: 343.969 bits (881), Expect = 1.512e-108
Identity = 198/520 (38.08%), Postives = 304/520 (58.46%), Query Frame = 1
Query:  205 SYKANCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTT---STGI-----EMINSGTESDEDYESG-------------------KLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARW----------WNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTL--GKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPEC 1647
            + + NC+  AI  FP+D+F+   R+SGA+++H +  +YMF+ LAIVC+DYFV  LE ICE L L  DVAGATFMAAGSSAPEL  ++IGVFI   D+ +G +VGSA +N++ +IG+  +FA  V+ L WW +FRD  FY +S++ L + IYD  + W+E++V +  Y  YI++  FN  L+   K    K        N+N+++      +E+ ED+ T+   S G      E+IN+   +    E+G                   +LI T  +     ++ ++ A   G            +  ++K++             N   + + +PL   L  +IP+C +  + K+F ++FI S +WI ++SY M+WM+T+IG+TLGIPD +MG+TF+AAG+SVPD IAS++V R+G GDMAVSN +GSNVFDIL+ +GVPW ++ + +  G  ++I S+GLLY+ + L  +V   +   HL  WK+    G  ++++Y  FL    M E NVF  V+ P C
Sbjct:  125 TEEKNCTEPAIHEFPDDVFTNAERKSGAVLLHIIAALYMFLALAIVCDDYFVTSLEKICEKLNLSEDVAGATFMAAGSSAPELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGIFAGQVVLLTWWAVFRDSFFYILSVVALIVFIYDEKIVWWESLVLVVMYACYILIMKFNSRLQ---KFFTRK-------GNKNVANGNAAAGSEL-EDVKTSKIYSRGSVVMVDEIINASPPNYRFPEAGLRVMVTNHFGPKTRLRMASRLIITERQRLVQSANGVETAVVDGKPDIENGNVPEDKSTEEKESELTTPFRLPDGCMNRTKWLISWPLLLILFFTIPNCAKSRWEKYFMLSFILSTVWIAVFSYFMVWMVTIIGYTLGIPDVIMGITFLAAGTSVPDCIASLIVARQGLGDMAVSNTIGSNVFDILVGLGVPWALQTMAVNYGSVVMINSRGLLYSVVLLLGSVALTILGIHLNHWKLDFKLGVYVLLLYAVFLCFSIMIEYNVFTFVNLPMC 633          
BLAST of slc24a-1 vs. Ensembl Zebrafish
Match: slc24a4a (solute carrier family 24 member 4a [Source:ZFIN;Acc:ZDB-GENE-050417-291])

HSP 1 Score: 330.487 bits (846), Expect = 7.464e-104
Identity = 197/517 (38.10%), Postives = 296/517 (57.25%), Query Frame = 1
Query:  205 SYKANCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGI---EMINSGTESDEDYESG---------------------------KLIGTRNRNGSCCSSD--IDFAKKTGCAMCLRSCFATLEL-PDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTL--GKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPECI 1650
            + + NC+  AI  FPEDLF+ + R  GA+++H    +YMF+ LAIVC+DYFV  LE ICE L L  DVAGATFMAAGSSAPEL  +IIGVFI   D+ +G +VGSA +N++ +IG+  +FA  V+ L  + +FRD ++Y IS+I L + IYD+ + W+E++V I  Y  YI++  FN SL+    +   K     T  N   S+   +  N++    +T  + +   EM+NS        E+G                           +L+ + N   S   SD   D  +    A    S     E+ P +      +   + + +P+   L  +IP+C ++ +   F ++F  S +WI  +SYI++WM+T++G+TLGIPD +MG+TF+AAG+SVPD IAS++V R+G GDMAVSN +GSNVFDIL+ +GVPW I+ + +  G  + I S+GL+Y+ + L  +V   V   H+  W++    G  ++++Y  FL    M E NVF  V+ P CI
Sbjct:   89 TQEKNCTAPAIHEFPEDLFTNQQRSQGAVLLHIFAALYMFLALAIVCDDYFVTSLEKICEKLHLSEDVAGATFMAAGSSAPELFASIIGVFITHGDVGVGTIVGSAVFNILCIIGVCGIFAGQVVFLTKYAVFRDSSYYIISVIALIVFIYDDEILWWESLVLIVMYLGYIIVMKFNTSLQ---NLFNGKEDKRVTNGNAVSSEMEPVKPNKI----YTRGSVVMVDEMMNSSPPHYRFPEAGLRVMITNHFGPKTRLRMASRLIINEQQRLVKSANGVDSVLVSDQKADTMENGNVAEDKLSEEQENEISPFRLPEGAMDTVKFFISWPISLLLYFTIPNCAKKRWECCFMLSFFLSTVWIAAFSYILVWMVTIVGYTLGIPDVIMGITFLAAGTSVPDCIASLIVARQGLGDMAVSNTIGSNVFDILVGLGVPWGIQTMAVNYGSVVKINSRGLVYSVVLLLGSVALTVLGIHVNRWRLDLRLGIYVLVLYAIFLTFSIMIEYNVFTFVNLPMCI 598          
BLAST of slc24a-1 vs. Ensembl Zebrafish
Match: BX088721.1 (solute carrier family 24 member 6a [Source:NCBI gene;Acc:561209])

HSP 1 Score: 318.931 bits (816), Expect = 2.098e-100
Identity = 189/511 (36.99%), Postives = 285/511 (55.77%), Query Frame = 1
Query:  196 QLLSYKANCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTV-IQLNWWPLFRDCAFYSISIILLALV----IYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHT-------TSTGIEMINSGTESDEDYESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKK-------------------------KARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTL--GKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYE 1611
            Q+L +    +P  I  FP+D+F+K  R+ GA+++H    +YMF  LAIVC+ +FVP LE ICENL L  DVAGATFMAAGSSAPEL T++IGVFI K D+ +G +VGSA +N++ +IG+  +FA  V I L WWPLFRD  FY +S++ L LV    ++  L  +Y     IF     + +  +N  +++W+         +    N    D   +M +E+   LH         S  + +    +       +G+++ T    G      + +  + G A  L S    LE P ++                         + RW     +   +PL   L  ++P+C    + +WF +TF+ S +WI ++SY+M+WM+T+I FTL IPD VMG+TF+AAG+SVPD +AS++V R+G GDMAVSN++GSN+FDIL+ +G PW ++ L +  G  + I SKGL+Y+ I L  +VF  V   HL  W++ +  G  L+ +Y  FL+    +E
Sbjct:   25 QVLWFPPQSNP--IHEFPQDIFTKGQRRHGAILLHVFCAVYMFYALAIVCDVFFVPSLEKICENLHLSEDVAGATFMAAGSSAPELFTSLIGVFITKGDLGVGTIVGSAVFNILVIIGVCGIFAGQVTITLTWWPLFRDSIFYILSVLALILVSRTVVFQVLFVFYILKRAIFHITSLLQVGDYNPHIDVWSL--------HPHHENAGGQDSPVVMVDELM-SLHPHQFSFSEASLRVMITPHFSPRTRLSMAGRMLITEVLAGP-----VPWGLENGGA--LESETQPLEEPRRRSQGGELERVADIEDTHNDLKCFLSTEGRW-EQAKWMFSWPLSCLLYYTVPNCVLPRWERWFMVTFVASTLWIAVFSYLMVWMVTIISFTLDIPDVVMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNIFDILLGLGFPWALRTLVVDYGSTVSINSKGLVYSVILLLASVFLTVLSVHLNHWRLDRRLGLGLMFLYAIFLLCSICFE 516          
BLAST of slc24a-1 vs. Ensembl Zebrafish
Match: slc24a5 (solute carrier family 24 member 5 [Source:ZFIN;Acc:ZDB-GENE-031210-1])

HSP 1 Score: 310.071 bits (793), Expect = 4.422e-97
Identity = 175/486 (36.01%), Postives = 276/486 (56.79%), Query Frame = 1
Query:  193 RQLLSYKANCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMINSGTESDEDYESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARW------WNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKC--LTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFG 1626
            R+ L   + C       FPE  F+ + R+ G ++I+F+I  YM + ++IVC++YF+P LE I E L L  DVAGATFMAAGSSAPEL T  +GVF+ K DI +  ++GSA YNL+ +     L +  V +L+ WPLFRDC  YSIS+  +  +I DN VYWY+    +  YG+Y+ +  F+  +   ++ ++ ++ P C        D                 +G +    G   D        +  R+RN S       F   +G +    S     E+ D+ K+ +           + L  P+   L VS+PDC+  F++ ++ +TF+ S +WI  ++Y+++WM+T++G TLGIPD+VMG+T +AAG+S+PD +ASV+V REG+ DMA+SN VGSNVFD+L C+G+PW I+   + +G P+ + S GL++ + TL +++  L    H+  WK+    G + +  Y+ F  +  +YEL + G
Sbjct:   49 RRDLENASECVQPQSSEFPEGFFTVQERKDGGILIYFMIIFYMLLSVSIVCDEYFLPSLEVISERLGLSQDVAGATFMAAGSSAPELVTAFLGVFVTKGDIGVSTIMGSAVYNLLCICAACGLLSSAVGRLSCWPLFRDCVAYSISVAAVIAIISDNRVYWYDGACLLLVYGVYVAVLCFDLKI---SEYVMQRFSPCCWCLKPRDRD-----------------SGEQQPLVGWSDDSSLR----VQRRSRNDSGI-----FQDDSGYSHLSLSLHGLNEISDEHKSVFSMPDHDLKRILWVLSLPVSTLLFVSVPDCRRPFWKNFYMLTFLMSAVWISAFTYVLVWMVTIVGETLGIPDTVMGMTLLAAGTSIPDTVASVMVAREGKSDMAMSNIVGSNVFDML-CLGLPWFIQTVFVDVGSPVDVNSSGLVFMSCTLLLSIIFLFLAVHINGWKLDWKLGLVCLACYILFATLSILYELGIIG 504          
BLAST of slc24a-1 vs. Ensembl Zebrafish
Match: slc24a2 (solute carrier family 24 member 2 [Source:ZFIN;Acc:ZDB-GENE-060825-277])

HSP 1 Score: 295.819 bits (756), Expect = 1.606e-90
Identity = 184/521 (35.32%), Postives = 284/521 (54.51%), Query Frame = 1
Query:  169 NNDKSYISRQLLSYKANCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPN------------CTINNEN-LSDEAFLMSNEVAEDLHTTSTGIEMINSGTESDEDYESGKL-------------IGTRNRNGSC-----CSSDIDF---AKKTGCAMCLRSCFATLELPDKKKARWW-----NYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLI-KCLTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYE 1611
            ++++  +S  +    A+ +  +   +PEDLF+ + R+ GA+++H    +YMFI LAIVC+++FVP L  I E L++  DVAGATFMAAG SAPEL T++IGVFI+  ++ +G +VGSA +N++FVIG+ ALF++ ++ L WWPLFRD +FY I +I+L +   DN + + E+   +  YG Y+    FN S+E W K   T+ L N               ++EN LS +  L     +  LH T     +      + +    GK               G    NG        SS+++        G A          E  D+  +  W         Y   +P+ F L +S+PD +    RK+F +TF+ S  WI  +SY+M+W    +G T+GI + +MGLT +AAG+S+PD I SV+V R+G GDMAVS++VGSN+FDI + +  PWL+   L     + + S GL  A + LF+ +  ++    +  WKM+K  G+++ ++Y  FLVV  M E
Sbjct:   92 SDEERNVSADVPIAMASSAEHSKGEYPEDLFTLEQRRQGAVVLHMFGMMYMFIALAIVCDEFFVPALTVITEKLEISDDVAGATFMAAGGSAPELFTSVIGVFISHSNVGIGTIVGSAVFNILFVIGMCALFSREILNLTWWPLFRDVSFYIIGLIMLIVFFLDNYITYVESFALLSCYGSYVTFMKFNSSVETWIK---TRLLGNQVDDIEAPPKVVSVPDDENKLSAKPRLQRGGSSASLHNTLMRNSIFQLMIHTLDPLSEGKFKEKASILHKIARKKGQDEANGVVDKNLPNSSNVEVEVTPPMNGSAGPEVEVEEEEEDEDQPLSLAWPDTIRKQVTYLFIFPIVFPLWLSLPDVRRESSRKFFPVTFLGSISWIAFFSYLMVWWAHQVGETIGITEEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPFPWLLFSMLNDFSSVAVSSNGLFCAIVLLFLMLLFVIISIAVCKWKMSKMLGFLMFLLYFVFLVVSVMLE 609          
BLAST of slc24a-1 vs. Ensembl Xenopus
Match: nt5c3a (5'-nucleotidase, cytosolic IIIA [Source:Xenbase;Acc:XB-GENE-1004833])

HSP 1 Score: 336.265 bits (861), Expect = 9.632e-107
Identity = 200/495 (40.40%), Postives = 286/495 (57.78%), Query Frame = 1
Query:  232 AIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVY------WYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLH----TTSTGIE-----MINSGTESD------EDYESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTL--GKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPEC 1647
            AI+ FP+DLFS K RQ GA++ H    +YMF  LAIVC+D+FVP LE ICE L L  DVAGATFMAAGSS PEL  ++IGVFI   D+ +G +VGSA +N++ +IG+  +FA  V++L WW LFRD  +Y ISI+ L +V   +++Y      +Y     +    I        +  E   ++++T   P  T     L   + L+ NE    LH    T++T ++     + N G   D      E+ E+  L+        C  SDI F    GCA                     N F +   +PL   L  +IP+C +  +  +F +TFI S +WI ++SYIM+WM+TVIG+TLGIPD +MG+TF+AAG+SVPD +AS++V R+G GDMAVSN++GSNVFDIL+ +GVPW ++ + +  G  + I SKGL+Y+ I L  +V   V   ++  WK+ K FG+ ++ +Y  FL    + E NVF  V+ P C
Sbjct:   59 AINEFPDDLFSIKERQRGAVLFHIFCALYMFYALAIVCDDFFVPSLEKICEKLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGVFAGQVVRLTWWSLFRDSMYYIISILALIIV---SMIYLLASQQYYNRNSVVMVDEIICSSPPKYRFPEAGLRIMITNKFPPRT----RLRMASRLIINERQRLLHSANGTSTTTLDGKQELLENGGLHVDKADDYQEENEANYLVPFSVPKPYCLPSDI-FLSLGGCA---------------------NIFKWAFSWPLICILYFTIPNCSKPRWENFFMLTFITSTLWIAIFSYIMVWMVTVIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNSIGSNVFDILVGLGVPWGLQTMIINYGSTVKINSKGLVYSVILLLGSVALTVGGIYVNKWKLDKKFGFYVLFLYAIFLCFSVLIEYNVFTFVNLPTC 524          
BLAST of slc24a-1 vs. Ensembl Xenopus
Match: SLC24A5 (solute carrier family 24 member 5 [Source:NCBI gene;Acc:100490024])

HSP 1 Score: 332.798 bits (852), Expect = 3.244e-106
Identity = 192/489 (39.26%), Postives = 280/489 (57.26%), Query Frame = 1
Query:  184 YISRQLLSYKAN------CSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMINSGTESDEDYESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLGK--PILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFG 1626
            +I RQ +  +        C       FPED F+++ R+ G LIIHFLI +YMF+ +AIVCE YF+P LE I E L L  DVAGATFMA GSSAPE  T  +GVF+ K DI +  +VGSA YNL+ +     L + +V +L  WPLFRDC  Y+IS+  +  + +DN +YWYE+   I  YGIYIV   F+  +    + ++ ++ P CT        EA + + E    L      + +I   + SD         G            I  +     +    S F T+   D K+  W       L  P+   L +++PDC+ + ++  F +TF+ S +WI   +YI++WM+TV+G TL IPD+VMGLT +AAG+S+PD +ASVLV REG+GDMA+SN VGSNVFD+L C+GVPW IK + + +  P+ + S G+ Y TI+L  ++  +    HL  WK+ K  G + +++Y+ F+ +  +YEL + G
Sbjct:    2 FIKRQHIPQRCTIKNETLCIASPSSEFPEDFFTEQERKQGGLIIHFLIILYMFLAVAIVCESYFIPSLEVISERLGLSQDVAGATFMAIGSSAPEFVTVFLGVFVTKGDIGVSTIVGSAVYNLLGICAACCLLSLSVSRLTCWPLFRDCVAYAISVAAVIAITFDNRIYWYESASLILIYGIYIVTMCFDIRIN---QYIMRRFSPCCT-----CCREAMVGNTEHEPLLGWKEDSLPVIRRHSRSDS--------GIFQEESDYSQLSISLSGLKESSNNPPSVF-TMPENDLKRIIWV------LSLPIITLLYLTVPDCRRKRWKNLFILTFLMSAVWISAVTYILVWMVTVVGETLSIPDTVMGLTLLAAGTSIPDTVASVLVAREGKGDMAMSNIVGSNVFDML-CLGVPWFIKTVFVDRSAPVEVNSSGITYTTISLLFSILFIFVAIHLNGWKLDKKLGVMCLLMYLLFVTLSILYELGIIG 466          
BLAST of slc24a-1 vs. Ensembl Xenopus
Match: nt5c3a (5'-nucleotidase, cytosolic IIIA [Source:Xenbase;Acc:XB-GENE-1004833])

HSP 1 Score: 336.65 bits (862), Expect = 3.377e-106
Identity = 198/521 (38.00%), Postives = 301/521 (57.77%), Query Frame = 1
Query:  190 SRQLL-----SYKANCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNL-VYWYEAXXXXXXXXXXXXLNYFNKSLELWA-------KMLVTKYLPNCTINNENLSDEAFLMSNEV----AEDLHTTSTGIEMINSGT---ESDEDYESGKLIGTRNR-----NGSCCSS---DIDFAKKTGCAMCLRSCF-----ATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTL--GKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPEC 1647
            +R+LL     +   NC+  AI+ FP+DLFS K RQ GA++ H    +YMF  LAIVC+D+FVP LE ICE L L  DVAGATFMAAGSS PEL  ++IGVFI   D+ +G +VGSA +N++ +IG+  +FA  V++L WW LFRD  +Y ISI+ L + IYD + V+W   I+ + ++   +++ Y  K   L+           V   L +   + +  +  + +M +E+             G+ ++ +      +     S  +I  R R     NG+  ++     +  +  G  +     +     A   +P    +   N F +   +PL   L  +IP+C +  +  +F +TFI S +WI ++SYIM+WM+TVIG+TLGIPD +MG+TF+AAG+SVPD +AS++V R+G GDMAVSN++GSNVFDIL+ +GVPW ++ + +  G  + I SKGL+Y+ I L  +V   V   ++  WK+ K FG+ ++ +Y  FL    + E NVF  V+ P C
Sbjct:   69 NRRLLVSDNGTQAKNCTEPAINEFPDDLFSIKERQRGAVLFHIFCALYMFYALAIVCDDFFVPSLEKICEKLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGVFAGQVVRLTWWSLFRDSMYYIISILALIIFIYDEIIVWWESLILIVMYFFYILIMKYNTKMQRLFTIKKNVGNGCPVGSELQDVKASQQYYNRNSVVMVDEIICSSPPKYRFPEAGLRIMITNKFPPRTRLRMASRLIINERQRLLHSANGTSTTTLDGKQELLENGGLHVDKADDYQEENEANYLVPFSVPSGCANIFKWAFSWPLICILYFTIPNCSKPRWENFFMLTFITSTLWIAIFSYIMVWMVTVIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNSIGSNVFDILVGLGVPWGLQTMIINYGSTVKINSKGLVYSVILLLGSVALTVGGIYVNKWKLDKKFGFYVLFLYAIFLCFSVLIEYNVFTFVNLPTC 589          
BLAST of slc24a-1 vs. Ensembl Xenopus
Match: SLC24A5 (solute carrier family 24 member 5 [Source:NCBI gene;Acc:100490024])

HSP 1 Score: 331.643 bits (849), Expect = 7.843e-106
Identity = 189/471 (40.13%), Postives = 274/471 (58.17%), Query Frame = 1
Query:  220 CSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMINSGTESDEDYESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLGK--PILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFG 1626
            C       FPED F+++ R+ G LIIHFLI +YMF+ +AIVCE YF+P LE I E L L  DVAGATFMA GSSAPE  T  +GVF+ K DI +  +VGSA YNL+ +     L + +V +L  WPLFRDC  Y+IS+  +  + +DN +YWYE+   I  YGIYIV   F+  +    + ++ ++ P CT        EA + + E    L      + +I   + SD         G            I  +     +    S F T+   D K+  W       L  P+   L +++PDC+ + ++  F +TF+ S +WI   +YI++WM+TV+G TL IPD+VMGLT +AAG+S+PD +ASVLV REG+GDMA+SN VGSNVFD+L C+GVPW IK + + +  P+ + S G+ Y TI+L  ++  +    HL  WK+ K  G + +++Y+ F+ +  +YEL + G
Sbjct:    8 CIASPSSEFPEDFFTEQERKQGGLIIHFLIILYMFLAVAIVCESYFIPSLEVISERLGLSQDVAGATFMAIGSSAPEFVTVFLGVFVTKGDIGVSTIVGSAVYNLLGICAACCLLSLSVSRLTCWPLFRDCVAYAISVAAVIAITFDNRIYWYESASLILIYGIYIVTMCFDIRIN---QYIMRRFSPCCT-----CCREAMVGNTEHEPLLGWKEDSLPVIRRHSRSDS--------GIFQEESDYSQLSISLSGLKESSNNPPSVF-TMPENDLKRIIWV------LSLPIITLLYLTVPDCRRKRWKNLFILTFLMSAVWISAVTYILVWMVTVVGETLSIPDTVMGLTLLAAGTSIPDTVASVLVAREGKGDMAMSNIVGSNVFDML-CLGVPWFIKTVFVDRSAPVEVNSSGITYTTISLLFSILFIFVAIHLNGWKLDKKLGVMCLLMYLLFVTLSILYELGIIG 454          
BLAST of slc24a-1 vs. Ensembl Xenopus
Match: SLC24A5 (solute carrier family 24 member 5 [Source:NCBI gene;Acc:100490024])

HSP 1 Score: 332.028 bits (850), Expect = 1.017e-105
Identity = 190/477 (39.83%), Postives = 276/477 (57.86%), Query Frame = 1
Query:  202 LSYKANCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMINSGTESDEDYESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLGK--PILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFG 1626
            L  +  C       FPED F+++ R+ G LIIHFLI +YMF+ +AIVCE YF+P LE I E L L  DVAGATFMA GSSAPE  T  +GVF+ K DI +  +VGSA YNL+ +     L + +V +L  WPLFRDC  Y+IS+  +  + +DN +YWYE+   I  YGIYIV   F+  +    + ++ ++ P CT        EA + + E    L      + +I   + SD         G            I  +     +    S F T+   D K+  W       L  P+   L +++PDC+ + ++  F +TF+ S +WI   +YI++WM+TV+G TL IPD+VMGLT +AAG+S+PD +ASVLV REG+GDMA+SN VGSNVFD+L C+GVPW IK + + +  P+ + S G+ Y TI+L  ++  +    HL  WK+ K  G + +++Y+ F+ +  +YEL + G
Sbjct:   25 LENETLCIASPSSEFPEDFFTEQERKQGGLIIHFLIILYMFLAVAIVCESYFIPSLEVISERLGLSQDVAGATFMAIGSSAPEFVTVFLGVFVTKGDIGVSTIVGSAVYNLLGICAACCLLSLSVSRLTCWPLFRDCVAYAISVAAVIAITFDNRIYWYESASLILIYGIYIVTMCFDIRIN---QYIMRRFSPCCT-----CCREAMVGNTEHEPLLGWKEDSLPVIRRHSRSDS--------GIFQEESDYSQLSISLSGLKESSNNPPSVF-TMPENDLKRIIWV------LSLPIITLLYLTVPDCRRKRWKNLFILTFLMSAVWISAVTYILVWMVTVVGETLSIPDTVMGLTLLAAGTSIPDTVASVLVAREGKGDMAMSNIVGSNVFDML-CLGVPWFIKTVFVDRSAPVEVNSSGITYTTISLLFSILFIFVAIHLNGWKLDKKLGVMCLLMYLLFVTLSILYELGIIG 477          
BLAST of slc24a-1 vs. Ensembl Mouse
Match: Slc24a5 (solute carrier family 24, member 5 [Source:MGI Symbol;Acc:MGI:2677271])

HSP 1 Score: 317.775 bits (813), Expect = 3.273e-100
Identity = 176/475 (37.05%), Postives = 265/475 (55.79%), Query Frame = 1
Query:  211 KANCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMINSGT-ESDEDYESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKC--LTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFG 1626
               C+      FPE  F+K+    G ++I+FLI +YM + ++IVC+ YF+P LE I ++L L  DVAGATFMAAGSSAPEL T  +GVFI K DI +  ++GSA YNL+ +     L +  V  L+ WPLFRDCA Y++S+  +  +I+DN +YWYE    +  YG+Y++L  F+ ++        +   P      E   ++  L+  E    L          +SG  + D  Y    L                     G +       +   +P+    R     ++ L  P+   L ++ PDC+ +F++ +F ITF  S +WI  ++YI++WM+TV G TLGIPD+VMGLT +AAG+S+PD + SVLV R+G+GDMA+SN VGSNVFD+L C+G+PW IK        PI + SKGL Y TI+L +++  L    H   WK+ +  G + +++Y+    +  +YE+ + G
Sbjct:   43 STQCAVSPASEFPEGFFTKQESTDGGIVIYFLIILYMCMAISIVCDKYFLPSLEIISDSLGLSQDVAGATFMAAGSSAPELVTAFLGVFITKGDIGISTILGSAIYNLLGICAACGLLSNMVSTLSCWPLFRDCAVYAVSVGAVFGIIFDNRIYWYEGAGLLLIYGLYVLLLCFDTTISRHVMKTCSPCCPCLARAMEERIEQQTLLGWEDESQLFIRRQ--SRTDSGIFQEDSGYSQLSL------------------SLHGLSQVSEDPPSVFSMPEADLRR----IFWVLSLPIITLLALTTPDCRRKFWKNYFVITFFMSALWISAFTYILVWMVTVTGETLGIPDTVMGLTLLAAGTSIPDTVTSVLVARKGKGDMAISNIVGSNVFDML-CLGLPWFIKTAFTNASAPIEVNSKGLTYITISLNISILFLFLAVHFNGWKLDRKLGVVCLVLYLGLATLSVLYEIGIIG 492          
BLAST of slc24a-1 vs. Ensembl Mouse
Match: Slc24a4 (solute carrier family 24 (sodium/potassium/calcium exchanger), member 4 [Source:MGI Symbol;Acc:MGI:2447362])

HSP 1 Score: 194.512 bits (493), Expect = 4.391e-53
Identity = 92/213 (43.19%), Postives = 143/213 (67.14%), Query Frame = 1
Query: 1021 FATLELPDKK--KARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTL--GKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPEC 1647
             +   +P+ K  KA+W         +PL F LCV+IP+C +  + K+F +TFI + +WI ++SY+M+W++T+IG+TLGIPD +MG+TF+AAG+SVPD +AS++V R+G GDMAVSN +GSNVFDIL+ +G+PW ++ + +  G  + I S+GL+Y+ + L  +V   V   HL  W++ +  G  ++++Y  FL    M E NVF  V+ P C
Sbjct:  393 LSPFSMPEAKGDKAKWV------FTWPLIFLLCVTIPNCSKPRWEKFFMVTFITATLWIAVFSYLMVWLVTIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNTIGSNVFDILVGLGIPWGLQTMVINYGSTVKINSRGLVYSVVLLLGSVALTVLGIHLNKWRLDRKLGIYVLVLYAVFLCFSIMIEFNVFTFVNLPMC 599          

HSP 2 Score: 183.341 bits (464), Expect = 3.676e-49
Identity = 92/229 (40.17%), Postives = 135/229 (58.95%), Query Frame = 1
Query:   25 IQSIEKYSDSNRHKTMKKRSYISIWTFLLMFGCLFIFYANYKHDINPINND---KSYISRQLLS------YKANCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEA 684
            ++ + + S   R + M  +    +   L +  C    + +  H            ++ +R+L++         NC+  AI  FP DLFS K RQ GA+++H L  +YMF  LAIVC+D+FVP LE ICE L L  DVAGATFMAAGSS PEL  ++IGVFI   D+ +G +VGSA +N++ +IG+  LFA  V++L WW + RD  +Y++S+I+L   IYD  + W+E 
Sbjct:    3 LRGLIRQSKVRRRREMLPQQVGFVCAVLALVCCASGLFGSLGHKTASAGKHVLLDTWRNRKLMAPINGTPLAKNCTDPAIHEFPTDLFSNKERQHGAVLLHILGALYMFYALAIVCDDFFVPSLEKICEKLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVRLTWWAVCRDSVYYTLSVIVLIAFIYDEEIVWWEG 231          

HSP 3 Score: 51.6026 bits (122), Expect = 3.410e-6
Identity = 39/118 (33.05%), Postives = 63/118 (53.39%), Query Frame = 1
Query: 1243 LGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVV 1596
            L + + V G TF+AAGSS P+  ASV+ V    GD+ V   VGS VF+IL  +GV  L     +        +  +Y T+++      +V I  +Y  ++    G +LII+YV ++++
Sbjct:  133 LHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVRLTWWAVCRDSVYYTLSV------IVLIAFIYDEEIVWWEGLVLIILYVFYILI 244          
BLAST of slc24a-1 vs. Ensembl Mouse
Match: Slc24a4 (solute carrier family 24 (sodium/potassium/calcium exchanger), member 4 [Source:MGI Symbol;Acc:MGI:2447362])

HSP 1 Score: 194.512 bits (493), Expect = 4.673e-53
Identity = 92/213 (43.19%), Postives = 143/213 (67.14%), Query Frame = 1
Query: 1021 FATLELPDKK--KARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTL--GKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPEC 1647
             +   +P+ K  KA+W         +PL F LCV+IP+C +  + K+F +TFI + +WI ++SY+M+W++T+IG+TLGIPD +MG+TF+AAG+SVPD +AS++V R+G GDMAVSN +GSNVFDIL+ +G+PW ++ + +  G  + I S+GL+Y+ + L  +V   V   HL  W++ +  G  ++++Y  FL    M E NVF  V+ P C
Sbjct:  395 LSPFSMPEAKGDKAKWV------FTWPLIFLLCVTIPNCSKPRWEKFFMVTFITATLWIAVFSYLMVWLVTIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNTIGSNVFDILVGLGIPWGLQTMVINYGSTVKINSRGLVYSVVLLLGSVALTVLGIHLNKWRLDRKLGIYVLVLYAVFLCFSIMIEFNVFTFVNLPMC 601          

HSP 2 Score: 182.57 bits (462), Expect = 7.721e-49
Identity = 84/156 (53.85%), Postives = 111/156 (71.15%), Query Frame = 1
Query:  217 NCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEA 684
            NC+  AI  FP DLFS K RQ GA+++H L  +YMF  LAIVC+D+FVP LE ICE L L  DVAGATFMAAGSS PEL  ++IGVFI   D+ +G +VGSA +N++ +IG+  LFA  V++L WW + RD  +Y++S+I+L   IYD  + W+E 
Sbjct:   59 NCTDPAIHEFPTDLFSNKERQHGAVLLHILGALYMFYALAIVCDDFFVPSLEKICEKLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVRLTWWAVCRDSVYYTLSVIVLIAFIYDEEIVWWEG 214          

HSP 3 Score: 51.6026 bits (122), Expect = 3.300e-6
Identity = 39/118 (33.05%), Postives = 63/118 (53.39%), Query Frame = 1
Query: 1243 LGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVV 1596
            L + + V G TF+AAGSS P+  ASV+ V    GD+ V   VGS VF+IL  +GV  L     +        +  +Y T+++      +V I  +Y  ++    G +LII+YV ++++
Sbjct:  116 LHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVRLTWWAVCRDSVYYTLSV------IVLIAFIYDEEIVWWEGLVLIILYVFYILI 227          
BLAST of slc24a-1 vs. Ensembl Mouse
Match: Slc24a4 (solute carrier family 24 (sodium/potassium/calcium exchanger), member 4 [Source:MGI Symbol;Acc:MGI:2447362])

HSP 1 Score: 194.126 bits (492), Expect = 6.313e-53
Identity = 92/213 (43.19%), Postives = 143/213 (67.14%), Query Frame = 1
Query: 1021 FATLELPDKK--KARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTL--GKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPEC 1647
             +   +P+ K  KA+W         +PL F LCV+IP+C +  + K+F +TFI + +WI ++SY+M+W++T+IG+TLGIPD +MG+TF+AAG+SVPD +AS++V R+G GDMAVSN +GSNVFDIL+ +G+PW ++ + +  G  + I S+GL+Y+ + L  +V   V   HL  W++ +  G  ++++Y  FL    M E NVF  V+ P C
Sbjct:  412 LSPFSMPEAKGDKAKWV------FTWPLIFLLCVTIPNCSKPRWEKFFMVTFITATLWIAVFSYLMVWLVTIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNTIGSNVFDILVGLGIPWGLQTMVINYGSTVKINSRGLVYSVVLLLGSVALTVLGIHLNKWRLDRKLGIYVLVLYAVFLCFSIMIEFNVFTFVNLPMC 618          

HSP 2 Score: 182.956 bits (463), Expect = 6.424e-49
Identity = 92/229 (40.17%), Postives = 135/229 (58.95%), Query Frame = 1
Query:   25 IQSIEKYSDSNRHKTMKKRSYISIWTFLLMFGCLFIFYANYKHDINPINND---KSYISRQLLS------YKANCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEA 684
            ++ + + S   R + M  +    +   L +  C    + +  H            ++ +R+L++         NC+  AI  FP DLFS K RQ GA+++H L  +YMF  LAIVC+D+FVP LE ICE L L  DVAGATFMAAGSS PEL  ++IGVFI   D+ +G +VGSA +N++ +IG+  LFA  V++L WW + RD  +Y++S+I+L   IYD  + W+E 
Sbjct:    3 LRGLIRQSKVRRRREMLPQQVGFVCAVLALVCCASGLFGSLGHKTASAGKHVLLDTWRNRKLMAPINGTPLAKNCTDPAIHEFPTDLFSNKERQHGAVLLHILGALYMFYALAIVCDDFFVPSLEKICEKLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVRLTWWAVCRDSVYYTLSVIVLIAFIYDEEIVWWEG 231          

HSP 3 Score: 51.2174 bits (121), Expect = 3.770e-6
Identity = 39/118 (33.05%), Postives = 63/118 (53.39%), Query Frame = 1
Query: 1243 LGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVV 1596
            L + + V G TF+AAGSS P+  ASV+ V    GD+ V   VGS VF+IL  +GV  L     +        +  +Y T+++      +V I  +Y  ++    G +LII+YV ++++
Sbjct:  133 LHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVRLTWWAVCRDSVYYTLSV------IVLIAFIYDEEIVWWEGLVLIILYVFYILI 244          
BLAST of slc24a-1 vs. Ensembl Mouse
Match: Slc24a3 (solute carrier family 24 (sodium/potassium/calcium exchanger), member 3 [Source:MGI Symbol;Acc:MGI:2137513])

HSP 1 Score: 192.2 bits (487), Expect = 2.493e-52
Identity = 91/192 (47.40%), Postives = 132/192 (68.75%), Query Frame = 1
Query: 1078 YGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTL--GKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPEC 1647
            +   +PL F L  ++P+C +  + KWF +TF +S +WI  +SY+M+WM+T+IG+TLGIPD +MG+TF+AAG+SVPD +AS++V R+G GDMAVSN++GSNVFDILI +G+PW ++ L +  G  I + S+GL+Y+   L  +VF  VF  HL  W++ K  G   + +Y  FL    M E NVF  V+ P C
Sbjct:  402 WAFTWPLSFVLYFTVPNCNKPHWEKWFMVTFASSTLWIAAFSYMMVWMVTIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNVFDILIGLGLPWALQTLAVDYGSYIRLNSRGLIYSVGLLLASVFVTVFGVHLNKWQLDKKLGCGCLFLYGVFLCFSIMTEFNVFTFVNLPMC 593          

HSP 2 Score: 181.03 bits (458), Expect = 2.044e-48
Identity = 86/171 (50.29%), Postives = 117/171 (68.42%), Query Frame = 1
Query:  172 NDKSYISRQLLSYKANCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEA 684
            ND        L    NC+  A+  FP D+FS + R+ GA+++H L  +YMF  LAIVC+D+FVP LE ICE L L  DVAGATFMAAGSSAPEL T++IGVFI K D+ +G +VGSA +N++ +IG+  LFA  V+ L+ W L RD  +Y++S++ L + IYD  V W+E+
Sbjct:   20 NDTLTSEDAGLQSSKNCTEPALHEFPRDIFSNEDRRQGAVVLHVLCAMYMFYALAIVCDDFFVPSLEKICERLHLSEDVAGATFMAAGSSAPELFTSVIGVFITKGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVALSSWCLLRDSIYYTLSVVALIVFIYDEKVSWWES 190          

HSP 3 Score: 52.373 bits (124), Expect = 1.839e-6
Identity = 40/118 (33.90%), Postives = 66/118 (55.93%), Query Frame = 1
Query: 1243 LGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVV 1596
            L + + V G TF+AAGSS P+   SV+ V   +GD+ V   VGS VF+IL  +GV  L      G+ + + S  LL  +I   ++V  L  I  +Y  K++     +L+++Y+ ++V+
Sbjct:   92 LHLSEDVAGATFMAAGSSAPELFTSVIGVFITKGDVGVGTIVGSAVFNILCIIGVCGLFA----GQVVALSSWCLLRDSIYYTLSVVAL--IVFIYDEKVSWWESLVLVLMYLIYIVI 203          
BLAST of slc24a-1 vs. UniProt/SwissProt
Match: sp|Q71RS6|NCKX5_HUMAN (Sodium/potassium/calcium exchanger 5 OS=Homo sapiens OX=9606 GN=SLC24A5 PE=1 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 1.811e-100
Identity = 184/478 (38.49%), Postives = 275/478 (57.53%), Query Frame = 1
Query:  211 KANCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNCTINNENL--SDEAFLMSNEVAEDLHTTSTGIEMINSGTESDED--YESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKC--LTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFG 1626
               C       FPE  F+++ R+ G +II+FLI +YMF+ ++IVC++YF+P LE I E+L L  DVAG TFMAAGSSAPEL T  +GVFI K DI +  ++GSA YNL+ +     L + TV  L+ WPLFRDCA Y+IS   +  +IYDN VYWYE  + +  YG+Y+++  F+  +    + ++ K  P C    + +  S++  LM  E          G   I   + +D    YE                S +  +   G +       +   +P+    R     ++ L  P+   L ++ PDC+++F++ +F ITF  S IWI  ++YI++WM+T+ G TL IPD+VMGLT +AAG+S+PD IASVLV R+G+GDMA+SN VGSNVFD+L C+G+PW IK   +    P  + S+GL Y TI+L +++  L    H   WK+ +  G + ++ Y+    +  +YEL + G
Sbjct:   43 STQCVISPSSEFPEGFFTRQERRDGGIIIYFLIIVYMFMAISIVCDEYFLPSLEIISESLGLSQDVAGTTFMAAGSSAPELVTAFLGVFITKGDIGISTILGSAIYNLLGICAACGLLSNTVSTLSCWPLFRDCAAYTISAAAVLGIIYDNQVYWYEGALLLLIYGLYVLVLCFDIKIN---QYIIKKCSPCCACLAKAMERSEQQPLMGWE--------DEGQPFIRRQSRTDSGIFYEDSGY------------SQLSISLH-GLSQVSEDPPSVFNMPEADLKR----IFWVLSLPIITLLFLTTPDCRKKFWKNYFVITFFMSAIWISAFTYILVWMVTITGETLEIPDTVMGLTLLAAGTSIPDTIASVLVARKGKGDMAMSNIVGSNVFDML-CLGIPWFIKTAFINGSAPAEVNSRGLTYITISLNISIIFLFLAVHFNGWKLDRKLGIVCLLSYLGLATLSVLYELGIIG 491          
BLAST of slc24a-1 vs. UniProt/SwissProt
Match: sp|Q8C261|NCKX5_MOUSE (Sodium/potassium/calcium exchanger 5 OS=Mus musculus OX=10090 GN=Slc24a5 PE=2 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 2.289e-99
Identity = 176/475 (37.05%), Postives = 265/475 (55.79%), Query Frame = 1
Query:  211 KANCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMINSGT-ESDEDYESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKC--LTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFG 1626
               C+      FPE  F+K+    G ++I+FLI +YM + ++IVC+ YF+P LE I ++L L  DVAGATFMAAGSSAPEL T  +GVFI K DI +  ++GSA YNL+ +     L +  V  L+ WPLFRDCA Y++S+  +  +I+DN +YWYE    +  YG+Y++L  F+ ++        +   P      E   ++  L+  E    L          +SG  + D  Y    L                     G +       +   +P+    R     ++ L  P+   L ++ PDC+ +F++ +F ITF  S +WI  ++YI++WM+TV G TLGIPD+VMGLT +AAG+S+PD + SVLV R+G+GDMA+SN VGSNVFD+L C+G+PW IK        PI + SKGL Y TI+L +++  L    H   WK+ +  G + +++Y+    +  +YE+ + G
Sbjct:   43 STQCAVSPASEFPEGFFTKQESTDGGIVIYFLIILYMCMAISIVCDKYFLPSLEIISDSLGLSQDVAGATFMAAGSSAPELVTAFLGVFITKGDIGISTILGSAIYNLLGICAACGLLSNMVSTLSCWPLFRDCAVYAVSVGAVFGIIFDNRIYWYEGAGLLLIYGLYVLLLCFDTTISRHVMKTCSPCCPCLARAMEERIEQQTLLGWEDESQLFIRRQ--SRTDSGIFQEDSGYSQLSL------------------SLHGLSQVSEDPPSVFSMPEADLRR----IFWVLSLPIITLLALTTPDCRRKFWKNYFVITFFMSALWISAFTYILVWMVTVTGETLGIPDTVMGLTLLAAGTSIPDTVTSVLVARKGKGDMAISNIVGSNVFDML-CLGLPWFIKTAFTNASAPIEVNSKGLTYITISLNISILFLFLAVHFNGWKLDRKLGVVCLVLYLGLATLSVLYEIGIIG 492          
BLAST of slc24a-1 vs. UniProt/SwissProt
Match: sp|Q49SH1|NCKX5_DANRE (Sodium/potassium/calcium exchanger 5 OS=Danio rerio OX=7955 GN=slc24a5 PE=2 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 7.313e-96
Identity = 174/486 (35.80%), Postives = 276/486 (56.79%), Query Frame = 1
Query:  193 RQLLSYKANCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMINSGTESDEDYESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARW------WNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKC--LTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFG 1626
            R+ L   + C       FPE  F+ + R+ G ++I+F+I  YM + ++IVC++YF+P LE I E L L  DVAGATFMAAGSSAPEL T  +GVF+ K DI +  ++GSA YNL+ +     L +  V +L+ WPLFRDC  Y+IS+  +  +I DN VYWY+    +  YG+Y+ +  F+  +   ++ ++ ++ P C        D                 +G +    G   D        +  R+RN S       F   +G +    S     E+ D+ K+ +           + L  P+   L VS+PDC+  F++ ++ +TF+ S +WI  ++Y+++WM+T++G TLGIPD+VMG+T +AAG+S+PD +ASV+V REG+ DMA+SN VGSNVFD+L C+G+PW I+   + +G P+ + S GL++ + TL +++  L    H+  WK+    G + +  Y+ F  +  +YEL + G
Sbjct:   49 RRDLENASECVQPQSSEFPEGFFTVQERKDGGILIYFMIIFYMLLSVSIVCDEYFLPSLEVISERLGLSQDVAGATFMAAGSSAPELVTAFLGVFVTKGDIGVSTIMGSAVYNLLCICAACGLLSSAVGRLSCWPLFRDCVAYAISVAAVIAIISDNRVYWYDGACLLLVYGVYVAVLCFDLRI---SEYVMQRFSPCCWCLKPRDRD-----------------SGEQQPLVGWSDDSSLR----VQRRSRNDSGI-----FQDDSGYSHLSLSLHGLNEISDEHKSVFSMPDHDLKRILWVLSLPVSTLLFVSVPDCRRPFWKNFYMLTFLMSAVWISAFTYVLVWMVTIVGETLGIPDTVMGMTLLAAGTSIPDTVASVMVAREGKSDMAMSNIVGSNVFDML-CLGLPWFIQTVFVDVGSPVEVNSSGLVFMSCTLLLSIIFLFLAVHINGWKLDWKLGLVCLACYILFATLSILYELGIIG 504          
BLAST of slc24a-1 vs. UniProt/SwissProt
Match: sp|Q9VN12|NCKXH_DROME (Probable sodium/potassium/calcium exchanger CG1090 OS=Drosophila melanogaster OX=7227 GN=CG1090 PE=2 SV=4)

HSP 1 Score: 222.246 bits (565), Expect = 3.939e-62
Identity = 102/190 (53.68%), Postives = 141/190 (74.21%), Query Frame = 1
Query: 1084 LCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKC--LTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPEC 1647
            + YP+ F    ++PDC++  +R W+  TF+ S +WI  YSY M+WMITVIG TL IPD+VMGLTF+AAG SVPDA++S+ V++EG GDMAVSNA+GSNVFDIL+C+G+PW I+   +  G  + + SKGL Y+T++LF TV  L+  THL  WK+ K  G IL++ Y+ F+ +  +YELNVFG ++PPEC
Sbjct:  440 VVYPIHFLCKKTMPDCRQEQYRNWYPFTFLMSMVWISFYSYFMVWMITVIGSTLAIPDTVMGLTFVAAGVSVPDALSSIAVIKEGFGDMAVSNAIGSNVFDILVCLGLPWFIQTAIIKPGSHVNVISKGLAYSTLSLFSTVVFLILSTHLNGWKLDKRLGIILMVWYLFFITLASLYELNVFGYMNPPEC 629          

HSP 2 Score: 207.608 bits (527), Expect = 9.299e-57
Identity = 122/294 (41.50%), Postives = 171/294 (58.16%), Query Frame = 1
Query:   46 SDSNRHKTMKKRSYISIWTFLLMFGCLFIFYANYKHDINPINNDKSYISRQLLSYKANCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMINSGTESDEDYESGK 927
            +++N   T ++ S  S+    L F       +   H   P    K          + NC+P AI+ FP+ L +K ARQ G LI+H L+ ++ F GLAIVC++YFV  L+ +CE LKL PDVAGATFMAAGSSAPELAT +IGVF AKDDI +  V+GSA +N+MFVI + AL + TV QLNWWPL RDC FY +SI+++ ++I+++++  +E++V +  Y  Y V  +FN  LE WA  L    LP    + E  S  A +    V E  +T  +  +        D +  S K
Sbjct:   43 AEANGEDTPERNSESSVLDTTLAFEPQASTQSTPIHGAVPTWRPK----------RDNCTPPAIEQFPQPLMNKWARQHGGLILHILVAVFTFFGLAIVCDEYFVASLDRLCEELKLSPDVAGATFMAAGSSAPELATVVIGVFFAKDDIGISGVIGSAVFNIMFVISVCALCSGTVCQLNWWPLVRDCFFYCVSILVMLIIIFNDVISCFESVVMLLCYVGYCVALHFNTELERWALGL---NLPFKLPSKEEQS--ALVTYKNVPEGSYTQESVGQTQGQKATDDSETRSAK 321          
BLAST of slc24a-1 vs. UniProt/SwissProt
Match: sp|Q8CGQ8|NCKX4_MOUSE (Sodium/potassium/calcium exchanger 4 OS=Mus musculus OX=10090 GN=Slc24a4 PE=1 SV=2)

HSP 1 Score: 194.126 bits (492), Expect = 4.416e-52
Identity = 92/213 (43.19%), Postives = 143/213 (67.14%), Query Frame = 1
Query: 1021 FATLELPDKK--KARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTL--GKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPEC 1647
             +   +P+ K  KA+W         +PL F LCV+IP+C +  + K+F +TFI + +WI ++SY+M+W++T+IG+TLGIPD +MG+TF+AAG+SVPD +AS++V R+G GDMAVSN +GSNVFDIL+ +G+PW ++ + +  G  + I S+GL+Y+ + L  +V   V   HL  W++ +  G  ++++Y  FL    M E NVF  V+ P C
Sbjct:  412 LSPFSMPEAKGDKAKWV------FTWPLIFLLCVTIPNCSKPRWEKFFMVTFITATLWIAVFSYLMVWLVTIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNTIGSNVFDILVGLGIPWGLQTMVINYGSTVKINSRGLVYSVVLLLGSVALTVLGIHLNKWRLDRKLGIYVLVLYAVFLCFSIMIEFNVFTFVNLPMC 618          

HSP 2 Score: 182.956 bits (463), Expect = 4.494e-48
Identity = 92/229 (40.17%), Postives = 135/229 (58.95%), Query Frame = 1
Query:   25 IQSIEKYSDSNRHKTMKKRSYISIWTFLLMFGCLFIFYANYKHDINPINND---KSYISRQLLS------YKANCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEA 684
            ++ + + S   R + M  +    +   L +  C    + +  H            ++ +R+L++         NC+  AI  FP DLFS K RQ GA+++H L  +YMF  LAIVC+D+FVP LE ICE L L  DVAGATFMAAGSS PEL  ++IGVFI   D+ +G +VGSA +N++ +IG+  LFA  V++L WW + RD  +Y++S+I+L   IYD  + W+E 
Sbjct:    3 LRGLIRQSKVRRRREMLPQQVGFVCAVLALVCCASGLFGSLGHKTASAGKHVLLDTWRNRKLMAPINGTPLAKNCTDPAIHEFPTDLFSNKERQHGAVLLHILGALYMFYALAIVCDDFFVPSLEKICEKLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVRLTWWAVCRDSVYYTLSVIVLIAFIYDEEIVWWEG 231          
BLAST of slc24a-1 vs. TrEMBL
Match: A0A0H3YFD4 (Slc24a-1 OS=Schmidtea mediterranea OX=79327 GN=slc24a-1 PE=2 SV=1)

HSP 1 Score: 1049.65 bits (2713), Expect = 0.000e+0
Identity = 527/527 (100.00%), Postives = 527/527 (100.00%), Query Frame = 1
Query:   70 MKKRSYISIWTFLLMFGCLFIFYANYKHDINPINNDKSYISRQLLSYKANCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMINSGTESDEDYESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPECI 1650
            MKKRSYISIWTFLLMFGCLFIFYANYKHDINPINNDKSYISRQLLSYKANCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAIVFIFFYGIYIVLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMINSGTESDEDYESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPECI
Sbjct:    1 MKKRSYISIWTFLLMFGCLFIFYANYKHDINPINNDKSYISRQLLSYKANCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAIVFIFFYGIYIVLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMINSGTESDEDYESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPECI 527          
BLAST of slc24a-1 vs. TrEMBL
Match: A0A0R3WB94 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS7895 PE=3 SV=1)

HSP 1 Score: 491.5 bits (1264), Expect = 2.617e-163
Identity = 268/556 (48.20%), Postives = 357/556 (64.21%), Query Frame = 1
Query:  103 FLLMFGCLFIFYANYKHDINPINNDKSYISRQLL------SYKA-NCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNC--TINNENLSDEAFLMSN----------------------------EVAEDLHTTSTGIEMINSGTESDEDYESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKA--RWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKW--FWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPEC 1647
            F  +   L  +    +  I   +  K    R LL       +K  NC+P AI+NFP D F++K R+SG +I H     YMF+ LAIVC++YF+PCLE IC+ L+LQPDVAGATFMAAGSSAPELATT++GV IA+DDI LGAVVGSAD+N+MFV  + ALF+K VI LNWWPL RD  FY +SIILLALVI D  VYWYEA++ + FYG+YI L +FN+ L++        +   C   +++E  S E    S+                            + +E +H  S+   + + GT    D E+     ++N+         D   +T   +CL    A L  P K  +  RW    YY L +P+RF LC++ PD +   +R+W   WI F+ SC WIG+++  M+WMITV+G TLGIPD++MGLTFIAAGSSVPDAI SV+VVREG+GDMA+SNAVGSN+FDIL+CMG+PWL++ + +G P+ IYS+GL YAT+TLF+TV  L+  THL  W++TK +G  L+I Y+ FLVVC +YELN+FG+VHPPEC
Sbjct:   10 FYTLKAVLLQYQQQNRDSIEAQDGQKLPTERHLLLGNPAIPFKGLNCTPLAIENFPRDQFTQKQRRSGLVIFHIFAAAYMFLALAIVCDEYFIPCLEVICDVLRLQPDVAGATFMAAGSSAPELATTLVGVLIARDDIGLGAVVGSADFNVMFVTSVCALFSKEVIYLNWWPLVRDSFFYLVSIILLALVIVDEKVYWYEALILLLFYGLYISLMHFNRRLDVLLNAWCLSHRNICPRVLHDEVSSVEIAAQSSGKFGGKHGETVGLQASETPLANYSRLEADESEAVHHLSSHEVIEDVGTVPRSDPETAIAPTSQNKEELIGGVTGDSDPRTFVQICL----APLAFPPKGTSITRW---IYYILVWPIRFCLCLTTPDSRSPRWRRWQGHWIAFLVSCFWIGVFTIFMMWMITVVGVTLGIPDTIMGLTFIAAGSSVPDAITSVIVVREGEGDMAISNAVGSNIFDILVCMGLPWLVRSMVIGGPVEIYSQGLTYATLTLFVTVLILLGATHLNRWRLTKLYGVGLMITYLLFLVVCSLYELNIFGMVHPPEC 558          
BLAST of slc24a-1 vs. TrEMBL
Match: A0A4E0RSA5 (Sodium:potassium:calcium exchanger OS=Fasciola hepatica OX=6192 GN=D915_005031 PE=3 SV=1)

HSP 1 Score: 488.804 bits (1257), Expect = 5.512e-162
Identity = 255/508 (50.20%), Postives = 336/508 (66.14%), Query Frame = 1
Query:  214 ANCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTTST-------GIEMINSG-------------------TESDEDYESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCY-PLRFFLCVSIPDCKERFFRKWF---WITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPEC 1647
            ANC+P A++NFP+DLF++K RQ GA+++H + ++YMF  LAI+C++YF+PCLE ICE L LQPDVAGATFMAAGSSAPELATT++GVFIAKDDI LGAVVGSAD+N+M V+ ++ALFAK VI LNWWPL RDC FY  SI++LALVI D  +YWYEA+V +  Y +Y++  Y+N   + +      ++   C        +E   M        H TS        G      G                   TE DE  E  +      + G      +   K    +    +CF+ L LP ++  R   +  + +C  P+R  LC+++PD ++  +R+ F   WI F  SC+WIG+++ IM+WMITVIG TL IPD++MGLTFIAAGSSVPDAIAS+LVVREG+GDMAVSNAVGSNVFDIL+CMG+PW +KC+  G P++IYSKGLLYAT+TLF TV  L+ +THL  W++TK +G +L+I YV  L+ C  YELN+F  VHPP C
Sbjct:   79 ANCTPLAMENFPKDLFTQKQRQRGAVVLHIIGSVYMFFALAILCDEYFIPCLERICEVLHLQPDVAGATFMAAGSSAPELATTLVGVFIAKDDIGLGAVVGSADFNIMLVVSVTALFAKQVIYLNWWPLVRDCTFYLFSIVVLALVIVDENIYWYEAMVLLLLYAVYVIFMYYNPRCDAFWNTWCHQHPTCCPRAMHTEQEEIDYMQQHSGAFGHVTSQPQASGFPGAAAPEQGYTRLSVNKVDDPYLNTSGITEFDETDEKLRNNSVILKTGELEVHVVSPVKNDTWS---ETCFSALRLPSREGVRGKIHHAFCICLLPIRLVLCLTVPDVRKAKWRRIFVSHWIAFFMSCVWIGLFTVIMMWMITVIGVTLHIPDTIMGLTFIAAGSSVPDAIASILVVREGEGDMAVSNAVGSNVFDILVCMGLPWFLKCIISGAPVIIYSKGLLYATLTLFSTVLFLLGVTHLNRWRLTKPYGIVLLIGYVVVLIFCSCYELNLFSNVHPPAC 583          
BLAST of slc24a-1 vs. TrEMBL
Match: W6UGM1 (Putative sodium/potassium/calcium exchanger OS=Echinococcus granulosus OX=6210 GN=EGR_04979 PE=3 SV=1)

HSP 1 Score: 487.649 bits (1254), Expect = 1.381e-161
Identity = 262/548 (47.81%), Postives = 356/548 (64.96%), Query Frame = 1
Query:  118 GCLFIFYANYKHDINPINNDKSYISRQLL-------SYKA-NCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLE-------LWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMIN-SGTESDED--------YESGKLIGTRNRNGSCCSSDIDFAKK---TGCAMC-------LRSCFATLELPDKKKA--RWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKW--FWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPEC 1647
              + ++    +  I   ++ K  + R+LL        +K  NC+P AIDNFP D F++K R+SG +I H     YMF+ LAIVC++YF+PCL+ IC+ L+LQPDVAGATFMAAGSSAPELATT++GV IA+DDI LGAVVGSAD+N+MFV  + ALF+K +I LNWWPL RD  FY +SIILLA VI D  VYWYEA++ + FYG YI L +FN+ L+       L  + +  + L +   N E  +  +     +  E +   S+   + N S  E+DE         +E  + +    R+    +    F  K   TG            + C A L  P K  +  RW    YY L +P+RF LC++ PD +   +R+W   WI F+ SC WIG+++  M+WMI V+G TLGIPD++MGLTFIAAGSSVPDAI SV+VVREG+GDMA+SNAVGSN+FDIL+CMG+PWL++ + +G P++IYS+GL YAT+TLF+TV  L+  THL  W++TK +G  L+I Y+ FLV+C +YELN+FG+VHPP C
Sbjct:   29 AVILLYQQEGRDSIEVQDDQKLPVERRLLLMNPTIPPFKGLNCTPLAIDNFPRDQFTQKQRRSGLVIFHIFAAAYMFLALAIVCDEYFIPCLKVICDVLRLQPDVAGATFMAAGSSAPELATTLVGVLIARDDIGLGAVVGSADFNVMFVTSVCALFSKEIIYLNWWPLVRDSTFYLVSIILLASVIVDEKVYWYEALILLLFYGFYISLMHFNRRLDVLLNAWCLSHRNICPRVLHDEVSNVEIAAQSSGKFGGKYGETMGLQSSETPLANYSRLEADESELINHLSSHEVIEDVAAVPRSDPETAIAPTFQSKEQLTGGVTGDSDPRTFAQICLAPLAFPPKGTSMMRW---IYYILAWPIRFCLCLTTPDSRSPRWRRWQGHWIAFLVSCFWIGVFTIFMMWMIAVVGVTLGIPDTIMGLTFIAAGSSVPDAITSVIVVREGEGDMAISNAVGSNIFDILVCMGLPWLVRSMVIGGPVVIYSQGLTYATLTLFVTVLILLGATHLNRWRLTKPYGVGLMITYILFLVICSLYELNIFGMVHPPAC 573          
BLAST of slc24a-1 vs. TrEMBL
Match: A0A5K3EGE3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 484.182 bits (1245), Expect = 4.744e-161
Identity = 252/508 (49.61%), Postives = 342/508 (67.32%), Query Frame = 1
Query:  217 NCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNCT------INNENLSDEAFLMSNEVAED------LHTTSTGIEMINSGTESDEDYESGKLIGTRNRNGSCCSSDI-----------------DFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKW--FWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPEC 1647
            NC+P AIDNFP D F++K R+SG +++H +   YMF+ LAIVC++Y++PCLE IC+ L+LQPDVAGATFMAAGSSAPELATT++GVFIA+DDI LGAVVGS+D+N+MFVI + ALF+K VI LNWWPL RD  FY ISII+LALVI D  VYWYEA+V + FY +YI+L YFN+ L+ +       +   C       +N+  ++ ++       + D      + T  T    + SG++ +++    KL      N +  S  +                    K++      + C A L  P K  +   ++ YY L +P+R  LC++ PDC+   +R+    WI F   C WIG+++  M+WMIT+IG TLGIPD++MGLT +AAGSSVPDAI SV+VVREG+GDMA+SNAVGSN+FDIL+CMG+PWL++C+ +  P++IYS+GL YAT+TLF TV  L+  THL  W++TK +G  L+I Y+ FLVVC +YELNVFG VHPPEC
Sbjct:   12 NCTPLAIDNFPRDQFTQKQRRSGLVVLHVIAAAYMFLALAIVCDEYYIPCLEVICDVLRLQPDVAGATFMAAGSSAPELATTLVGVFIARDDIGLGAVVGSSDFNVMFVISVCALFSKEVIYLNWWPLVRDTTFYLISIIILALVIADENVYWYEAVVLLTFYALYILLMYFNRRLDSFLNAWCLNHRSFCPRVMHDDVNSVEVTAQSTGKFGGKSGDTFDNQGVDTPMTNYTRLQSGSDDNQEAVEAKLPAVALSNQAPNSPPLTNLDTVIAPPAPSNDPESHVKRSDSLTFAQICLAPLSFPPKGTSTL-SWIYYLLAWPIRLCLCLTTPDCRSPKWRRLQGHWIAFFICCFWIGVFTMFMMWMITIIGVTLGIPDTIMGLTLLAAGSSVPDAITSVIVVREGEGDMAISNAVGSNIFDILVCMGLPWLMRCIAISGPVVIYSQGLTYATLTLFFTVLILLGATHLNRWRLTKLYGVGLMITYLLFLVVCSLYELNVFGYVHPPEC 518          
BLAST of slc24a-1 vs. Ensembl Cavefish
Match: slc24a2 (sodium/potassium/calcium exchanger 2 [Source:NCBI gene;Acc:103028516])

HSP 1 Score: 302.368 bits (773), Expect = 3.933e-93
Identity = 190/591 (32.15%), Postives = 316/591 (53.47%), Query Frame = 1
Query:   19 ELIQSIEKYSDSNRHKTMKKRSYISIWTFLLMFGCL--FIFYANYK--------HDINPINNDKSYISRQLLSYKANCSPKAI-------DNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTK-------YLP--NCTINNEN-LSDEAFLMSNEVAEDLHTTST----------GIEMINSGTESDEDYESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFA-------------------TLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLG-KPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNV 1620
            EL  ++       RH   +K     +  F+L F  L   +F++ +K        H  +P+++     +    +  A+  P+A+        ++PEDLF+ + R+ GA+++H    +YMFI LAIVC+++FVP L  I E LK+  DVAGATFMAAG SAPEL T++IGVFI+  ++ +G +VGSA +N++FVIG+ ALF++ ++ L WWPLFRD +FY + +I+L +   DN + + E+I  +  Y  Y++   FN ++E   K L+ +         P  N ++++EN LS +  L     +  LH +             ++ +N G   ++     K+   + ++ +    D +    +   + +                        +L  PD  + R      Y   +P+ F L +++PD +    +K+F  TF+ S  WI  +SY+M+W    +G T+GI + +MGLT +AAG+S+PD I SV+V R+G GDMAVS++VGSN+FDI + +  PWL+  +    KP+ + S GL  A + LF+ +  ++    +  W+M+K  G+ + ++Y  FLVV  M E  V
Sbjct:   13 ELASALPSKKRHLRHHVRRKLRPSRVLGFVLSFCALALLLFWSAFKGTAMSLLGHPDDPLSHRTLRSTDGERNISADV-PRAMASVMENQGDYPEDLFTLEERRQGAVVLHMFGMLYMFIALAIVCDEFFVPALTVITEKLKISDDVAGATFMAAGGSAPELFTSVIGVFISHSNVGIGTIVGSAVFNILFVIGMCALFSREILNLTWWPLFRDVSFYIMDLIMLIVFFLDNYITYVESIALLLAYVSYVLFMKFNANVEGLVKGLMNRNQVDEIEVAPKVNNSVDDENKLSAKPRLQRGGSSASLHNSLMRNSIFQLMIHTLDPLNEGKFKEKASILHKIARKKGQDEANGVVDKNLPNSSNVEVEVTPPMNGNAGQEQAEEEEEGEDQPLSLGWPDTNRKR----LTYLFIFPIVFPLWLTLPDVRREKAKKFFPFTFLGSISWIAAFSYLMVWWAHQVGETIGITEEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPFPWLLYAMFHNFKPVAVSSNGLFCAIVLLFLMLLFVIISIAVCKWRMSKLLGFFMFMLYFVFLVVSVMLEDKV 598          
BLAST of slc24a-1 vs. Ensembl Cavefish
Match: SLC24A2 (solute carrier family 24 member 2 [Source:NCBI gene;Acc:103026719])

HSP 1 Score: 299.286 bits (765), Expect = 2.917e-92
Identity = 177/488 (36.27%), Postives = 279/488 (57.17%), Query Frame = 1
Query:  241 NFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVT------------KYLPNCTINNENLSDEAFLMSNEVAEDL-HTTSTGIE--------MINSGTESDEDYESGKLIGTRN-RNGSCCSSDIDFAKKTGCAMCLRSCFA--------TLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLG-KPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYE 1611
            ++PEDLFS + R+ GA+++H +  +YMFI LAIVC+++FVP L  I E L +  DVAGATFMAAG SAPEL T++IGVFI+  ++ +G +VGSA +N++FVIG+ A+F+K ++ L WWPLFRD +FY + +I+L +   DN + ++E+I  +  Y  Y++   +N  +E++ K L+             K  P       + S    LM N + + + HT     E        +++   +     E    +  +N  N S    ++             +           +L  P+  + R    F Y    P+ F L +++PD ++   +K+F ITF+ +  WI  +SY+M+W    +G T+GI + +MGLT +AAG+S+PD I SV+V R+G GDMAVS++VGSN+FDI + +  PWL+  L  G KPI++ S GL  A + LF+ +  ++       WKM+K  G+I+ ++Y+ FLVV  M E
Sbjct:   91 DYPEDLFSLEQRRRGAVVLHMIGMLYMFIALAIVCDEFFVPALTVITEKLAISDDVAGATFMAAGGSAPELFTSVIGVFISHSNVGIGTIVGSAVFNILFVIGMCAVFSKEILNLTWWPLFRDVSFYILGLIMLIVFFLDNYISYWESIALLTAYACYVIFMKYNGQVEMFIKGLINRNQVVEVVEAPPKAKPRLQRGGSSASLHNSLMRNSIFQLMIHTLDPLSEGKFREKASILHKIAKKKCQVEDANGVADKNLPNSSNVEVEVTPPLNGTAGQEGDTGEEDEEDDQPLSLSWPETCRKR----FTYLFILPIVFPLWITLPDVRKPTSKKFFPITFLGAICWIAAFSYLMVWWAHQVGETIGITEEIMGLTMLAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPFPWLLYSLINGLKPIVVSSNGLFCAIVLLFLMLLFVIISIAACKWKMSKLLGFIMFLLYLVFLVVSVMLE 574          
BLAST of slc24a-1 vs. Ensembl Cavefish
Match: slc24a2 (sodium/potassium/calcium exchanger 2 [Source:NCBI gene;Acc:103028516])

HSP 1 Score: 297.745 bits (761), Expect = 1.700e-91
Identity = 189/585 (32.31%), Postives = 310/585 (52.99%), Query Frame = 1
Query:   49 DSNRHKTMKKRSYISIWTFLLMFGCL--FIFYANYK--------HDINPINNDKSYISRQLLSYKANCSPKAI-------DNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTK--------------YLPNCT----------INNENLSDEAFLMSNEVAEDL-HTTSTGIEMINSGTESDEDYESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFA------------------TLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLG-KPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNV 1620
            D  RH   +K     +  F+L F  L   +F++ +K        H  +P+++     +    +  A+  P+A+        ++PEDLF+ + R+ GA+++H    +YMFI LAIVC+++FVP L  I E LK+  DVAGATFMAAG SAPEL T++IGVFI+  ++ +G +VGSA +N++FVIG+ ALF++ ++ L WWPLFRD +FY + +I+L +   DN + + E+I  +  Y  Y++   FN ++E   K L+ +              Y P  T              + S    LM N + + + HT    ++ +N G   ++     K+   + ++ +    D +    +   + +                       +L  PD  + R      Y   +P+ F L +++PD +    +K+F  TF+ S  WI  +SY+M+W    +G T+GI + +MGLT +AAG+S+PD I SV+V R+G GDMAVS++VGSN+FDI + +  PWL+  +    KP+ + S GL  A + LF+ +  ++    +  W+M+K  G+ + ++Y  FLVV  M E  V
Sbjct:   12 DFTRHHVRRKLRPSRVLGFVLSFCALALLLFWSAFKGTAMSLLGHPDDPLSHRTLRSTDGERNISADV-PRAMASVMENQGDYPEDLFTLEERRQGAVVLHMFGMLYMFIALAIVCDEFFVPALTVITEKLKISDDVAGATFMAAGGSAPELFTSVIGVFISHSNVGIGTIVGSAVFNILFVIGMCALFSREILNLTWWPLFRDVSFYIMDLIMLIVFFLDNYITYVESIALLLAYVSYVLFMKFNANVEGLVKGLMNRNQVDEIEVAPKAMAYRPPATGRTGAKPRLQRGGSSASLHNSLMRNSIFQLMIHT----LDPLNEGKFKEKASILHKIARKKGQDEANGVVDKNLPNSSNVEVEVTPPMNGNAGQEAEEEEEGEDQPLSLGWPDTNRKR----LTYLFIFPIVFPLWLTLPDVRREKAKKFFPFTFLGSISWIAAFSYLMVWWAHQVGETIGITEEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPFPWLLYAMFHNFKPVAVSSNGLFCAIVLLFLMLLFVIISIAVCKWRMSKLLGFFMFMLYFVFLVVSVMLEDKV 587          
BLAST of slc24a-1 vs. Ensembl Cavefish
Match: SLC24A2 (solute carrier family 24 member 2 [Source:NCBI gene;Acc:103026719])

HSP 1 Score: 297.36 bits (760), Expect = 2.546e-91
Identity = 182/510 (35.69%), Postives = 284/510 (55.69%), Query Frame = 1
Query:  241 NFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVT------------KYLPNCTINNENLSDEAFLMSNEVAEDLHTT----STGIEMINSGTESDEDY-ESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKAR-------------------------------W----WNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLG-KPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYE 1611
            ++PEDLFS + R+ GA+++H +  +YMFI LAIVC+++FVP L  I E L +  DVAGATFMAAG SAPEL T++IGVFI+  ++ +G +VGSA +N++FVIG+ A+F+K ++ L WWPLFRD +FY + +I+L +   DN + ++E+I  +  Y  Y++   +N  +E++ K L+             K  P    +   +S +  L     +  LH +    S    MI++     E++ +SGK    R +     +S +    K  C +   +  A   LP+                                    W       F Y    P+ F L +++PD ++   +K+F ITF+ +  WI  +SY+M+W    +G T+GI + +MGLT +AAG+S+PD I SV+V R+G GDMAVS++VGSN+FDI + +  PWL+  L  G KPI++ S GL  A + LF+ +  ++       WKM+K  G+I+ ++Y+ FLVV  M E
Sbjct:   91 DYPEDLFSLEQRRRGAVVLHMIGMLYMFIALAIVCDEFFVPALTVITEKLAISDDVAGATFMAAGGSAPELFTSVIGVFISHSNVGIGTIVGSAVFNILFVIGMCAVFSKEILNLTWWPLFRDVSFYILGLIMLIVFFLDNYISYWESIALLTAYACYVIFMKYNGQVEMFIKGLINRNQVVEVVEAPPKVSPVAVDDESKVSAKPRLQRGGSSASLHNSLMRNSIFQLMIHTLDPLSEEFADSGKF---REK-----ASILHKIAKKKCQVEDANGVADKNLPNSSNVEVEVTPPLNGTAGQEGDTGEEDEEDDQPLSLSWPETCRKRFTYLFILPIVFPLWITLPDVRKPTSKKFFPITFLGAICWIAAFSYLMVWWAHQVGETIGITEEIMGLTMLAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPFPWLLYSLINGLKPIVVSSNGLFCAIVLLFLMLLFVIISIAACKWKMSKLLGFIMFLLYLVFLVVSVMLE 592          
BLAST of slc24a-1 vs. Ensembl Cavefish
Match: slc24a4a (solute carrier family 24 member 4a [Source:ZFIN;Acc:ZDB-GENE-050417-291])

HSP 1 Score: 271.166 bits (692), Expect = 2.191e-82
Identity = 183/521 (35.12%), Postives = 276/521 (52.98%), Query Frame = 1
Query:  283 GALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCA------FYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNCTINNENLSD-----EAF-------LMSNEVAEDLHTTSTGI---EMINSGTESDEDYESG-------------------KLIGTRNRNGSCCSSDIDFA-KKTGCAMCLRSCF---------------ATLELPDKKKARWW--------NYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTL--GKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPEC 1647
            GA+++H     YMF+ LAIVC+DYFV  LE ICE L++  DVAGATFMAAGSSAPEL  +IIGVFI   D+ +G +VGSA +N++ +IG+  +FA  V           C       FY    I  A  IYD  + W+E+++ +  Y  YIV+  FN S++ +      K + N       L D     E F       L+S+     ++T  + +   EM+NS   +    E+G                   +LI    +     S+ +D A    G A  L +                 +   LP +++   +        N   +   +P+   L  ++P+C +  + ++F ++F  S +WI ++SY M+WM+T+IG+TLGIPD +MG+TF+AAG+SVPD IAS++V R+G GDMAVSN +GSNVFDIL+ +GVPW I+ + +  G  ++I S+GL+Y+ + L  +V   V   H+  WK+    G  ++I+Y  FL    + E NVF  V+ P C
Sbjct:    2 GAVLLHIFAATYMFLALAIVCDDYFVTSLEKICEKLQMSEDVAGATFMAAGSSAPELFASIIGVFITHGDVGVGTIVGSAVFNILCIIGVCGIFAGQV-----------CVCVCMHQFYYYDDIRTAF-IYDGRIVWWESLILMVMYIGYIVIMKFNTSMQNYFSGKDDKGVANGNAVISELEDGNACYEQFWDDPTWPLLSSVKPTKMYTRGSVVMVDEMMNSSPPNYRFPEAGLRVMITNHFGPKTRLRMASRLIINEQQRLMQASNGVDGALVSDGKADTLENGIMAEDKLTEDEDNELSSPFSLPGEERVEGFTRASGGVMNILKFIFSWPILVLLYFTVPNCAKPRWERFFMLSFFLSTLWIAVFSYFMVWMVTIIGYTLGIPDVIMGITFLAAGTSVPDCIASLIVARQGLGDMAVSNTIGSNVFDILVGLGVPWGIQTMAVNYGSVVVINSRGLVYSVVLLLGSVALTVLGIHVNKWKLDFKLGMYVLILYGVFLCFSILIEYNVFTFVNLPMC 510          
BLAST of slc24a-1 vs. Ensembl Sea Lamprey
Match: slc24a4b (solute carrier family 24 member 4b [Source:ZFIN;Acc:ZDB-GENE-081031-75])

HSP 1 Score: 186.422 bits (472), Expect = 1.734e-51
Identity = 92/212 (43.40%), Postives = 138/212 (65.09%), Query Frame = 1
Query: 1024 ATLELPDK--KKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTL--GKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPEC 1647
            A+L +PD    K +W         +PL   L  ++P+C +  +  WF  +F+ S IWI ++SY+M+WM+TVIG+TLGIPD +MG+TF+AAG+SVPD +AS++V R+G GDMAVSN++GSNVFDIL+ +G+PW ++ L +  G  + I S+GL+Y+ + L  +V   V   +L +WK+ +  G   + +Y  FL    M E NVF  V+ P C
Sbjct:  339 ASLRIPDGVCNKLKWM------FAWPLGLLLYFTVPNCAKARWENWFMASFVISTIWIAVFSYVMVWMVTVIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNVFDILVGLGLPWALQTLLVDYGSHVEINSRGLIYSVVLLLASVGITVLGIYLNNWKLDRKLGLACLFVYAVFLCFSIMIEFNVFTFVNLPMC 544          

HSP 2 Score: 177.178 bits (448), Expect = 3.355e-48
Identity = 84/159 (52.83%), Postives = 115/159 (72.33%), Query Frame = 1
Query:  220 CSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTII----GVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEA 684
            C   AI+ FP+D+F+ + R+ G L++H   T+YMF  LA+VC+D+FVP LE I E L+L  DVAGATFMAAGSSAPEL T++I    GVF+ K D+ +G +VGSA +N++ +IG+  LFA  +++L WW LFRD  FY+ISII L L I D +V W+E+
Sbjct:    1 CVVAAINEFPKDIFTNEERKHGGLLLHVFCTMYMFYALALVCDDFFVPSLEKISERLQLSEDVAGATFMAAGSSAPELFTSVIVWCEGVFVTKGDVGVGTIVGSAVFNILCIIGVCGLFAGQIVRLTWWSLFRDSVFYTISIIALILFICDEIVSWWES 159          
BLAST of slc24a-1 vs. Ensembl Sea Lamprey
Match: slc24a1 (solute carrier family 24 member 1 [Source:ZFIN;Acc:ZDB-GENE-060503-191])

HSP 1 Score: 176.407 bits (446), Expect = 7.906e-48
Identity = 84/181 (46.41%), Postives = 128/181 (70.72%), Query Frame = 1
Query:  241 NFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLP 783
            ++P DLF+ + R+ GA+++H L  IYMFI LAIVC+++FVP L  I E L +  DVAGATFMAAG SAPEL T++IGVFI+  ++ +G +VGSA +N++FVIG+ A+F++ ++ L WWPLFRD +FY + + +L +   DNL+ W+E+++ +  Y  Y+V   FN  +E + K  ++   P
Sbjct:   18 DYPRDLFTLEQRKRGAVVLHMLGMIYMFIALAIVCDEFFVPALGVITEKLAISDDVAGATFMAAGGSAPELFTSLIGVFISHSNVGIGTIVGSAVFNILFVIGMCAVFSREILVLTWWPLFRDVSFYIVGLSMLIIFFLDNLIQWWESMLLLSCYVSYVVFMKFNAKVESFVKQRLSMDPP 198          

HSP 2 Score: 137.502 bits (345), Expect = 1.622e-34
Identity = 68/167 (40.72%), Postives = 108/167 (64.67%), Query Frame = 1
Query: 1114 VSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLG-KPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYE 1611
            +++PD +    RK+F +TF  S +WI ++SY+M+W    +G T+GI + +MGLT +AAG+S+PD I SV+V R+G GDMAVS++VGSN+FDI + + +PWL+  L  G  P+ + S GL  A + LF+ +  ++       W M K  G+ + ++Y  FL++  M E
Sbjct:  378 ITLPDVRNHRSRKFFMVTFFGSILWIAIFSYLMVWWAHQVGETIGITEEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPMPWLMFSLVKGFAPVQVSSNGLFCAIVLLFLMLLFVILTIAACRWHMNKLLGFCMFLLYFVFLIISVMLE 544          
BLAST of slc24a-1 vs. Ensembl Sea Lamprey
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 65.0846 bits (157), Expect = 1.907e-11
Identity = 43/156 (27.56%), Postives = 80/156 (51.28%), Query Frame = 1
Query: 1162 ITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLT--LGKPILIYSKGLLYATITLFMTVFGLVFIT-HLYSWKMTKSFGYILIIIYVAFLVVCCMYELNV 1620
            + F+ S +W+   +  ++ ++   G   GI  +V+GLT +A G+SVPD +A + + R+G   MA+S   G  VF+IL+ +G+  L+      + +  L+    L++           L F+   L  + +T+ +G  L  +Y+AFL V  + E  +
Sbjct:  205 LGFVVSALWMNAIANEVVNLLQTFGVVFGISSTVLGLTLLAWGNSVPDFVADITMARQGYPRMAISACFGGIVFNILVGIGLGCLLSMPPSHMQQAQLVPDVPLVWVLCASLGISLVLSFVALPLQGFYLTRKYGVCLFALYLAFLTVALLTEFKI 360          
BLAST of slc24a-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006683.1 (pep scaffold:Pmarinus_7.0:GL476710:281470:285756:-1 gene:ENSPMAG00000006040.1 transcript:ENSPMAT00000006683.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.8474 bits (146), Expect = 2.579e-10
Identity = 44/137 (32.12%), Postives = 71/137 (51.82%), Query Frame = 1
Query: 1159 WITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIAS-VLVVREGQGDMAVSNAVGSNVFDILICMGVPWLI---KCLTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFG 1557
            W  F+ S   IG+ + ++  + +  G T+G+ DSV  + F+A G+S+PD  AS V  V++   D +V N  GSN  ++ + +G+ W I    C    K   +   G L  ++TLF TVF  + +  L  W+   S G
Sbjct:  123 WACFLVSISVIGLLTAMIGDLASHFGCTVGLKDSVTAVVFVALGTSIPDTFASKVAAVQDQFADASVGNVTGSNAVNVFLGIGIAWTIASVHCWANNKKFYV-DPGTLAFSVTLF-TVFAFICVGVLM-WRRRPSVG 256          
BLAST of slc24a-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000794.1 (pep scaffold:Pmarinus_7.0:GL477892:73629:76552:-1 gene:ENSPMAG00000000728.1 transcript:ENSPMAT00000000794.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 1.334e-6
Identity = 35/108 (32.41%), Postives = 54/108 (50.00%), Query Frame = 1
Query:  292 IIHFLITIYMFIGLAIVCEDYFVPCLECICENLK----LQPD--------------VAGATFMAAGSSAPELATTII---GVFIAKDDIALGAVVGSADYNLMFVIGL 552
            I++F+  IYMF+G++I+  D F+  +E I    K     +PD              V+  T MA GSSAPE+  +II   G      D+    +VGSA +N+  +I +
Sbjct:   82 IVYFVALIYMFLGVSIIA-DRFMASIEVITSQEKEITIKRPDGETTTTTVRVWNETVSNLTLMALGSSAPEILLSIIEICGHGFEAGDLGPSTIVGSAAFNMFVIIAI 188          
BLAST of slc24a-1 vs. Ensembl Nematostella
Match: EDO32048 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW69])

HSP 1 Score: 348.977 bits (894), Expect = 8.128e-113
Identity = 199/498 (39.96%), Postives = 290/498 (58.23%), Query Frame = 1
Query:  217 NCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELW------------------AKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMINSGTESDEDYESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLT--LGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPECI 1650
            NC+P AI  FP+D F+++ RQ GA++++F+I++YMF  +AIVC+DYFVPCLE IC+ L LQ DVAGATFMA GSSAPEL  ++IGVFI K DI +G ++GSA +N++FVIG+  + A TV+ L WWP+ RD  FY  S++ L LV+ DN+V W EA   + FY +Y+++ YFN  +E +                   K   TKY P    +NE    EA ++ N    D  T    +  I     + E  +S  ++G     G   +   ++ +     +       TL  P       W    + L  P+     ++IPD K+    KW  ++FI   +WIG+ SY+++WM+TVIG+T  IPDSVMGL+ +A GSSVPD ++S+ V R+G GDMAVS+ VGSNVFDIL+C+G+PWLIK         ++I S GL  +   +  ++   + I   Y W + K  G I ++ Y  F+ +  + E+N FG  +PP C+
Sbjct:    1 NCTPPAILEFPDDFFTQRQRQRGAVVLNFIISLYMFWAVAIVCDDYFVPCLEIICDRLGLQTDVAGATFMALGSSAPELFASVIGVFITKGDIGVGTILGSAVFNVLFVIGVCGVGAGTVLYLAWWPMVRDSVFYLFSLVGLMLVLMDNVVVWSEATAMVSFYSVYLLIMYFNPRIEAYLYRVTKTTTPEYKSDLHEQKATKTKYDPVQQTDNEV---EAEILDNVNGSDDTTKKGLLGRIYELYFNKEKVKSPLIVGF----GEHLAHHHEYEQHVPHDVPD----LTLGSPFSPPENVWPRICWVLGLPINLSFFLTIPDVKKPSCEKWVVLSFIICIVWIGVTSYVLVWMVTVIGYTFLIPDSVMGLSLVAFGSSVPDCLSSLFVARKGDGDMAVSHTVGSNVFDILLCLGIPWLIKTTVWEYDSSVVINSHGLFISCFFILGSIAVTLIIIWYYKWTLNKKVGCIYLVFYFIFMSISVVVEMNAFGNFNPPMCV 487          
BLAST of slc24a-1 vs. Ensembl Nematostella
Match: EDO35212 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM57])

HSP 1 Score: 223.402 bits (568), Expect = 8.666e-65
Identity = 157/449 (34.97%), Postives = 230/449 (51.22%), Query Frame = 1
Query:  289 LIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSL-----ELWAKMLVTKYL-------------PNCT---------------INNENLSDEAFLMSNE-----VAEDLHTTSTGIEMINSGTESD----------------EDYESGKLIGTRNRNGSCCSSDIDFAK-KTGCAMCLRSCFA-----TLELPDKKKARWWNYFY------YGLCYPLRFFLCV---SIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCL 1428
            L+++    + +FI LAIVC+D+FVP LE I E L L  DVAGATFMAAGSSAPEL T+I GV +   D+ +G +VGSA +NL+ +I L+A F+  V+QL+W PL RD   YS+SI    +  +D     YEA V +  Y  YIV+  FN  L     E+  +   T+               P  T               IN E+  DEA   +N+     + +  H  +   E  + G  S                  D E     G+R ++G     D  + + + G  M +  C       T E P +++  W +  Y      + L +P   F+C+   +IPDC +   RKWF  +F  S +WI + S+ ++ ++   G  L +    MGL  IA G+SVPDA++S++V R+G GDMAVSNA+GSNVFDI + +G+P++I+ L
Sbjct:    3 LVLYIFAILVIFIALAIVCDDFFVPSLEAISEKLDLSEDVAGATFMAAGSSAPELFTSIAGVTV-DSDVGVGTIVGSAIFNLLVIIALTAAFSGQVLQLDWRPLLRDSVAYSLSIAFFIIFSWDGKFEMYEAAVLLILYIAYIVVMKFNPKLMDLLAEVGPQGQPTEVTNLGVSDADSLVNEPAVTVLQGQHGTPAGKLPPINQESSQDEATSPTNQKRSSSIHDASHHNTRHFEHAHKGMMSRSFVSNCCINPFIIINARDSEQPPGDGSRPQSGVGSKDDGGYKEDEVGSTMKVCPCLPPVSIETPEYPTEERTCWSSTKYVMGWVLFVLSFP---FVCLYTWTIPDCSKPHNRKWFLASFTMSIVWIAILSFGLVTVVGRSGCILNVDKFTMGLVIIAIGTSVPDALSSIIVARDGFGDMAVSNAIGSNVFDINLGLGLPFVIRIL 447          
BLAST of slc24a-1 vs. Ensembl Nematostella
Match: EDO48300 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJP5])

HSP 1 Score: 159.073 bits (401), Expect = 7.995e-45
Identity = 88/187 (47.06%), Postives = 132/187 (70.59%), Query Frame = 1
Query: 1093 PLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTL--GKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPEC 1647
            P+     ++IPDC+   +RKW+++TF+ S +WI   SYI++WM+ +IG+TL IPD VMGLTF+AAGSSVPD I+S++V R G GDMAVSN +GSNVFDIL+C+G+PWL+K   +  G  + + S  ++Y +I+LF TV   + +  L  W++ +  G + +I+Y+AF+ V  ++ELNV G  + P C
Sbjct:   23 PISCLFFITIPDCRRPRWRKWYFLTFLISVLWIAGLSYILVWMVEIIGYTLEIPDVVMGLTFVAAGSSVPDGISSLIVARHGDGDMAVSNTIGSNVFDILLCLGLPWLLKTTAVEHGGVVTVLSGSIIYTSISLFGTVVVTILLVVLNRWRLNRLLGCVFMILYIAFISVATLFELNVIGDFNLPIC 209          
BLAST of slc24a-1 vs. Ensembl Nematostella
Match: EDO41421 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4I7])

HSP 1 Score: 167.933 bits (424), Expect = 3.930e-44
Identity = 82/169 (48.52%), Postives = 120/169 (71.01%), Query Frame = 1
Query:  184 YISRQLLSYKANCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFI-AKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSIS-IILLALVIYDNLVYWYEA 684
            Y  R LL+     S ++ + +PED F+ + +Q GA+I H +   YMF+ LAI C+++FVP L  I E L+L+ DVAGATFMAAG SAPEL T+ IG FI  K ++ +G +VGSA +N++FVIG+ A+F+K V++L WWPLFRDC FYS++ IIL+   +  +++ W+E+
Sbjct:   74 YHHRTLLNASDTTSERSAE-YPEDEFTLEQKQQGAVICHIIGMCYMFLALAIACDEFFVPSLTVIIEKLELKEDVAGATFMAAGGSAPELFTSFIGTFIDPKSNVGIGTIVGSAVFNVLFVIGMCAMFSKGVLELTWWPLFRDCIFYSLALIILIIFFLSGDVIVWWES 241          

HSP 2 Score: 145.206 bits (365), Expect = 1.799e-36
Identity = 76/187 (40.64%), Postives = 113/187 (60.43%), Query Frame = 1
Query: 1030 LELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWL-IKCLTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAF 1587
            L  P+  + R     +Y +  PL F +  ++ D +    R  + ITF+ S  WI  +SY M+W  T +G+T  IP  VMGLTF+AAG+SVPD I SVLV R+G GDMAVS+++GSN+FDI + + +PWL    + LG  + + S+G+LY+ I LF  +  +V       W+M+KS G  + + Y+ F
Sbjct:  449 LSWPESGRDR----VFYVIKAPLMFLMYYTMVDVRRPERRHLYPITFLMSIFWIAFFSYFMVWWATEVGYTFDIPTEVMGLTFLAAGTSVPDLITSVLVARKGFGDMAVSSSIGSNLFDITVGLPLPWLCYSAVNLGLAVNVSSRGILYSVIMLFCMLIAVVVSIAASRWRMSKSLGACMFVFYIIF 631          
BLAST of slc24a-1 vs. Ensembl Nematostella
Match: EDO48007 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKL4])

HSP 1 Score: 157.147 bits (396), Expect = 9.133e-42
Identity = 75/168 (44.64%), Postives = 116/168 (69.05%), Query Frame = 1
Query: 1114 VSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKC--LTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYE 1611
            V+IPDC+++ +RK++ +TF  + IW+ + SY ++WM+ +IG+T  IP+ VMG+TF+AAGSS+PDAIAS++V ++G GDMAVSN +GSNVFD+L C+G+PWLIK   L  GKP++I S+ + + +  L  ++     +     WK+    G   +I+Y  FL+V    E
Sbjct:  252 VTIPDCRKKTWRKFYLVTFTVAVIWMAVLSYFLVWMVAIIGYTYTIPECVMGMTFLAAGSSLPDAIASLVVAKQGSGDMAVSNCIGSNVFDML-CLGIPWLIKSAFLQPGKPVVIQSENIFFTSAMLIGSIAVTFLLIQFNKWKLNVKVGIAFLIMYFLFLIVATYIE 418          

HSP 2 Score: 151.754 bits (382), Expect = 6.003e-40
Identity = 80/176 (45.45%), Postives = 114/176 (64.77%), Query Frame = 1
Query:  220 CSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLE 747
            C P  I+ FP D+ ++  R  G +++H + ++++F  L +VCED+FV  L  I   L L+PDVAGATFMA GSSAP L   II +F  + DI LG +VGS  +N +F+I L A+ +   +QL  +P+ RD   Y  S+I+L + IYDN VYWYE ++F+  Y IYIV+ YFN  +E
Sbjct:    1 CRPPNIEEFPPDVLTQDQRFYGGVMLHVIFSLHLFCALTVVCEDFFVASLNRISMCLGLKPDVAGATFMAVGSSAPTLFIAIISIFFTEGDIGLGTIVGSTIFNTLFIIALCAIGSGVTLQLACYPISRDSTVYVASVIVLMVSIYDNKVYWYEGLIFVIVYAIYIVIMYFNDQVE 176          
BLAST of slc24a-1 vs. Ensembl Medaka
Match: slc24a5 (solute carrier family 24 member 5 [Source:NCBI gene;Acc:101173921])

HSP 1 Score: 333.954 bits (855), Expect = 2.540e-106
Identity = 193/485 (39.79%), Postives = 286/485 (58.97%), Query Frame = 1
Query:  193 RQLLSYKANC-SPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVA----EDLHTTSTGIEMINSGTESDEDYESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLG--KPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFG 1626
            R+ L  +  C SP+A   FP+  F+ + R+ G L+I+F+I  YM + +AIVC+DYF+P LE I E L L  DVAGATFMAAGSSAPEL T  +GVF+ K DI +  +VGSA YNL+ +     + A    +L  WPLFRDC  Y IS+  +  +I DN VYWYEA   +  YG+YIV+  F+  +   ++ ++ K  P CT  +   +D+   M  +      +D      G    +SG   D+   S   +     N      +I  A++       +S F+  E  D K+  W       L  P+   L +++PDC+ RF+++WF ITF  S +WI  ++Y+++WM+TV+G TLGIPD+VMGLT +AAG+S+PD +ASV+V REG+ DMA+SN VGSNVFD+L C+G+PW IK + +    P+ + S GL++ + TL +++  L    H+  WK+    G + +I Y+ F  +  +YEL + G
Sbjct:   49 RRALENETECISPQA-SEFPDGFFTVQERKDGGLVIYFMIIFYMLLAVAIVCDDYFLPSLEVISERLGLSQDVAGATFMAAGSSAPELVTAFLGVFVTKGDIGVSTIVGSAVYNLLGICAACGILASVARRLTCWPLFRDCLAYGISVAAVIGIISDNKVYWYEAACLLLVYGVYIVVLCFDLRI---SEFVLRKLSPCCTCLSSGSADK---METQPLTGWNDDTRLRICGRSRTDSGIFHDDSGYSHLSLSLHGLN------EISDAEQ-------KSVFSVPE-SDLKRILWV------LSLPVIVLLFLTVPDCRRRFWKQWFMITFFMSAVWISAFTYVLVWMVTVVGETLGIPDTVMGLTLLAAGTSIPDTVASVMVAREGKADMAMSNIVGSNVFDML-CLGLPWFIKTVFVDTINPVEVNSSGLVFVSCTLLLSIVFLFVAVHINGWKLDWKLGLVSLICYILFATLSILYELGIIG 505          
BLAST of slc24a-1 vs. Ensembl Medaka
Match: slc24a5 (solute carrier family 24 member 5 [Source:NCBI gene;Acc:101173921])

HSP 1 Score: 330.487 bits (846), Expect = 1.595e-105
Identity = 190/474 (40.08%), Postives = 281/474 (59.28%), Query Frame = 1
Query:  223 SPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVA----EDLHTTSTGIEMINSGTESDEDYESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLG--KPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFG 1626
            SP+A   FP+  F+ + R+ G L+I+F+I  YM + +AIVC+DYF+P LE I E L L  DVAGATFMAAGSSAPEL T  +GVF+ K DI +  +VGSA YNL+ +     + A    +L  WPLFRDC  Y IS+  +  +I DN VYWYEA   +  YG+YIV+  F+  +   ++ ++ K  P CT  +   +D+   M  +      +D      G    +SG   D+   S   +     N      +I  A++       +S F+  E  D K+  W       L  P+   L +++PDC+ RF+++WF ITF  S +WI  ++Y+++WM+TV+G TLGIPD+VMGLT +AAG+S+PD +ASV+V REG+ DMA+SN VGSNVFD+L C+G+PW IK + +    P+ + S GL++ + TL +++  L    H+  WK+    G + +I Y+ F  +  +YEL + G
Sbjct:   17 SPQA-SEFPDGFFTVQERKDGGLVIYFMIIFYMLLAVAIVCDDYFLPSLEVISERLGLSQDVAGATFMAAGSSAPELVTAFLGVFVTKGDIGVSTIVGSAVYNLLGICAACGILASVARRLTCWPLFRDCLAYGISVAAVIGIISDNKVYWYEAACLLLVYGVYIVVLCFDLRI---SEFVLRKLSPCCTCLSSGSADK---METQPLTGWNDDTRLRICGRSRTDSGIFHDDSGYSHLSLSLHGLN------EISDAEQ-------KSVFSVPE-SDLKRILWV------LSLPVIVLLFLTVPDCRRRFWKQWFMITFFMSAVWISAFTYVLVWMVTVVGETLGIPDTVMGLTLLAAGTSIPDTVASVMVAREGKADMAMSNIVGSNVFDML-CLGLPWFIKTVFVDTINPVEVNSSGLVFVSCTLLLSIVFLFVAVHINGWKLDWKLGLVSLICYILFATLSILYELGIIG 462          
BLAST of slc24a-1 vs. Ensembl Medaka
Match: ENSORLT00000009286.2 (sodium/potassium/calcium exchanger 3 [Source:NCBI gene;Acc:101155536])

HSP 1 Score: 323.168 bits (827), Expect = 4.708e-101
Identity = 204/561 (36.36%), Postives = 315/561 (56.15%), Query Frame = 1
Query:  166 INNDKSYISRQLLSYKANCS----PKA-IDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLV-TKYL----------------PNCT-----INNENLSDEAFL---MSNEV----AEDLHTTSTGIEMINS-------------------------GTESDEDYESG---KLIGTRN---RNGSCC---------SSDIDFAKKTGCAMCLRS----CFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTL--GKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMY 1608
            IN+     +R+L+  K++      P+A I  FP+D+F+++ R++GA+++H L  IYMF  LAIVC+DYFVP LE I ENL+L  DVAGATFMAAGSSAPEL T++IGVFI K D+ +G +VGSA +N++ +IGL  +FA   + L WW LFRD  +Y ++++ L LVIYD+ V W+E+++ I  YGIYI++  FN  + ++   L  +++L                P C      +N E    +  L   M +E+       L  +  G+ ++ +                         G++   D E+G   +   T N   R GSC            D +  +K G            F  + +P    AR      + + +PL   L  ++P+C    + +WF +TF+ S +WI ++SY M+WM+T+I +TL IPD +MG+TF+AAG+SVPD +AS++V R+G GDMAVSN++GSN+FDIL+ +G PW ++ L +  G  + I +KGL+Y+ I L  +VF  V   HL  W++ +  G  L+ +Y  FL+   ++
Sbjct:   45 INDGLLRWTRRLMQEKSDNQSLDEPRAAIHEFPQDIFTREQRKNGAVLLHALCAIYMFYALAIVCDDYFVPSLEKISENLQLSEDVAGATFMAAGSSAPELFTSLIGVFITKGDVGVGTIVGSAVFNILVIIGLCGIFAGQTVVLTWWSLFRDATYYILAVLALILVIYDDTVLWWESLLLITMYGIYIIIMKFNSPISVFVTHLFQSRWLCCSKSEEQHDSKMVEDPACNTSMVLLNKEQSHGQEPLPVIMVDELLIINPHKLSFSEAGLRIMITPHFSPRTRLSMAGRMLISERQRLIRGSKHQRDGEAGHASRGESTSNSLKRTGSCSLENGGGRPRMQDTESVEKPGVEEEGEEDEDGIFNPVRIPGSCGAR----VKWVITWPLSLLLYCTVPNCVLPRWHRWFMVTFVASTMWIAVFSYQMVWMVTIISYTLDIPDYIMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNIFDILLGLGFPWALRTLVVDHGSTVSINNKGLVYSVILLLASVFLTVISVHLNHWRLDRRLGLGLLFLYAIFLLCSILF 601          
BLAST of slc24a-1 vs. Ensembl Medaka
Match: SLC24A2 (solute carrier family 24 member 2 [Source:NCBI gene;Acc:101167489])

HSP 1 Score: 295.049 bits (754), Expect = 3.867e-90
Identity = 178/509 (34.97%), Postives = 273/509 (53.63%), Query Frame = 1
Query:  241 NFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKM-----------LVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTT-------STGIEMINSGTESD------------------EDYESGKLIGTRNRNGSCCSSDIDF---AKKTGCAMCLRSCFA---------TLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLG-KPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNV 1620
             +P DLF+   R+ GA+++H    IYMFI LAIVC+++FVP L  I E L +  DVAGATFMAAG SAPEL T+IIGVFI+  ++ +G +VGSA +N++FVIG+ A+F+K ++ L WWPLFRD +FY + +I+L +   DN++  +E++  +  Y  Y++   FN  +E + K            +  K  P    ++  LS    L     +  LH +          I  ++  +E                    ED E    + +R       SS ++        G A                 +L  P+  + R    F Y L  P+   L +++PD ++   +K+F +TF+ S  WI ++SY+M+W    +G T+GI + +MGLT +AAG+S+PD I SV+V R+G GDMAVS++VGSN+FDI + +  PWL      G KP+ + S GL  A + LF+ +  ++       W+M+K  G+I+ ++Y  FLVV  M E  V
Sbjct:  114 EYPPDLFTLSERRQGAVVLHMFGMIYMFIALAIVCDEFFVPALTVITEKLNISDDVAGATFMAAGGSAPELFTSIIGVFISHSNVGIGTIVGSAVFNILFVIGMCAIFSKEILNLTWWPLFRDVSFYILDLIMLIIFFLDNIILVWESVTLLSAYAAYVIFMKFNSKMEGFVKSCMHRNQVVEVEVQPKASPGAPEDDGKLSARPRLQRGGSSASLHNSLMRNSIFQLMIHTLDPLSEGKFREKASILHKIAKKKCQVEDSEKANGVSSRADKNLPNSSSVEEEVPPPMNGTAGQEGEAAEDEEEEDQPLSLSWPESNRKR----FTYLLIMPIVLPLWITLPDVRKTSSKKFFPVTFLGSITWIAVFSYLMVWWAHQVGETIGITEEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPFPWLFWSFFNGLKPVQVSSNGLFCAIVLLFLMLLFVIISIAACKWRMSKLLGFIMFMLYFVFLVVSVMLEDRV 618          
BLAST of slc24a-1 vs. Ensembl Medaka
Match: SLC24A2 (solute carrier family 24 member 2 [Source:NCBI gene;Acc:101167489])

HSP 1 Score: 294.664 bits (753), Expect = 5.681e-90
Identity = 178/514 (34.63%), Postives = 277/514 (53.89%), Query Frame = 1
Query:  241 NFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKM-----------LVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTT----STGIEMINSGTESDEDY-ESGK-----------------LIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFA--------------------TLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLG-KPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNV 1620
             +P DLF+   R+ GA+++H    IYMFI LAIVC+++FVP L  I E L +  DVAGATFMAAG SAPEL T+IIGVFI+  ++ +G +VGSA +N++FVIG+ A+F+K ++ L WWPLFRD +FY + +I+L +   DN++  +E++  +  Y  Y++   FN  +E + K            +  K  P    ++  LS    L     +  LH +    S    MI++     E++ +SGK                 +  +   NG    +D +    +     +                         +L  P+  + R    F Y L  P+   L +++PD ++   +K+F +TF+ S  WI ++SY+M+W    +G T+GI + +MGLT +AAG+S+PD I SV+V R+G GDMAVS++VGSN+FDI + +  PWL      G KP+ + S GL  A + LF+ +  ++       W+M+K  G+I+ ++Y  FLVV  M E  V
Sbjct:  114 EYPPDLFTLSERRQGAVVLHMFGMIYMFIALAIVCDEFFVPALTVITEKLNISDDVAGATFMAAGGSAPELFTSIIGVFISHSNVGIGTIVGSAVFNILFVIGMCAIFSKEILNLTWWPLFRDVSFYILDLIMLIIFFLDNIILVWESVTLLSAYAAYVIFMKFNSKMEGFVKSCMHRNQVVEVEVQPKASPGAPEDDGKLSARPRLQRGGSSASLHNSLMRNSIFQLMIHTLDPLSEEFADSGKFREKASILHKIAKKKCQVEDSEKANGVSSRADKNLPNSSSVEEEVPPPMNGTAGQEGEAAEDEEEEDQPLSLSWPESNRKR----FTYLLIMPIVLPLWITLPDVRKTSSKKFFPVTFLGSITWIAVFSYLMVWWAHQVGETIGITEEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPFPWLFWSFFNGLKPVQVSSNGLFCAIVLLFLMLLFVIISIAACKWRMSKLLGFIMFMLYFVFLVVSVMLEDRV 623          
BLAST of slc24a-1 vs. Planmine SMEST
Match: SMESG000010390.1 (SMESG000010390.1)

HSP 1 Score: 1018.84 bits (2633), Expect = 0.000e+0
Identity = 511/513 (99.61%), Postives = 513/513 (100.00%), Query Frame = 1
Query:  112 MFGCLFIFYANYKHDINPINNDKSYISRQLLSYKANCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMINSGTESDEDYESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPECI 1650
            MFGCLFIFYANYKHDINPINNDKSYISRQLLSYKANCSPKAIDNFPEDLFSK+ARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAIVFIFFYGIYIVLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMINSGTESDEDYESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDC+ERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPECI
Sbjct:    1 MFGCLFIFYANYKHDINPINNDKSYISRQLLSYKANCSPKAIDNFPEDLFSKEARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAIVFIFFYGIYIVLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMINSGTESDEDYESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCRERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPECI 513          
BLAST of slc24a-1 vs. Planmine SMEST
Match: SMESG000010390.1 (SMESG000010390.1)

HSP 1 Score: 989.949 bits (2558), Expect = 0.000e+0
Identity = 501/513 (97.66%), Postives = 503/513 (98.05%), Query Frame = 1
Query:  112 MFGCLFIFYANYKHDINPINNDKSYISRQLLSYKANCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMINSGTESDEDYESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPECI 1650
            MFGCLFIFYANYKHDINPINNDKSYISRQLLSYKANCSPKAIDNFPEDLFSK+ARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAIVFIFFYGIYIVLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMINSGTES          GTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDC+ERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPECI
Sbjct:    1 MFGCLFIFYANYKHDINPINNDKSYISRQLLSYKANCSPKAIDNFPEDLFSKEARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAIVFIFFYGIYIVLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMINSGTES----------GTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCRERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCLTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPECI 503          
BLAST of slc24a-1 vs. Planmine SMEST
Match: SMESG000030115.1 (SMESG000030115.1)

HSP 1 Score: 341.273 bits (874), Expect = 1.340e-109
Identity = 201/508 (39.57%), Postives = 303/508 (59.65%), Query Frame = 1
Query:  133 FYANYKHDINPINNDKSYISRQLLSYKANCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMINSGTESDEDYESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDC-KERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKC--LTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPEC 1647
            F+  +K + + ++      SR+LL  K NC+ ++I+ FP D  ++K R++G +I H  +++Y+F+ LAI+C++YFV  LE +CE   ++ DVAGATFMAAGSSAPEL T++IGVFI K D+ +  +VGSA +N++ +I +  +F  +VI LNWWP+FRDC  Y +SII L +++ D L+ WYEA+V +F Y  YI++ Y+N +L       V + LP      E          N +      TS G+      +E +E  E+G +    +R       D D     G +  +       E+P+    R     Y+    P+      +IPDC K   +RK F +TF  S IWI + +YI++WMI +IG TL IPD++MGLTF+AAG+S+PDAIA  LV ++G GDMA+SN++GSNVFDILIC+G+PW I+   L  G  I + S  L++ TITL  TV  LV    +  WK+ +  G+I + +Y+  + +  ++ELN+ G  + P C
Sbjct:    3 FFTKFKSNSDTMSELHG-TSRKLLGLK-NCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSMYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCIIYCLSIIALIIILNDGLIQWYEALVMLFMYVAYIIILYYNGNL----YGFVIQRLPRLKGYGEE--------HNPLISQNLPTSFGLL---DSSEEEEIMETGDVDSIHSR----IRLDEDMTNLEGESPTI------FEVPNSFCHR----LYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVESSSLIFTTITLLSTVVVLVATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPC 479          
BLAST of slc24a-1 vs. Planmine SMEST
Match: SMESG000030115.1 (SMESG000030115.1)

HSP 1 Score: 316.62 bits (810), Expect = 1.961e-100
Identity = 195/487 (40.04%), Postives = 290/487 (59.55%), Query Frame = 1
Query:   70 MKKRSYISIWTFLLMFGCLFI---FYANYKHDINPINNDKSYISRQLLSYKANCSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMINSGTESDEDYESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDC-KERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKC--LTLGKPILIYSKGLLYATITLFMTVFGLV 1512
            M K+++ + +  L  +  L I   F+  +K + + ++      SR+LL  K NC+ ++I+ FP D  ++K R++G +I H  +++Y+F+ LAI+C++YFV  LE +CE   ++ DVAGATFMAAGSSAPEL T++IGVFI K D+ +  +VGSA +N++ +I +  +F  +VI LNWWP+FRDC  Y +SII L +++ D L+ WYEA+V +F Y  YI++ Y+N +L       V + LP      E          N +      TS G+      +E +E  E+G +    +R       D D     G +  +       E+P+    R     Y+    P+      +IPDC K   +RK F +TF  S IWI + +YI++WMI +IG TL IPD++MGLTF+AAG+S+PDAIA  LV ++G GDMA+SN++GSNVFDILIC+G+PW I+   L  G  I + S  L++ TITL  TV  LV
Sbjct:    1 MLKKNHGAYFKILFFYFSLVIGMYFFTKFKSNSDTMSELHG-TSRKLLGLK-NCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSMYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCIIYCLSIIALIIILNDGLIQWYEALVMLFMYVAYIIILYYNGNL----YGFVIQRLPRLKGYGEE--------HNPLISQNLPTSFGLL---DSSEEEEIMETGDVDSIHSR----IRLDEDMTNLEGESPTI------FEVPNSFCHR----LYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVESSSLIFTTITLLSTVVVLV 456          
BLAST of slc24a-1 vs. Planmine SMEST
Match: SMESG000036251.1 (SMESG000036251.1)

HSP 1 Score: 238.424 bits (607), Expect = 9.643e-70
Identity = 172/524 (32.82%), Postives = 272/524 (51.91%), Query Frame = 1
Query:  169 NNDKSYISRQLLS------YKANCS-----PKAIDNFPEDL-FSKKARQSGALI-IHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAXXXXXXXXXXXXLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMINSGTESDEDYES-GKLIGTRNRNGSCCSSDIDFAKK--TGCAMC--LRSCFAT-----LELPDKKKAR------WWNYFY----YGLCYPLRFFLCVSIPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKCL-TLGKPILIYSKG---------------LLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLV 1593
             N   + +R LL       Y +NC+     P  +  F E+  F K    +G  I ++ LIT+ +FI LA++C+D+FVP LE + E LKL PDVAGATFMAAGSS+PEL ++I  V   + D+ +G + GSA +NL+ +I LSA  +K+V++L+W P+ RDCAFY ISI  L   ++D ++ WY+A+V +  Y  YI    FN  +         K      +   N  D+   +++ +  D    +T I +I+   E      +  + +          S DI    +    C MC  +R          +ELP  +  R      W+ Y      + + +P       +I DC ++ ++K+F ++F  S +W+G  ++ M+ ++T IG  + +   VM L  +AAGSS+PD + S++V REG GDMAVSNA+GSNVFDI   +G+P++IK L   G PI ++S+                + +  I LF+ +      T L  +K+ K  G+    +Y+ FL+
Sbjct:   23 RNKTGFTNRNLLQSVQNVYYYSNCTNTTTIPNILQVFWENCDFEKSTNLTGVWISLYILITLIIFIALAVICDDFFVPSLEVMSEKLKLSPDVAGATFMAAGSSSPELFSSIAAVTF-ESDVGIGTITGSAVFNLLVIISLSAAVSKSVLKLDWRPITRDCAFYLISIGWLIFSVHDTIINWYDAVVMLLIYASYITFMVFNAKIMKRCNRNWDKCCYQSKVEPLNEEDDDIFLNSLIKYDRR--NTLINVISLPAEKRMSLPAFSRSVSIIESIEEDVSDDIKPVIQCCNLCNMCPPIRGSPPKYSDYMVELPTTESHRFSRSNIWFLYILKWIIFVVAFPFLVMFSYTIVDCTKQQYKKYFLMSFFVSILWLGSLTFAMVIIVTKIGCLINVNSFVMSLVVLAAGSSLPDLLGSLIVAREGCGDMAVSNAIGSNVFDINTGLGIPFMIKILINRGSPISLFSQKERKAYCQNAMLLIPHVKFTCILLFLLIMSYTIFT-LAKFKLNKVIGFSFFGLYIVFLI 542          
The following BLAST results are available for this feature:
BLAST of slc24a-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC24A53.771e-10138.49solute carrier family 24 member 5 [Source:HGNC Sym... [more]
SLC24A51.487e-7937.95solute carrier family 24 member 5 [Source:HGNC Sym... [more]
SLC24A41.254e-5247.34solute carrier family 24 member 4 [Source:HGNC Sym... [more]
SLC24A41.992e-5247.34solute carrier family 24 member 4 [Source:HGNC Sym... [more]
SLC24A42.772e-5247.34solute carrier family 24 member 4 [Source:HGNC Sym... [more]
back to top
BLAST of slc24a-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncx-45.016e-9134.21Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:Q1Z... [more]
ncx-52.014e-4336.55Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
ncx-43.174e-2745.59Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:Q1Z... [more]
ncx-71.356e-1231.21Putative sodium/calcium exchanger 7 [Source:UniPr... [more]
ncx-93.608e-1229.31Mitochondrial sodium/calcium exchanger protein [S... [more]
back to top
BLAST of slc24a-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zyd3.233e-9938.20gene:FBgn0265767 transcript:FBtr0340198[more]
CG120611.157e-7631.94gene:FBgn0040031 transcript:FBtr0332625[more]
zyd1.721e-7134.68gene:FBgn0265767 transcript:FBtr0340199[more]
zyd1.721e-7134.68gene:FBgn0265767 transcript:FBtr0113769[more]
zyd1.721e-7134.68gene:FBgn0265767 transcript:FBtr0347557[more]
back to top
BLAST of slc24a-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc24a4b1.512e-10838.08solute carrier family 24 member 4b [Source:ZFIN;Ac... [more]
slc24a4a7.464e-10438.10solute carrier family 24 member 4a [Source:ZFIN;Ac... [more]
BX088721.12.098e-10036.99solute carrier family 24 member 6a [Source:NCBI ge... [more]
slc24a54.422e-9736.01solute carrier family 24 member 5 [Source:ZFIN;Acc... [more]
slc24a21.606e-9035.32solute carrier family 24 member 2 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc24a-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nt5c3a9.632e-10740.405'-nucleotidase, cytosolic IIIA [Source:Xenbase;Ac... [more]
SLC24A53.244e-10639.26solute carrier family 24 member 5 [Source:NCBI gen... [more]
nt5c3a3.377e-10638.005'-nucleotidase, cytosolic IIIA [Source:Xenbase;Ac... [more]
SLC24A57.843e-10640.13solute carrier family 24 member 5 [Source:NCBI gen... [more]
SLC24A51.017e-10539.83solute carrier family 24 member 5 [Source:NCBI gen... [more]
back to top
BLAST of slc24a-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc24a53.273e-10037.05solute carrier family 24, member 5 [Source:MGI Sym... [more]
Slc24a44.391e-5343.19solute carrier family 24 (sodium/potassium/calcium... [more]
Slc24a44.673e-5343.19solute carrier family 24 (sodium/potassium/calcium... [more]
Slc24a46.313e-5343.19solute carrier family 24 (sodium/potassium/calcium... [more]
Slc24a32.493e-5247.40solute carrier family 24 (sodium/potassium/calcium... [more]
back to top
BLAST of slc24a-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q71RS6|NCKX5_HUMAN1.811e-10038.49Sodium/potassium/calcium exchanger 5 OS=Homo sapie... [more]
sp|Q8C261|NCKX5_MOUSE2.289e-9937.05Sodium/potassium/calcium exchanger 5 OS=Mus muscul... [more]
sp|Q49SH1|NCKX5_DANRE7.313e-9635.80Sodium/potassium/calcium exchanger 5 OS=Danio reri... [more]
sp|Q9VN12|NCKXH_DROME3.939e-6253.68Probable sodium/potassium/calcium exchanger CG1090... [more]
sp|Q8CGQ8|NCKX4_MOUSE4.416e-5243.19Sodium/potassium/calcium exchanger 4 OS=Mus muscul... [more]
back to top
BLAST of slc24a-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFD40.000e+0100.00Slc24a-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0R3WB942.617e-16348.20Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A4E0RSA55.512e-16250.20Sodium:potassium:calcium exchanger OS=Fasciola hep... [more]
W6UGM11.381e-16147.81Putative sodium/potassium/calcium exchanger OS=Ech... [more]
A0A5K3EGE34.744e-16149.61Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of slc24a-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc24a23.933e-9332.15sodium/potassium/calcium exchanger 2 [Source:NCBI ... [more]
SLC24A22.917e-9236.27solute carrier family 24 member 2 [Source:NCBI gen... [more]
slc24a21.700e-9132.31sodium/potassium/calcium exchanger 2 [Source:NCBI ... [more]
SLC24A22.546e-9135.69solute carrier family 24 member 2 [Source:NCBI gen... [more]
slc24a4a2.191e-8235.12solute carrier family 24 member 4a [Source:ZFIN;Ac... [more]
back to top
BLAST of slc24a-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc24a4b1.734e-5143.40solute carrier family 24 member 4b [Source:ZFIN;Ac... [more]
slc24a17.906e-4846.41solute carrier family 24 member 1 [Source:ZFIN;Acc... [more]
SLC8B11.907e-1127.56solute carrier family 8 member B1 [Source:HGNC Sym... [more]
ENSPMAT00000006683.12.579e-1032.12pep scaffold:Pmarinus_7.0:GL476710:281470:285756:-... [more]
ENSPMAT00000000794.11.334e-632.41pep scaffold:Pmarinus_7.0:GL477892:73629:76552:-1 ... [more]
back to top
BLAST of slc24a-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc24a-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO320488.128e-11339.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352128.666e-6534.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483007.995e-4547.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414213.930e-4448.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480079.133e-4244.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc24a-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc24a52.540e-10639.79solute carrier family 24 member 5 [Source:NCBI gen... [more]
slc24a51.595e-10540.08solute carrier family 24 member 5 [Source:NCBI gen... [more]
ENSORLT00000009286.24.708e-10136.36sodium/potassium/calcium exchanger 3 [Source:NCBI ... [more]
SLC24A23.867e-9034.97solute carrier family 24 member 2 [Source:NCBI gen... [more]
SLC24A25.681e-9034.63solute carrier family 24 member 2 [Source:NCBI gen... [more]
back to top
BLAST of slc24a-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010390.10.000e+099.61SMESG000010390.1[more]
SMESG000010390.10.000e+097.66SMESG000010390.1[more]
SMESG000030115.11.340e-10939.57SMESG000030115.1[more]
SMESG000030115.11.961e-10040.04SMESG000030115.1[more]
SMESG000036251.19.643e-7032.82SMESG000036251.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30032389
GenBankAKN21562.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032389 ID=SMED30032389|Name=slc24a-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2111bp
TCTATATAAATCTTATATGAGTTAATTCAAAGCATCGAAAAATATTCTGA
TTCAAACCGTCATAAAACTATGAAGAAAAGATCCTATATTTCAATTTGGA
CTTTTTTATTAATGTTTGGATGTCTATTTATATTTTATGCGAATTACAAA
CATGACATAAATCCGATAAATAATGACAAATCCTATATATCTCGGCAATT
GTTGAGTTACAAAGCCAACTGCTCACCAAAAGCTATTGATAATTTTCCTG
AAGATTTATTTTCAAAGAAAGCTCGACAGTCGGGAGCGTTGATTATTCAT
TTTCTTATTACCATTTACATGTTCATTGGACTGGCAATAGTTTGTGAGGA
CTATTTTGTACCATGCCTCGAATGCATTTGTGAGAATCTCAAACTTCAAC
CAGATGTTGCAGGAGCGACGTTCATGGCTGCTGGCAGTTCAGCACCGGAA
TTAGCAACTACAATCATTGGAGTATTCATTGCAAAGGATGACATAGCTCT
TGGGGCGGTTGTAGGCTCAGCGGACTATAATCTTATGTTTGTAATTGGCT
TATCAGCTCTTTTCGCCAAAACAGTCATTCAATTAAATTGGTGGCCATTG
TTTCGTGATTGTGCATTTTATTCGATCTCCATTATCCTATTGGCACTGGT
TATTTATGATAATCTCGTTTATTGGTATGAGGCAATTGTATTCATTTTTT
TCTATGGTATCTACATAGTGTTGAATTATTTCAATAAGTCCTTGGAGCTA
TGGGCAAAAATGCTAGTCACAAAGTATCTCCCAAATTGTACAATTAATAA
TGAAAATCTATCAGATGAAGCATTTCTCATGTCAAATGAAGTGGCCGAGG
ATTTACACACGACTTCTACAGGAATCGAGATGATCAACTCTGGCACCGAA
TCAGATGAAGATTATGAAAGCGGAAAACTAATAGGCACTCGCAATCGCAA
CGGAAGTTGTTGTTCTTCAGACATAGATTTTGCAAAGAAAACCGGATGTG
CCATGTGTTTAAGAAGTTGTTTCGCTACCCTTGAGTTACCGGATAAAAAG
AAAGCGAGATGGTGGAATTATTTCTATTACGGCCTCTGTTATCCGTTAAG
ATTTTTTCTTTGTGTCTCCATTCCAGATTGCAAGGAGCGCTTTTTCCGTA
AATGGTTTTGGATCACGTTCATCAATTCTTGCATTTGGATTGGAATGTAT
TCCTACATCATGATATGGATGATCACTGTGATAGGTTTTACCTTGGGTAT
ACCAGATTCCGTCATGGGGTTGACATTTATAGCGGCGGGTTCCAGTGTTC
CTGATGCGATAGCTTCGGTTTTGGTGGTTAGAGAAGGCCAAGGCGACATG
GCCGTGTCTAATGCAGTTGGAAGCAATGTGTTTGATATCTTGATCTGCAT
GGGCGTTCCCTGGCTTATCAAGTGCTTGACTTTAGGCAAACCGATATTAA
TATACTCTAAAGGGCTATTGTATGCAACAATAACGCTATTCATGACGGTC
TTTGGATTGGTATTCATTACACATCTCTACAGCTGGAAAATGACCAAGAG
TTTCGGATACATTTTGATTATTATCTACGTTGCATTTCTCGTCGTTTGCT
GTATGTATGAACTGAATGTGTTTGGGCTTGTACATCCTCCTGAATGTATA
TAAGCCTCCGTGTATGGAGGATACAATAGGTATCATCGATATTGTTATTA
GATTAATGAAGAGTTGATTTTATTTGTTTCTATGGCAACTGAGGACCTCC
GCTTGGAGTAATTTTCGGATTATTCCATTATCTGTTATTGATTAATTCGT
CTCGATCCGATCAGTTATCATCAATTTAATGTAATGTTGACTTGGACAGC
CATTCTGTAACGTGTTCGTGTGTAAATATTGATTGATTGATTTATGATTG
GTTGATTTGTGATTGATTTATGATTGGGTGATTTGTGATTGATTGATTGA
TGGAATCGATGATTGATTTGGGATTGATTTGTGATTGATTTATCGATTGA
CAAAAACTTCATCGAATTTTTCCTTTTTCAAAGCTGCATCACGTGATTAG
TGTAGTTATTAATACATTTAATTCGAATATCAATTAATTTATTAATTAAT
TTTTAATAAAT
back to top

protein sequence of SMED30032389-orf-1

>SMED30032389-orf-1 ID=SMED30032389-orf-1|Name=SMED30032389-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=105bp
MNTNPKTVMNSVIVAYNSPLEYINIGLPKVKHLISQGTPMQIKISNTLLP
TALDTAMSPWPSLTTKTEAIASGTLEPAAINVNPMTESGIPKVKPITVII
HIMM*
back to top

protein sequence of SMED30032389-orf-2

>SMED30032389-orf-2 ID=SMED30032389-orf-2|Name=SMED30032389-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=528bp
MKKRSYISIWTFLLMFGCLFIFYANYKHDINPINNDKSYISRQLLSYKAN
CSPKAIDNFPEDLFSKKARQSGALIIHFLITIYMFIGLAIVCEDYFVPCL
ECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGS
ADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLV
YWYEAIVFIFFYGIYIVLNYFNKSLELWAKMLVTKYLPNCTINNENLSDE
AFLMSNEVAEDLHTTSTGIEMINSGTESDEDYESGKLIGTRNRNGSCCSS
DIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVS
IPDCKERFFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMG
LTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLI
KCLTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILI
IIYVAFLVVCCMYELNVFGLVHPPECI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR004481K/Na/Ca-exchanger
IPR004837NaCa_Exmemb
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1420.30coord: 125..253
e-value: 1.7E-26
score: 94.9
coord: 332..530
e-value: 3.0E-29
score: 103.9
NoneNo IPR availablePANTHERPTHR10846:SF8SODIUM/POTASSIUM/CALCIUM EXCHANGER CG1090-RELATEDcoord: 64..542
NoneNo IPR availableTMHMMTMhelixcoord: 379..401
NoneNo IPR availableTMHMMTMhelixcoord: 414..436
NoneNo IPR availableTMHMMTMhelixcoord: 215..237
NoneNo IPR availableTMHMMTMhelixcoord: 159..181
NoneNo IPR availableTMHMMTMhelixcoord: 481..503
NoneNo IPR availableTMHMMTMhelixcoord: 449..466
NoneNo IPR availableTMHMMTMhelixcoord: 188..210
NoneNo IPR availableTMHMMTMhelixcoord: 510..532
NoneNo IPR availableTMHMMTMhelixcoord: 132..154
NoneNo IPR availableTMHMMTMhelixcoord: 89..108
NoneNo IPR availableTMHMMTMhelixcoord: 21..40
IPR004481Sodium/potassium/calcium exchangerTIGRFAMTIGR00367TIGR00367coord: 92..522
e-value: 2.2E-75
score: 251.6
IPR004481Sodium/potassium/calcium exchangerPANTHERPTHR10846SODIUM/POTASSIUM/CALCIUM EXCHANGERcoord: 64..542
IPR004837Sodium/calcium exchanger membrane regionPFAMPF01699Na_Ca_excoord: 93..236
e-value: 3.2E-25
score: 88.8
coord: 379..526
e-value: 5.4E-27
score: 94.6