C4b binding protein beta chain

Overview
NameC4b binding protein beta chain
Smed IDSMED30032384
Length (bp)2054
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of C4b binding protein beta chain (SMED30032384) t-SNE clustered cells

Violin plots show distribution of expression levels for C4b binding protein beta chain (SMED30032384) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of C4b binding protein beta chain (SMED30032384) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for C4b binding protein beta chain (SMED30032384) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032384

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30032384h1SMcG0015014 dd_Smed_v4_13071_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30032384h1SMcG0015014 dd_Smed_v4_13071_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30032384h1SMcG0015014 dd_Smed_v4_13071_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
midlineSMED30032384h1SMcG0015014 dd_Smed_v4_13071_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30032384h1SMcG0015014 SmedASXL_015971SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30032384h1SMcG0015014 dd_Smed_v4_13071_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032384h1SMcG0015014 dd_Smed_v4_13071_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30032384h1SMcG0015014 dd_Smed_v4_13071_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30032384h1SMcG0015014 dd_Smed_v4_13071_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30032384h1SMcG0015014 dd_Smed_v4_13071_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30032384h1SMcG0015014 dd_Smed_v6_13071_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30032384h1SMcG0015014 OX_Smed_1.0.06258ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of C4b binding protein beta chain vs. Ensembl Human
Match: CSMD1 (CUB and Sushi multiple domains 1 [Source:HGNC Symbol;Acc:HGNC:14026])

HSP 1 Score: 120.168 bits (300), Expect = 3.667e-27
Identity = 114/472 (24.15%), Postives = 180/472 (38.14%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECT-DQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFK------------------------------------IQCTTDQFEDKNCRRQCQA----------------DGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFI-PRCVEAACSARPPSMKYSTVRFLSLKHDSLARYY-CHFGYYIA 1634
            + + C  P  P N      +   G  V Y+C+   +L G   R CQ +   SG+ P CT +    C      P T  H +   DDFK    ++  C+ G++           NG+     P+ CE  SCG    P NG  + ++   + S  I  C +G+K                                    IQ  TD   +K    QC                  DG+W+    +C A+LCP+  P +NG V G      S  ++ C +GYQL  S +  C   G W G    C+   CG P      +++ ++ T+ ++  ++CKS   L+G +       V    G     +P C+        D    +    N +  +    EV  G+ V  +C  GY +       C  N +W+ I   C+  AC  +P +  ++ VR + L        Y CH G+++A
Sbjct: 2855 LAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGD----PGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPV-CEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTIISCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMDGYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSR-----RVCQADGTWSGIQPTCIDPAHNTCPDPGTPHFGIQNSSRGY----EV--GSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACR-QPETPAHADVRAIDLPTFGYTLVYTCHPGFFLA 3309          

HSP 2 Score: 107.457 bits (267), Expect = 4.082e-23
Identity = 134/532 (25.19%), Postives = 204/532 (38.35%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIK-----TFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHC---KPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFI-PRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL---NGHWSPPQMPTCEFIM 1949
            + C     P NG+   ++ + G    +TC +GY L G   R C AN   SGSE  C      C S    P   V+ + + D F   + V   C  G+     S  I     ++W      C   +CG   +P +G T   + +    +    CN G+ +Q  +        R QC+++G+WS     C  + C +    EN    G  N   S +      + CK+G+ L GS    C   G WD S   C+  +CG P     A +  E  T+GA   Y C+   +LIG  + + C E  + SG LP        HC    P          H +       + D+    + +R  C  G++L       C  NGSW+ + P C   +C           V    +   S   Y C  GY    +  G+ T     +     G WT    + C    C  P T  NG  +    +D T           N+ V Y+C+P Y ++    A      +G W+P + P C+ ++
Sbjct: 2620 ISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRCL--AGHCGS----PDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRIC-LQDHKWSGQTPVCVPITCGHPGNPAHGFTN-GSEFNLNDVVNFTCNTGYLLQGVS--------RAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRV-CQEDSHWSGALP--------HCTGNNPGFCGDPGTPAHGSR------LGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGY----KTSGLMTRHCTAN-----GTWTGTAPD-CTIISCGDPGTLANGIQF---GTDFT----------FNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSK-PVCKAVL 3096          

HSP 3 Score: 99.3673 bits (246), Expect = 1.248e-20
Identity = 105/447 (23.49%), Postives = 160/447 (35.79%), Query Frame = 3
Query:  336 AQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNR-DDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTA---ILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQV------DSAKVYIHENNKTTNFI-MHDEVTHGTHVRAKCNFGY---ELNSDILPACYNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIA 1634
             ++C+ D    G   + + + C  P  P +G  N S   + D V +TC +GY L+G  +  C++N + S   P C  +   C    ++     H   N  + F+ G  +   C+ G+     S +    NG  W     KC   SCG    P N   +    +TY ++            C   +    N  R CQ D  WSG    CT      C +   P +G  +G      S+  F C+ G+QL GS  R C   G+W G    C   +CG P       +                S   L   +    C E    SG + +       HC           D   +   +     N I    + T    V  +CN GY    + S  +    +G WN      +A    +PP ++  TV     +  S   Y C  GY ++
Sbjct: 2717 VRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTC--RVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANG-LWDRSLPKCLAISCGHPGVPANA-VLTGELFTYGAVV--------HYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIV--------------SSDGILFSSSVIYACWEGYKTSGLMTR-------HCTANGTWTGTAPDCTIISCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMDGYQLS 3130          

HSP 4 Score: 98.5969 bits (244), Expect = 1.902e-20
Identity = 108/424 (25.47%), Postives = 161/424 (37.97%), Query Frame = 3
Query:  423 NGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQAN-LRLSGSEPECTDQTDLCFSAP-YIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNE-W--KYDPIKCEKKSCGKLEDPKNGRTMYN------NNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWS-GDT-AICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF-IPRCVEAACSARPPSMKYSTVRF------LSLKHDSLARYYCHFGYYI 1631
             G  N +   VG +V Y CK GY + G     C+ N L +     +    T LC +    IP +  + +   ++F     V   C  G++        A C  +  W  K  P  C+  +C  +E   +   ++       N Y  Q +          + C+   + +     +CQA+G W+ GD    C  I C  LS P NG  +G      +   F C  GY L GSH+R+C   G W GS + C+  +CG P  IV   ++ +  ++     Y+C     L+G TS   C +    SG  P         C P          H  N    F    E      V   CN GY L       C  NG W+  +P C    CS   P    + +R        S ++     Y+C  G+Y+
Sbjct: 2441 GGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMY----QWDSLTPLCQAVSCGIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL----------LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRCLAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVG-TSVRICLQDHKWSGQTPV--------CVPITCG------HPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSD--PGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYL 2833          

HSP 5 Score: 62.3882 bits (150), Expect = 3.127e-9
Identity = 46/187 (24.60%), Postives = 76/187 (40.64%), Query Frame = 3
Query:  399 CQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAIC 956
            C  P  P  G  +        +V + CKS + L G  +R CQA+   SG +P C D        P  P+  + ++S    ++ G  V   C+ GY    +      C  N  W     +C   +C + E P +      +  T+    +  C+ GF +   ++        R C+AD KW+G + +C
Sbjct: 3155 CGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNTCPDPGTPHFGIQNSSR--GYEVGSTVFFRCRKGYH--IQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAGGSEH-------RTCKADMKWTGKSPVC 3330          

HSP 6 Score: 58.5362 bits (140), Expect = 5.118e-8
Identity = 125/543 (23.02%), Postives = 185/543 (34.07%), Query Frame = 3
Query:  396 QCQPP--VQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQ--ANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGY----------------EDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMG-VWNTVNSIKTFKCKEGYQLHGSHLRKCTREG----NWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF---IPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTC 1937
            +CQPP  V             +GD V+Y C  GY L G     C+  + L+  GS P C  Q          P  +V   S+           +I   GY                E  Y   I      +E ++D ++    S G  + P     + + N+T QS      N    ++ +TD    K   +   A            A  C    P +NG ++      V S   + CK GY++ G     C R       WD     C   +CG P             T  ++  Y+C     L  E+S            W  K +P     CKP    S +  + E+      +      +G  V   C+ GY L    L  C  NG+WN     P C   +C +       + +  L++ + + A + C+ GY + +     E L+         G W+   T  C    C  P    NG I   G S R               V Y+C+P +RL G  + +CL  H    Q P C
Sbjct: 2257 KCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTCEAQ---------CPANEVRTGSS----------GVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSG--QSPL--LVVLSGNHTEQSNFTSRSNQ-LYLRWSTDHATSKKGFKIRYA------------APYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSCGIPESPGNGSFTGNEFTLDSKVVYECHEGFKL--ESSQQATAVCQEDGLWSNKGKPPT---CKPVACPSIEAQLSEH-VIWRLVSGSLNEYGAQVLLSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTV-YGATAIFTCNTGYTL-VGSHVRECLA--------NGLWSGSETR-CLAGHCGSPDPIVNGHISGDGFSYR-------------DTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVC 2733          

HSP 7 Score: 51.6026 bits (122), Expect = 5.548e-6
Identity = 61/256 (23.83%), Postives = 87/256 (33.98%), Query Frame = 3
Query:  375 VCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDP--IKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGV-WNTVNSIKTFKCKEGYQLHG-SHLRKCTREGNWDGSNSTC 1130
            VC  +     PPVQ  NG    S    G  + Y+C  GY L       C+      G  P+C      C   P IP        +   F    +V   C++ +     S  + + +G      P  I     +C     P  G    +  Y   S     C  G+ IQ +T         R C A+  WSG    C    C +   P + +V  +   T      + C  G+ L G S  R C  +  W G +  C
Sbjct: 3091 VCKAVLCPQPPPVQ--NGTVEGSDFRWGSSISYSCMDGYQLSHSAILSCEGRGVWKGEIPQCLPV--FC-GDPGIP---AEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGST--------TRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAGGSEHRTCKADMKWTGKSPVC 3330          
BLAST of C4b binding protein beta chain vs. Ensembl Human
Match: CSMD1 (CUB and Sushi multiple domains 1 [Source:HGNC Symbol;Acc:HGNC:14026])

HSP 1 Score: 120.168 bits (300), Expect = 3.714e-27
Identity = 114/472 (24.15%), Postives = 180/472 (38.14%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECT-DQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFK------------------------------------IQCTTDQFEDKNCRRQCQA----------------DGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFI-PRCVEAACSARPPSMKYSTVRFLSLKHDSLARYY-CHFGYYIA 1634
            + + C  P  P N      +   G  V Y+C+   +L G   R CQ +   SG+ P CT +    C      P T  H +   DDFK    ++  C+ G++           NG+     P+ CE  SCG    P NG  + ++   + S  I  C +G+K                                    IQ  TD   +K    QC                  DG+W+    +C A+LCP+  P +NG V G      S  ++ C +GYQL  S +  C   G W G    C+   CG P      +++ ++ T+ ++  ++CKS   L+G +       V    G     +P C+        D    +    N +  +    EV  G+ V  +C  GY +       C  N +W+ I   C+  AC  +P +  ++ VR + L        Y CH G+++A
Sbjct: 2273 LAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGD----PGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPV-CEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTIISCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMDGYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSR-----RVCQADGTWSGIQPTCIDPAHNTCPDPGTPHFGIQNSSRGY----EV--GSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACR-QPETPAHADVRAIDLPTFGYTLVYTCHPGFFLA 2727          

HSP 2 Score: 107.457 bits (267), Expect = 3.672e-23
Identity = 134/532 (25.19%), Postives = 204/532 (38.35%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIK-----TFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHC---KPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFI-PRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL---NGHWSPPQMPTCEFIM 1949
            + C     P NG+   ++ + G    +TC +GY L G   R C AN   SGSE  C      C S    P   V+ + + D F   + V   C  G+     S  I     ++W      C   +CG   +P +G T   + +    +    CN G+ +Q  +        R QC+++G+WS     C  + C +    EN    G  N   S +      + CK+G+ L GS    C   G WD S   C+  +CG P     A +  E  T+GA   Y C+   +LIG  + + C E  + SG LP        HC    P          H +       + D+    + +R  C  G++L       C  NGSW+ + P C   +C           V    +   S   Y C  GY    +  G+ T     +     G WT    + C    C  P T  NG  +    +D T           N+ V Y+C+P Y ++    A      +G W+P + P C+ ++
Sbjct: 2038 ISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRCL--AGHCGS----PDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRIC-LQDHKWSGQTPVCVPITCGHPGNPAHGFTN-GSEFNLNDVVNFTCNTGYLLQGVS--------RAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRV-CQEDSHWSGALP--------HCTGNNPGFCGDPGTPAHGSR------LGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGY----KTSGLMTRHCTAN-----GTWTGTAPD-CTIISCGDPGTLANGIQF---GTDFT----------FNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSK-PVCKAVL 2514          

HSP 3 Score: 99.3673 bits (246), Expect = 1.069e-20
Identity = 105/447 (23.49%), Postives = 160/447 (35.79%), Query Frame = 3
Query:  336 AQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNR-DDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTA---ILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQV------DSAKVYIHENNKTTNFI-MHDEVTHGTHVRAKCNFGY---ELNSDILPACYNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIA 1634
             ++C+ D    G   + + + C  P  P +G  N S   + D V +TC +GY L+G  +  C++N + S   P C  +   C    ++     H   N  + F+ G  +   C+ G+     S +    NG  W     KC   SCG    P N   +    +TY ++            C   +    N  R CQ D  WSG    CT      C +   P +G  +G      S+  F C+ G+QL GS  R C   G+W G    C   +CG P       +                S   L   +    C E    SG + +       HC           D   +   +     N I    + T    V  +CN GY    + S  +    +G WN      +A    +PP ++  TV     +  S   Y C  GY ++
Sbjct: 2135 VRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTC--RVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANG-LWDRSLPKCLAISCGHPGVPANA-VLTGELFTYGAVV--------HYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIV--------------SSDGILFSSSVIYACWEGYKTSGLMTR-------HCTANGTWTGTAPDCTIISCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMDGYQLS 2548          

HSP 4 Score: 98.9821 bits (245), Expect = 1.822e-20
Identity = 107/423 (25.30%), Postives = 159/423 (37.59%), Query Frame = 3
Query:  423 NGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAP-YIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNE-W--KYDPIKCEKKSCGKLEDPKNGRTMYN------NNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWS-GDT-AICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF-IPRCVEAACSARPPSMKYSTVRF------LSLKHDSLARYYCHFGYYI 1631
             G  N +   VG +V Y CK GY + G     C+ N        +    T LC +    IP +  + +   ++F     V   C  G++        A C  +  W  K  P  C+  +C  +E   +   ++       N Y  Q +          + C+   + +     +CQA+G W+ GD    C  I C  LS P NG  +G      +   F C  GY L GSH+R+C   G W GS + C+  +CG P  IV   ++ +  ++     Y+C     L+G TS   C +    SG  P         C P          H  N    F    E      V   CN GY L       C  NG W+  +P C    CS   P    + +R        S ++     Y+C  G+Y+
Sbjct: 1859 GGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPL---GMYQWDSLTPLCQAVSCGIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL----------LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRCLAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVG-TSVRICLQDHKWSGQTPV--------CVPITCG------HPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSD--PGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYL 2251          

HSP 5 Score: 62.3882 bits (150), Expect = 3.107e-9
Identity = 46/187 (24.60%), Postives = 76/187 (40.64%), Query Frame = 3
Query:  399 CQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAIC 956
            C  P  P  G  +        +V + CKS + L G  +R CQA+   SG +P C D        P  P+  + ++S    ++ G  V   C+ GY    +      C  N  W     +C   +C + E P +      +  T+    +  C+ GF +   ++        R C+AD KW+G + +C
Sbjct: 2573 CGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNTCPDPGTPHFGIQNSSR--GYEVGSTVFFRCRKGYH--IQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAGGSEH-------RTCKADMKWTGKSPVC 2748          

HSP 6 Score: 53.1434 bits (126), Expect = 2.230e-6
Identity = 63/276 (22.83%), Postives = 94/276 (34.06%), Query Frame = 3
Query:  375 VCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDP--IKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGV-WNTVNSIKTFKCKEGYQLHG-SHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEA 1190
            VC  +     PPVQ  NG    S    G  + Y+C  GY L       C+      G  P+C      C   P IP        +   F    +V   C++ +     S  + + +G      P  I     +C     P  G    +  Y   S     C  G+ IQ +T         R C A+  WSG    C    C +   P + +V  +   T      + C  G+ L G S  R C  +  W G +  C +     P ++ F    ++ 
Sbjct: 2509 VCKAVLCPQPPPVQ--NGTVEGSDFRWGSSISYSCMDGYQLSHSAILSCEGRGVWKGEIPQCLPV--FC-GDPGIP---AEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGST--------TRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAGGSEHRTCKADMKWTGKSPVCKI-----PSDVFFVNSLWKG 2763          

HSP 7 Score: 51.2174 bits (121), Expect = 7.570e-6
Identity = 109/467 (23.34%), Postives = 164/467 (35.12%), Query Frame = 3
Query:  567 QTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMG-VWNTVNSIKTFKCKEGYQLHGSHLRKCTREG----NWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF---IPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTC 1937
            Q   C   P +P  Q    +  DDF+ G+ VK  C  GY       +  K +   +++     CE  S    + P     + + N+T QS      N    ++ +TD    K   +   A            A  C    P +NG ++      V S   + CK GY++ G     C R       WD     C   +CG P             T  ++  Y+C     L  E+S            W  K +P     CKP    S +  + E+      +      +G  V   C+ GY L    L  C  NG+WN     P C   +C +       + +  L++ + + A + C+ GY + +     E L+         G W+   T  C    C  P    NG I   G S R               V Y+C+P +RL G  + +CL  H    Q P C
Sbjct: 1735 QLKKCQPPPAVP--QAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTCEGSSG---QSPL--LVVLSGNHTEQSNFTSRSNQ-LYLRWSTDHATSKKGFKIRYA------------APYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSCGIPESPGNGSFTGNEFTLDSKVVYECHEGFKL--ESSQQATAVCQEDGLWSNKGKPPT---CKPVACPSIEAQLSEH-VIWRLVSGSLNEYGAQVLLSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTV-YGATAIFTCNTGYTL-VGSHVRECLA--------NGLWSGSETR-CLAGHCGSPDPIVNGHISGDGFSYR-------------DTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVC 2151          
BLAST of C4b binding protein beta chain vs. Ensembl Human
Match: CSMD1 (CUB and Sushi multiple domains 1 [Source:HGNC Symbol;Acc:HGNC:14026])

HSP 1 Score: 120.168 bits (300), Expect = 3.732e-27
Identity = 114/472 (24.15%), Postives = 180/472 (38.14%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECT-DQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFK------------------------------------IQCTTDQFEDKNCRRQCQA----------------DGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFI-PRCVEAACSARPPSMKYSTVRFLSLKHDSLARYY-CHFGYYIA 1634
            + + C  P  P N      +   G  V Y+C+   +L G   R CQ +   SG+ P CT +    C      P T  H +   DDFK    ++  C+ G++           NG+     P+ CE  SCG    P NG  + ++   + S  I  C +G+K                                    IQ  TD   +K    QC                  DG+W+    +C A+LCP+  P +NG V G      S  ++ C +GYQL  S +  C   G W G    C+   CG P      +++ ++ T+ ++  ++CKS   L+G +       V    G     +P C+        D    +    N +  +    EV  G+ V  +C  GY +       C  N +W+ I   C+  AC  +P +  ++ VR + L        Y CH G+++A
Sbjct: 2856 LAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGD----PGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPV-CEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTIISCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMDGYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSR-----RVCQADGTWSGIQPTCIDPAHNTCPDPGTPHFGIQNSSRGY----EV--GSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACR-QPETPAHADVRAIDLPTFGYTLVYTCHPGFFLA 3310          

HSP 2 Score: 107.457 bits (267), Expect = 4.189e-23
Identity = 134/532 (25.19%), Postives = 204/532 (38.35%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIK-----TFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHC---KPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFI-PRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL---NGHWSPPQMPTCEFIM 1949
            + C     P NG+   ++ + G    +TC +GY L G   R C AN   SGSE  C      C S    P   V+ + + D F   + V   C  G+     S  I     ++W      C   +CG   +P +G T   + +    +    CN G+ +Q  +        R QC+++G+WS     C  + C +    EN    G  N   S +      + CK+G+ L GS    C   G WD S   C+  +CG P     A +  E  T+GA   Y C+   +LIG  + + C E  + SG LP        HC    P          H +       + D+    + +R  C  G++L       C  NGSW+ + P C   +C           V    +   S   Y C  GY    +  G+ T     +     G WT    + C    C  P T  NG  +    +D T           N+ V Y+C+P Y ++    A      +G W+P + P C+ ++
Sbjct: 2621 ISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRCL--AGHCGS----PDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRIC-LQDHKWSGQTPVCVPITCGHPGNPAHGFTN-GSEFNLNDVVNFTCNTGYLLQGVS--------RAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRV-CQEDSHWSGALP--------HCTGNNPGFCGDPGTPAHGSR------LGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGY----KTSGLMTRHCTAN-----GTWTGTAPD-CTIISCGDPGTLANGIQF---GTDFT----------FNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSK-PVCKAVL 3097          

HSP 3 Score: 99.3673 bits (246), Expect = 1.216e-20
Identity = 105/447 (23.49%), Postives = 160/447 (35.79%), Query Frame = 3
Query:  336 AQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNR-DDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTA---ILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQV------DSAKVYIHENNKTTNFI-MHDEVTHGTHVRAKCNFGY---ELNSDILPACYNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIA 1634
             ++C+ D    G   + + + C  P  P +G  N S   + D V +TC +GY L+G  +  C++N + S   P C  +   C    ++     H   N  + F+ G  +   C+ G+     S +    NG  W     KC   SCG    P N   +    +TY ++            C   +    N  R CQ D  WSG    CT      C +   P +G  +G      S+  F C+ G+QL GS  R C   G+W G    C   +CG P       +                S   L   +    C E    SG + +       HC           D   +   +     N I    + T    V  +CN GY    + S  +    +G WN      +A    +PP ++  TV     +  S   Y C  GY ++
Sbjct: 2718 VRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTC--RVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANG-LWDRSLPKCLAISCGHPGVPANA-VLTGELFTYGAVV--------HYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIV--------------SSDGILFSSSVIYACWEGYKTSGLMTR-------HCTANGTWTGTAPDCTIISCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMDGYQLS 3131          

HSP 4 Score: 98.5969 bits (244), Expect = 1.902e-20
Identity = 108/424 (25.47%), Postives = 161/424 (37.97%), Query Frame = 3
Query:  423 NGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQAN-LRLSGSEPECTDQTDLCFSAP-YIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNE-W--KYDPIKCEKKSCGKLEDPKNGRTMYN------NNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWS-GDT-AICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF-IPRCVEAACSARPPSMKYSTVRF------LSLKHDSLARYYCHFGYYI 1631
             G  N +   VG +V Y CK GY + G     C+ N L +     +    T LC +    IP +  + +   ++F     V   C  G++        A C  +  W  K  P  C+  +C  +E   +   ++       N Y  Q +          + C+   + +     +CQA+G W+ GD    C  I C  LS P NG  +G      +   F C  GY L GSH+R+C   G W GS + C+  +CG P  IV   ++ +  ++     Y+C     L+G TS   C +    SG  P         C P          H  N    F    E      V   CN GY L       C  NG W+  +P C    CS   P    + +R        S ++     Y+C  G+Y+
Sbjct: 2442 GGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMY----QWDSLTPLCQAVSCGIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL----------LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRCLAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVG-TSVRICLQDHKWSGQTPV--------CVPITCG------HPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSD--PGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYL 2834          

HSP 5 Score: 62.3882 bits (150), Expect = 3.127e-9
Identity = 46/187 (24.60%), Postives = 76/187 (40.64%), Query Frame = 3
Query:  399 CQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAIC 956
            C  P  P  G  +        +V + CKS + L G  +R CQA+   SG +P C D        P  P+  + ++S    ++ G  V   C+ GY    +      C  N  W     +C   +C + E P +      +  T+    +  C+ GF +   ++        R C+AD KW+G + +C
Sbjct: 3156 CGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNTCPDPGTPHFGIQNSSR--GYEVGSTVFFRCRKGYH--IQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAGGSEH-------RTCKADMKWTGKSPVC 3331          

HSP 6 Score: 58.5362 bits (140), Expect = 5.162e-8
Identity = 125/543 (23.02%), Postives = 185/543 (34.07%), Query Frame = 3
Query:  396 QCQPP--VQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQ--ANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGY----------------EDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMG-VWNTVNSIKTFKCKEGYQLHGSHLRKCTREG----NWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF---IPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTC 1937
            +CQPP  V             +GD V+Y C  GY L G     C+  + L+  GS P C  Q          P  +V   S+           +I   GY                E  Y   I      +E ++D ++    S G  + P     + + N+T QS      N    ++ +TD    K   +   A            A  C    P +NG ++      V S   + CK GY++ G     C R       WD     C   +CG P             T  ++  Y+C     L  E+S            W  K +P     CKP    S +  + E+      +      +G  V   C+ GY L    L  C  NG+WN     P C   +C +       + +  L++ + + A + C+ GY + +     E L+         G W+   T  C    C  P    NG I   G S R               V Y+C+P +RL G  + +CL  H    Q P C
Sbjct: 2258 KCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTCEAQ---------CPANEVRTGSS----------GVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSG--QSPL--LVVLSGNHTEQSNFTSRSNQ-LYLRWSTDHATSKKGFKIRYA------------APYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSCGIPESPGNGSFTGNEFTLDSKVVYECHEGFKL--ESSQQATAVCQEDGLWSNKGKPPT---CKPVACPSIEAQLSEH-VIWRLVSGSLNEYGAQVLLSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTV-YGATAIFTCNTGYTL-VGSHVRECLA--------NGLWSGSETR-CLAGHCGSPDPIVNGHISGDGFSYR-------------DTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVC 2734          

HSP 7 Score: 51.6026 bits (122), Expect = 5.643e-6
Identity = 61/256 (23.83%), Postives = 87/256 (33.98%), Query Frame = 3
Query:  375 VCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDP--IKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGV-WNTVNSIKTFKCKEGYQLHG-SHLRKCTREGNWDGSNSTC 1130
            VC  +     PPVQ  NG    S    G  + Y+C  GY L       C+      G  P+C      C   P IP        +   F    +V   C++ +     S  + + +G      P  I     +C     P  G    +  Y   S     C  G+ IQ +T         R C A+  WSG    C    C +   P + +V  +   T      + C  G+ L G S  R C  +  W G +  C
Sbjct: 3092 VCKAVLCPQPPPVQ--NGTVEGSDFRWGSSISYSCMDGYQLSHSAILSCEGRGVWKGEIPQCLPV--FC-GDPGIP---AEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGST--------TRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAGGSEHRTCKADMKWTGKSPVC 3331          
BLAST of C4b binding protein beta chain vs. Ensembl Human
Match: CSMD1 (CUB and Sushi multiple domains 1 [Source:HGNC Symbol;Acc:HGNC:14026])

HSP 1 Score: 120.168 bits (300), Expect = 3.732e-27
Identity = 114/472 (24.15%), Postives = 180/472 (38.14%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECT-DQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFK------------------------------------IQCTTDQFEDKNCRRQCQA----------------DGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFI-PRCVEAACSARPPSMKYSTVRFLSLKHDSLARYY-CHFGYYIA 1634
            + + C  P  P N      +   G  V Y+C+   +L G   R CQ +   SG+ P CT +    C      P T  H +   DDFK    ++  C+ G++           NG+     P+ CE  SCG    P NG  + ++   + S  I  C +G+K                                    IQ  TD   +K    QC                  DG+W+    +C A+LCP+  P +NG V G      S  ++ C +GYQL  S +  C   G W G    C+   CG P      +++ ++ T+ ++  ++CKS   L+G +       V    G     +P C+        D    +    N +  +    EV  G+ V  +C  GY +       C  N +W+ I   C+  AC  +P +  ++ VR + L        Y CH G+++A
Sbjct: 2856 LAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGD----PGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPV-CEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTIISCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMDGYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSR-----RVCQADGTWSGIQPTCIDPAHNTCPDPGTPHFGIQNSSRGY----EV--GSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACR-QPETPAHADVRAIDLPTFGYTLVYTCHPGFFLA 3310          

HSP 2 Score: 107.457 bits (267), Expect = 4.189e-23
Identity = 134/532 (25.19%), Postives = 204/532 (38.35%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIK-----TFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHC---KPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFI-PRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL---NGHWSPPQMPTCEFIM 1949
            + C     P NG+   ++ + G    +TC +GY L G   R C AN   SGSE  C      C S    P   V+ + + D F   + V   C  G+     S  I     ++W      C   +CG   +P +G T   + +    +    CN G+ +Q  +        R QC+++G+WS     C  + C +    EN    G  N   S +      + CK+G+ L GS    C   G WD S   C+  +CG P     A +  E  T+GA   Y C+   +LIG  + + C E  + SG LP        HC    P          H +       + D+    + +R  C  G++L       C  NGSW+ + P C   +C           V    +   S   Y C  GY    +  G+ T     +     G WT    + C    C  P T  NG  +    +D T           N+ V Y+C+P Y ++    A      +G W+P + P C+ ++
Sbjct: 2621 ISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRCL--AGHCGS----PDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRIC-LQDHKWSGQTPVCVPITCGHPGNPAHGFTN-GSEFNLNDVVNFTCNTGYLLQGVS--------RAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRV-CQEDSHWSGALP--------HCTGNNPGFCGDPGTPAHGSR------LGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGY----KTSGLMTRHCTAN-----GTWTGTAPD-CTIISCGDPGTLANGIQF---GTDFT----------FNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSK-PVCKAVL 3097          

HSP 3 Score: 99.3673 bits (246), Expect = 1.216e-20
Identity = 105/447 (23.49%), Postives = 160/447 (35.79%), Query Frame = 3
Query:  336 AQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNR-DDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTA---ILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQV------DSAKVYIHENNKTTNFI-MHDEVTHGTHVRAKCNFGY---ELNSDILPACYNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIA 1634
             ++C+ D    G   + + + C  P  P +G  N S   + D V +TC +GY L+G  +  C++N + S   P C  +   C    ++     H   N  + F+ G  +   C+ G+     S +    NG  W     KC   SCG    P N   +    +TY ++            C   +    N  R CQ D  WSG    CT      C +   P +G  +G      S+  F C+ G+QL GS  R C   G+W G    C   +CG P       +                S   L   +    C E    SG + +       HC           D   +   +     N I    + T    V  +CN GY    + S  +    +G WN      +A    +PP ++  TV     +  S   Y C  GY ++
Sbjct: 2718 VRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTC--RVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANG-LWDRSLPKCLAISCGHPGVPANA-VLTGELFTYGAVV--------HYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIV--------------SSDGILFSSSVIYACWEGYKTSGLMTR-------HCTANGTWTGTAPDCTIISCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMDGYQLS 3131          

HSP 4 Score: 98.5969 bits (244), Expect = 1.902e-20
Identity = 108/424 (25.47%), Postives = 161/424 (37.97%), Query Frame = 3
Query:  423 NGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQAN-LRLSGSEPECTDQTDLCFSAP-YIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNE-W--KYDPIKCEKKSCGKLEDPKNGRTMYN------NNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWS-GDT-AICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF-IPRCVEAACSARPPSMKYSTVRF------LSLKHDSLARYYCHFGYYI 1631
             G  N +   VG +V Y CK GY + G     C+ N L +     +    T LC +    IP +  + +   ++F     V   C  G++        A C  +  W  K  P  C+  +C  +E   +   ++       N Y  Q +          + C+   + +     +CQA+G W+ GD    C  I C  LS P NG  +G      +   F C  GY L GSH+R+C   G W GS + C+  +CG P  IV   ++ +  ++     Y+C     L+G TS   C +    SG  P         C P          H  N    F    E      V   CN GY L       C  NG W+  +P C    CS   P    + +R        S ++     Y+C  G+Y+
Sbjct: 2442 GGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMY----QWDSLTPLCQAVSCGIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL----------LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRCLAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVG-TSVRICLQDHKWSGQTPV--------CVPITCG------HPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSD--PGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYL 2834          

HSP 5 Score: 62.3882 bits (150), Expect = 3.127e-9
Identity = 46/187 (24.60%), Postives = 76/187 (40.64%), Query Frame = 3
Query:  399 CQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAIC 956
            C  P  P  G  +        +V + CKS + L G  +R CQA+   SG +P C D        P  P+  + ++S    ++ G  V   C+ GY    +      C  N  W     +C   +C + E P +      +  T+    +  C+ GF +   ++        R C+AD KW+G + +C
Sbjct: 3156 CGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNTCPDPGTPHFGIQNSSR--GYEVGSTVFFRCRKGYH--IQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAGGSEH-------RTCKADMKWTGKSPVC 3331          

HSP 6 Score: 58.5362 bits (140), Expect = 5.162e-8
Identity = 125/543 (23.02%), Postives = 185/543 (34.07%), Query Frame = 3
Query:  396 QCQPP--VQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQ--ANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGY----------------EDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMG-VWNTVNSIKTFKCKEGYQLHGSHLRKCTREG----NWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF---IPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTC 1937
            +CQPP  V             +GD V+Y C  GY L G     C+  + L+  GS P C  Q          P  +V   S+           +I   GY                E  Y   I      +E ++D ++    S G  + P     + + N+T QS      N    ++ +TD    K   +   A            A  C    P +NG ++      V S   + CK GY++ G     C R       WD     C   +CG P             T  ++  Y+C     L  E+S            W  K +P     CKP    S +  + E+      +      +G  V   C+ GY L    L  C  NG+WN     P C   +C +       + +  L++ + + A + C+ GY + +     E L+         G W+   T  C    C  P    NG I   G S R               V Y+C+P +RL G  + +CL  H    Q P C
Sbjct: 2258 KCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTCEAQ---------CPANEVRTGSS----------GVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSG--QSPL--LVVLSGNHTEQSNFTSRSNQ-LYLRWSTDHATSKKGFKIRYA------------APYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSCGIPESPGNGSFTGNEFTLDSKVVYECHEGFKL--ESSQQATAVCQEDGLWSNKGKPPT---CKPVACPSIEAQLSEH-VIWRLVSGSLNEYGAQVLLSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTV-YGATAIFTCNTGYTL-VGSHVRECLA--------NGLWSGSETR-CLAGHCGSPDPIVNGHISGDGFSYR-------------DTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVC 2734          

HSP 7 Score: 51.6026 bits (122), Expect = 5.643e-6
Identity = 61/256 (23.83%), Postives = 87/256 (33.98%), Query Frame = 3
Query:  375 VCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDP--IKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGV-WNTVNSIKTFKCKEGYQLHG-SHLRKCTREGNWDGSNSTC 1130
            VC  +     PPVQ  NG    S    G  + Y+C  GY L       C+      G  P+C      C   P IP        +   F    +V   C++ +     S  + + +G      P  I     +C     P  G    +  Y   S     C  G+ IQ +T         R C A+  WSG    C    C +   P + +V  +   T      + C  G+ L G S  R C  +  W G +  C
Sbjct: 3092 VCKAVLCPQPPPVQ--NGTVEGSDFRWGSSISYSCMDGYQLSHSAILSCEGRGVWKGEIPQCLPV--FC-GDPGIP---AEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGST--------TRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAGGSEHRTCKADMKWTGKSPVC 3331          
BLAST of C4b binding protein beta chain vs. Ensembl Human
Match: CSMD1 (CUB and Sushi multiple domains 1 [Source:HGNC Symbol;Acc:HGNC:14026])

HSP 1 Score: 120.168 bits (300), Expect = 4.454e-27
Identity = 114/472 (24.15%), Postives = 180/472 (38.14%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECT-DQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFK------------------------------------IQCTTDQFEDKNCRRQCQA----------------DGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFI-PRCVEAACSARPPSMKYSTVRFLSLKHDSLARYY-CHFGYYIA 1634
            + + C  P  P N      +   G  V Y+C+   +L G   R CQ +   SG+ P CT +    C      P T  H +   DDFK    ++  C+ G++           NG+     P+ CE  SCG    P NG  + ++   + S  I  C +G+K                                    IQ  TD   +K    QC                  DG+W+    +C A+LCP+  P +NG V G      S  ++ C +GYQL  S +  C   G W G    C+   CG P      +++ ++ T+ ++  ++CKS   L+G +       V    G     +P C+        D    +    N +  +    EV  G+ V  +C  GY +       C  N +W+ I   C+  AC  +P +  ++ VR + L        Y CH G+++A
Sbjct: 2717 LAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGD----PGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPV-CEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTIISCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMDGYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSR-----RVCQADGTWSGIQPTCIDPAHNTCPDPGTPHFGIQNSSRGY----EV--GSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACR-QPETPAHADVRAIDLPTFGYTLVYTCHPGFFLA 3171          

HSP 2 Score: 107.071 bits (266), Expect = 4.661e-23
Identity = 134/532 (25.19%), Postives = 204/532 (38.35%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIK-----TFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHC---KPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFI-PRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL---NGHWSPPQMPTCEFIM 1949
            + C     P NG+   ++ + G    +TC +GY L G   R C AN   SGSE  C      C S    P   V+ + + D F   + V   C  G+     S  I     ++W      C   +CG   +P +G T   + +    +    CN G+ +Q  +        R QC+++G+WS     C  + C +    EN    G  N   S +      + CK+G+ L GS    C   G WD S   C+  +CG P     A +  E  T+GA   Y C+   +LIG  + + C E  + SG LP        HC    P          H +       + D+    + +R  C  G++L       C  NGSW+ + P C   +C           V    +   S   Y C  GY    +  G+ T     +     G WT    + C    C  P T  NG  +    +D T           N+ V Y+C+P Y ++    A      +G W+P + P C+ ++
Sbjct: 2482 ISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRCL--AGHCGS----PDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRIC-LQDHKWSGQTPVCVPITCGHPGNPAHGFTN-GSEFNLNDVVNFTCNTGYLLQGVS--------RAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRV-CQEDSHWSGALP--------HCTGNNPGFCGDPGTPAHGSR------LGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGY----KTSGLMTRHCTAN-----GTWTGTAPD-CTIISCGDPGTLANGIQF---GTDFT----------FNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSK-PVCKAVL 2958          

HSP 3 Score: 99.3673 bits (246), Expect = 1.353e-20
Identity = 105/447 (23.49%), Postives = 160/447 (35.79%), Query Frame = 3
Query:  336 AQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNR-DDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTA---ILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQV------DSAKVYIHENNKTTNFI-MHDEVTHGTHVRAKCNFGY---ELNSDILPACYNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIA 1634
             ++C+ D    G   + + + C  P  P +G  N S   + D V +TC +GY L+G  +  C++N + S   P C  +   C    ++     H   N  + F+ G  +   C+ G+     S +    NG  W     KC   SCG    P N   +    +TY ++            C   +    N  R CQ D  WSG    CT      C +   P +G  +G      S+  F C+ G+QL GS  R C   G+W G    C   +CG P       +                S   L   +    C E    SG + +       HC           D   +   +     N I    + T    V  +CN GY    + S  +    +G WN      +A    +PP ++  TV     +  S   Y C  GY ++
Sbjct: 2579 VRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTC--RVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANG-LWDRSLPKCLAISCGHPGVPANA-VLTGELFTYGAVV--------HYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIV--------------SSDGILFSSSVIYACWEGYKTSGLMTR-------HCTANGTWTGTAPDCTIISCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMDGYQLS 2992          

HSP 4 Score: 98.5969 bits (244), Expect = 2.190e-20
Identity = 108/424 (25.47%), Postives = 161/424 (37.97%), Query Frame = 3
Query:  423 NGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQAN-LRLSGSEPECTDQTDLCFSAP-YIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNE-W--KYDPIKCEKKSCGKLEDPKNGRTMYN------NNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWS-GDT-AICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF-IPRCVEAACSARPPSMKYSTVRF------LSLKHDSLARYYCHFGYYI 1631
             G  N +   VG +V Y CK GY + G     C+ N L +     +    T LC +    IP +  + +   ++F     V   C  G++        A C  +  W  K  P  C+  +C  +E   +   ++       N Y  Q +          + C+   + +     +CQA+G W+ GD    C  I C  LS P NG  +G      +   F C  GY L GSH+R+C   G W GS + C+  +CG P  IV   ++ +  ++     Y+C     L+G TS   C +    SG  P         C P          H  N    F    E      V   CN GY L       C  NG W+  +P C    CS   P    + +R        S ++     Y+C  G+Y+
Sbjct: 2303 GGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMY----QWDSLTPLCQAVSCGIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL----------LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRCLAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVG-TSVRICLQDHKWSGQTPV--------CVPITCG------HPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSD--PGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYL 2695          

HSP 5 Score: 62.3882 bits (150), Expect = 3.394e-9
Identity = 46/187 (24.60%), Postives = 76/187 (40.64%), Query Frame = 3
Query:  399 CQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAIC 956
            C  P  P  G  +        +V + CKS + L G  +R CQA+   SG +P C D        P  P+  + ++S    ++ G  V   C+ GY    +      C  N  W     +C   +C + E P +      +  T+    +  C+ GF +   ++        R C+AD KW+G + +C
Sbjct: 3017 CGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNTCPDPGTPHFGIQNSSR--GYEVGSTVFFRCRKGYH--IQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAGGSEH-------RTCKADMKWTGKSPVC 3192          

HSP 6 Score: 58.151 bits (139), Expect = 6.206e-8
Identity = 125/543 (23.02%), Postives = 185/543 (34.07%), Query Frame = 3
Query:  396 QCQPP--VQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQ--ANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGY----------------EDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMG-VWNTVNSIKTFKCKEGYQLHGSHLRKCTREG----NWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF---IPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTC 1937
            +CQPP  V             +GD V+Y C  GY L G     C+  + L+  GS P C  Q          P  +V   S+           +I   GY                E  Y   I      +E ++D ++    S G  + P     + + N+T QS      N    ++ +TD    K   +   A            A  C    P +NG ++      V S   + CK GY++ G     C R       WD     C   +CG P             T  ++  Y+C     L  E+S            W  K +P     CKP    S +  + E+      +      +G  V   C+ GY L    L  C  NG+WN     P C   +C +       + +  L++ + + A + C+ GY + +     E L+         G W+   T  C    C  P    NG I   G S R               V Y+C+P +RL G  + +CL  H    Q P C
Sbjct: 2119 KCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTCEAQ---------CPANEVRTGSS----------GVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSG--QSPL--LVVLSGNHTEQSNFTSRSNQ-LYLRWSTDHATSKKGFKIRYA------------APYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSCGIPESPGNGSFTGNEFTLDSKVVYECHEGFKL--ESSQQATAVCQEDGLWSNKGKPPT---CKPVACPSIEAQLSEH-VIWRLVSGSLNEYGAQVLLSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTV-YGATAIFTCNTGYTL-VGSHVRECLA--------NGLWSGSETR-CLAGHCGSPDPIVNGHISGDGFSYR-------------DTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVC 2595          

HSP 7 Score: 51.6026 bits (122), Expect = 5.775e-6
Identity = 61/256 (23.83%), Postives = 87/256 (33.98%), Query Frame = 3
Query:  375 VCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDP--IKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGV-WNTVNSIKTFKCKEGYQLHG-SHLRKCTREGNWDGSNSTC 1130
            VC  +     PPVQ  NG    S    G  + Y+C  GY L       C+      G  P+C      C   P IP        +   F    +V   C++ +     S  + + +G      P  I     +C     P  G    +  Y   S     C  G+ IQ +T         R C A+  WSG    C    C +   P + +V  +   T      + C  G+ L G S  R C  +  W G +  C
Sbjct: 2953 VCKAVLCPQPPPVQ--NGTVEGSDFRWGSSISYSCMDGYQLSHSAILSCEGRGVWKGEIPQCLPV--FC-GDPGIP---AEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGST--------TRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAGGSEHRTCKADMKWTGKSPVC 3192          
BLAST of C4b binding protein beta chain vs. Ensembl Celegans
Match: lev-9 (pep chromosome:WBcel235:X:6286129:6291579:-1 gene:WBGene00002976.1 transcript:T07H6.5c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lev-9)

HSP 1 Score: 193.356 bits (490), Expect = 5.262e-53
Identity = 169/578 (29.24%), Postives = 241/578 (41.70%), Query Frame = 3
Query:  291 KACTANIDCWVEYDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHS-ILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSN-RDDFKNGEDVKIICQNGYED-PYKSHIIAKC-----NGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTK-MPTEGCQXX----XXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTCEFIMHDELPISWLYYR 1985
            K C A+ DC     R + C+CD   CGL C+     C P     NG    +  L  G   EY C  GY L G  +R CQAN   S S+P C  Q   C   P IP+  VHD S+   ++    +V   C  GY     K   I+KC     N  +W    ++C+ ++C    D +NG     + + Y       CN GF +  +T         RQC ++G+W+ + A C A  C   S P +G+V+G   T  S+ T+ C  GY+L G   R C  EG W G+   C    C   P +    +    T+ GA A ++C    T  G  S   C E     G    P P+CL  C+   + + K+      +         +  G+ V  +CN  +E N D    C N +W+ +P C   +C   PP + ++ + F    H S+A+Y C+ GY+   R + +        IKC  G WTK  P   C P           T   G+I L G            K    R + ++C     L GP  A C+NG W P   P C    H  +    L+ R
Sbjct:   33 KECIADEDC----KRNKRCMCDGE-CGLSCVNPIAMCHPLPNIENGFIRTAGDLRFGSNAEYGCNKGYILVGASQRRCQANKEWSSSQPVCRLQLK-CGPPPEIPFA-VHDGSSFSGEYDLDAEVAYNCIPGYHKFNAKGLSISKCLLNRKNVAQWFGPDLRCKARACPDPGDIENG-LREGDTFEYPHHVKYSCNPGFLLVGSTS--------RQCSSNGEWTNEPANCKATECSRPSSPLHGKVVGSSLTYQSVVTYSCDHGYRLVGQVQRICLAEGIWGGNEPRCEEIRCSVLPTLPNGYIEGSETSFGAVAVFRCLETMTHEG-ASKAKCME----DGQWSAPIPRCLASCRVPHIQNGKIRDKSEGQL--------IASGSKVIVECNKQHEANIDERLICSNSTWSHVPVCSPLSCHNWPPRVPHARILFSKSSHGSIAKYECNNGYH-PNRNNQI--------IKCLYGEWTKDGPPMKCLPSWCEHPSKTYGTLPGGQILLEGILGAYEFQSYIQKVEEGRAISFQCGKGNYLIGPPKATCVNGEWMPKVSPKCVSQTHPMIEGKILWDR 572          
BLAST of C4b binding protein beta chain vs. Ensembl Celegans
Match: lev-9 (pep chromosome:WBcel235:X:6286453:6291732:-1 gene:WBGene00002976.1 transcript:T07H6.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lev-9)

HSP 1 Score: 192.971 bits (489), Expect = 7.418e-53
Identity = 169/578 (29.24%), Postives = 241/578 (41.70%), Query Frame = 3
Query:  291 KACTANIDCWVEYDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHS-ILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSN-RDDFKNGEDVKIICQNGYED-PYKSHIIAKC-----NGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTK-MPTEGCQXX----XXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTCEFIMHDELPISWLYYR 1985
            K C A+ DC     R + C+CD   CGL C+     C P     NG    +  L  G   EY C  GY L G  +R CQAN   S S+P C  Q   C   P IP+  VHD S+   ++    +V   C  GY     K   I+KC     N  +W    ++C+ ++C    D +NG     + + Y       CN GF +  +T         RQC ++G+W+ + A C A  C   S P +G+V+G   T  S+ T+ C  GY+L G   R C  EG W G+   C    C   P +    +    T+ GA A ++C    T  G  S   C E     G    P P+CL  C+   + + K+      +         +  G+ V  +CN  +E N D    C N +W+ +P C   +C   PP + ++ + F    H S+A+Y C+ GY+   R + +        IKC  G WTK  P   C P           T   G+I L G            K    R + ++C     L GP  A C+NG W P   P C    H  +    L+ R
Sbjct:   33 KECIADEDC----KRNKRCMCDGE-CGLSCVNPIAMCHPLPNIENGFIRTAGDLRFGSNAEYGCNKGYILVGASQRRCQANKEWSSSQPVCRLQLK-CGPPPEIPFA-VHDGSSFSGEYDLDAEVAYNCIPGYHKFNAKGLSISKCLLNRKNVAQWFGPDLRCKARACPDPGDIENG-LREGDTFEYPHHVKYSCNPGFLLVGSTS--------RQCSSNGEWTNEPANCKATECSRPSSPLHGKVVGSSLTYQSVVTYSCDHGYRLVGQVQRICLAEGIWGGNEPRCEEIRCSVLPTLPNGYIEGSETSFGAVAVFRCLETMTHEG-ASKAKCME----DGQWSAPIPRCLASCRVPHIQNGKIRDKSEGQL--------IASGSKVIVECNKQHEANIDERLICSNSTWSHVPVCSPLSCHNWPPRVPHARILFSKSSHGSIAKYECNNGYH-PNRNNQI--------IKCLYGEWTKDGPPMKCLPSWCEHPSKTYGTLPGGQILLEGILGAYEFQSYIQKVEEGRAISFQCGKGNYLIGPPKATCVNGEWMPKVSPKCVSQTHPMIEGKILWDR 572          
BLAST of C4b binding protein beta chain vs. Ensembl Celegans
Match: lev-9 (pep chromosome:WBcel235:X:6281847:6291579:-1 gene:WBGene00002976.1 transcript:T07H6.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lev-9)

HSP 1 Score: 193.356 bits (490), Expect = 2.096e-51
Identity = 169/578 (29.24%), Postives = 241/578 (41.70%), Query Frame = 3
Query:  291 KACTANIDCWVEYDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHS-ILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSN-RDDFKNGEDVKIICQNGYED-PYKSHIIAKC-----NGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTK-MPTEGCQXX----XXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTCEFIMHDELPISWLYYR 1985
            K C A+ DC     R + C+CD   CGL C+     C P     NG    +  L  G   EY C  GY L G  +R CQAN   S S+P C  Q   C   P IP+  VHD S+   ++    +V   C  GY     K   I+KC     N  +W    ++C+ ++C    D +NG     + + Y       CN GF +  +T         RQC ++G+W+ + A C A  C   S P +G+V+G   T  S+ T+ C  GY+L G   R C  EG W G+   C    C   P +    +    T+ GA A ++C    T  G  S   C E     G    P P+CL  C+   + + K+      +         +  G+ V  +CN  +E N D    C N +W+ +P C   +C   PP + ++ + F    H S+A+Y C+ GY+   R + +        IKC  G WTK  P   C P           T   G+I L G            K    R + ++C     L GP  A C+NG W P   P C    H  +    L+ R
Sbjct:   33 KECIADEDC----KRNKRCMCDGE-CGLSCVNPIAMCHPLPNIENGFIRTAGDLRFGSNAEYGCNKGYILVGASQRRCQANKEWSSSQPVCRLQLK-CGPPPEIPFA-VHDGSSFSGEYDLDAEVAYNCIPGYHKFNAKGLSISKCLLNRKNVAQWFGPDLRCKARACPDPGDIENG-LREGDTFEYPHHVKYSCNPGFLLVGSTS--------RQCSSNGEWTNEPANCKATECSRPSSPLHGKVVGSSLTYQSVVTYSCDHGYRLVGQVQRICLAEGIWGGNEPRCEEIRCSVLPTLPNGYIEGSETSFGAVAVFRCLETMTHEG-ASKAKCME----DGQWSAPIPRCLASCRVPHIQNGKIRDKSEGQL--------IASGSKVIVECNKQHEANIDERLICSNSTWSHVPVCSPLSCHNWPPRVPHARILFSKSSHGSIAKYECNNGYH-PNRNNQI--------IKCLYGEWTKDGPPMKCLPSWCEHPSKTYGTLPGGQILLEGILGAYEFQSYIQKVEEGRAISFQCGKGNYLIGPPKATCVNGEWMPKVSPKCVSQTHPMIEGKILWDR 572          

HSP 2 Score: 56.9954 bits (136), Expect = 4.896e-8
Identity = 47/195 (24.10%), Postives = 71/195 (36.41%), Query Frame = 3
Query:  732 WKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMG---VWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTC--IVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLP 1301
            W +   +C    C  +       T+   +Y    +A   C+ GF +        ++N    C   G WS D   C  + CP L PP NG  +G     NT   I    C   Y L G     C  +G W    + C    R+ G P       +A +  + G +  + C S++  +   + L C      S  LP
Sbjct: 1154 WSHSAPRCVAAHCPAVFVNGTRMTVTVTSYRTGGVAHFKCHKGFTL------IGEQN--LHCTTQGTWSHDFPYCNVVHCPPLLPPANGHFIGEPKEINTKGDIVLLGCLPNYMLTGGDFSVCQADGEWSEIKTKCDGYCRHPGQPDHGATTTIAKDYYSIGEKIVFYCPSQNYKLSSDNVLVCISPGQWSRRLP 1340          

HSP 3 Score: 51.2174 bits (121), Expect = 2.777e-6
Identity = 54/255 (21.18%), Postives = 88/255 (34.51%), Query Frame = 3
Query:  396 QCQPPVQPVNGHANHS--ILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIK---TFKC-KEGYQLHGSHLRKCTREGNWDGSNSTCIVRN 1142
            +C  P+ P N   + S   L VG   +++C  G++++G     C  +   S S P C     +    P +             ++ G      C  G+    + ++     G  W +D   C    C  L  P NG      ++  +   I    D   + C  +          CQADG+WS     C    C     P++G    +     SI     F C  + Y+L   ++  C   G W      C+  N
Sbjct: 1105 KCLLPIGPTNLQVDLSSPTLFVGTVAQFSCPPGFSVEGSAVSTCLEDATWSHSAPRC-----VAAHCPAVFVNGTRMTVTVTSYRTGGVAHFKCHKGFTLIGEQNLHCTTQGT-WSHDFPYCNVVHCPPLLPPANG------HFIGEPKEINTKGDIVLLGCLPNYMLTGGDFSVCQADGEWSEIKTKCDG-YCRHPGQPDHGATTTIAKDYYSIGEKIVFYCPSQNYKLSSDNVLVCISPGQWSRRLPLCLPSN 1346          
BLAST of C4b binding protein beta chain vs. Ensembl Celegans
Match: C54G4.4 (pep chromosome:WBcel235:I:7996728:8003179:-1 gene:WBGene00008314.1 transcript:C54G4.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C54G4.4)

HSP 1 Score: 63.5438 bits (153), Expect = 4.135e-10
Identity = 65/273 (23.81%), Postives = 107/273 (39.19%), Query Frame = 3
Query:  690 PYKSHIIAKCNGNEWKYDPIK--------CEKK-----SCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTV--NSIKTFKCKEGYQL-------HGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKC 1442
            P  S  +      EWK+ P          C+ K     S G  E  K   T  +++Y   ++    C+ G+ +            +R+C  +G+W+G    C    C  +   + G +  +  T    S   ++C  G+ L       + S  R C  +G W GS  TC + +CG PP I   +V  E++T  + A Y C     LIG  S L CG+   +  W P   P C       ++  +  + H N+ +++  +   V     V   C
Sbjct:  443 PSASEAVLLARPLEWKWVPASQTAWNSFLCQSKPKFCTSPGVGEATK--VTFSSHSYAIGTLCFYSCDSGYDLHGIR--------QRECAENGRWTGSIPNCYRKSCGAVRQWKFGRIKLLNKTTLFESEVEYECSNGWHLANSPSPSYRSLRRVCQSDGIWSGSEPTCELVDCGRPPLIANGRVDVESSTFESAANYTCHQGFRLIGPES-LMCGD---RGEWQPA-TPFCYDIATLQEIRGSTSHEHSNDNSSDSTIAMAVLASVIVAILC 700          
BLAST of C4b binding protein beta chain vs. Ensembl Celegans
Match: F36H2.3 (pep chromosome:WBcel235:I:9251838:9261657:-1 gene:WBGene00009500.1 transcript:F36H2.3h.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F36H2.3)

HSP 1 Score: 61.6178 bits (148), Expect = 1.985e-9
Identity = 112/578 (19.38%), Postives = 187/578 (32.35%), Query Frame = 3
Query:  390 DLQCQPPVQPVNGHANHS------ILLVGDQVEYTCKSGYALKGPRKRYCQANL----------RLSGSEP-ECTDQTDLCFS-APYIPYTQVHDNSNRDDFKNGEDVKIICQNG---------YEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPK------NGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCG------PPPEIVFAKVAYEAT-----THGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPK----PEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGSWN--FIPRCVEAACSARPPS---MKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIK--CNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPI-HNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTCEFIMHD 1955
             +QC   + P+ G   +S          G  V  +C +G A+ G     C   +           + GS   +C+  T    + A Y P++      +   F +G    + C  G             +   I+  C+G             +C  L  P       +G T +   +    IA   C++G +I  +T               G  +   + C  ++ P  +     +   V ++  +  T  C     L GS    C+  G W  +  +C     G      PP   V A + Y +      T G+ A   C +  T+IG TS   C      S W P             C P    S    +     + +  +   +  GT V   C  GY L+ + +  C +  W+   +  C++    +R  +       T    +  +     +    G  + LR D     +T  D    C  G W+      CQ              I  +  +  T    + + P     VV   C   Y   G   + C NG W+PP +  CE I ++
Sbjct:  990 GIQCTAMIAPLGGSVIYSNGGTMGPFPSGTTVTGSCTNGGAITGASTATCSNGMWNPTFLGTCSLIGGSTTGQCSALTIPSGAQATYSPFSL-----STTSFTSGTVATVTCTTGGSMLGTSTCTNGLWSPAIMGTCSGTG--------TGNTCSALTRPVGETVTYDGTTSFATTFNSGVIARVTCSNGTQIGQSTCLVGQWTPAITATCSGSSTAVGSQCIGVIVPTNAQVTYSDGSMVLHSAGTTATLTCLNSATLTGSSYSSCS-NGVWTPTLGSCTSSGTGTGPCYTPPLTPVGATLTYSSGYFAPWTAGSTATMSCPAGQTVIG-TSISYC----TNSAWSPALGSCSGSSVGQGCTPLSAFSGT--LTNGRMSYSPTITATIPVGTMVNIVCYAGYTLSGNSISTCTSSGWSPSTVGSCIQQGVLSRVSNQNCAAMDTPNHGTFSYSVAGSF--TTGTIVTLRCD-TNYAATNGDTSAICTNGVWSPKSLAMCQRTLKEVIGASCPAGIPAVLAATMTYSNGQLLGPYPAATVVTATCQAGYIPTGIMTSTCTNGLWTPPSLGLCELIGNE 1543          
BLAST of C4b binding protein beta chain vs. Ensembl Fly
Match: Hasp (gene:FBgn0032797 transcript:FBtr0081281)

HSP 1 Score: 190.66 bits (483), Expect = 2.084e-50
Identity = 154/563 (27.35%), Postives = 242/563 (42.98%), Query Frame = 3
Query:  363 LCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGY--EDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDT----AICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIV--FAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVY----IHENNKTTNFIMH------------------DEVTHGTHVRAKCNFGYELNSDIL--PACYNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLK-GPKIAVCLNGHWSPPQMPTCEFIMH 1952
            +CG  C++ D +C    QP  G    +    G +  Y C  GY + G + R CQA+   +G+EP C  Q   C   P I + +      ++ F     V+  C  GY      ++  +A  N   W    I+CE +SCG+  DP  G       YTY       C  G+++    +++        CQ+DG W+        + T+++CP    P+NG+        NS+ +++C+ GY L G    +C  +  W G+  TC   NCG P  +   + +     T  GA   ++C+    + G  S +   ++D +  W     P+CL  C    +    VY    I + N TT  I+H                  ++V HGT +  KC+  YE    +L  P C NG+W+ IPRCV A C + P   K+  V     +H   AR+ C  G+ +   +    T    + + C+ GNWT   T  C    C+ P    NG++ L+G            K ++N+ + Y+C   Y L+ GP  A C+ G W P  +P C    H
Sbjct:  109 VCGNSCIKPDRECPELAQPSLGQVTVAGRHFGARASYACPHGYHVVGLQSRLCQADGNWAGAEPAC-KQNIYCLKPPQIEHARNSALPEQETFDLDSTVQYHCHTGYVTNGFPRAKCLAIDNLASWYGPDIQCEPRSCGQPPDPAYGWHA-GECYTYGCKITYNCGTGYELVGKHERY--------CQSDGSWTPKELPTCVLVTSVVCPTPENPKNGKATYTTLAYNSVVSYECRYGYTLVGESSSRCGADRKWSGTLPTCKEINCGHPGVLYNGWIENIEAGTGLGASIIFRCQPEMMINGLGSSVC--QIDGR--WR-NALPECLAPCVVPTISQGNVYPIEIITDENGTT--IVHPPTTTTQSPTQTQSIGGVEKVKHGTALEVKCDENYEFPVSLLSPPTCNNGTWSIIPRCVPARCKSMPRPPKHGMVMAPKTEHGMKARFKCKDGFKLVSPEGKDVTDPHDYVLTCSFGNWTGE-TPKCDEVFCSFPGYIPNGKVLLVGNMGLYDYRPYVKKIVNNKQIMYDCDKGYVLEVGPPGATCVGGKWRPLDLPQCLLGQH 653          
BLAST of C4b binding protein beta chain vs. Ensembl Fly
Match: Hasp (gene:FBgn0032797 transcript:FBtr0302108)

HSP 1 Score: 190.66 bits (483), Expect = 2.528e-50
Identity = 154/563 (27.35%), Postives = 242/563 (42.98%), Query Frame = 3
Query:  363 LCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGY--EDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDT----AICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIV--FAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVY----IHENNKTTNFIMH------------------DEVTHGTHVRAKCNFGYELNSDIL--PACYNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLK-GPKIAVCLNGHWSPPQMPTCEFIMH 1952
            +CG  C++ D +C    QP  G    +    G +  Y C  GY + G + R CQA+   +G+EP C  Q   C   P I + +      ++ F     V+  C  GY      ++  +A  N   W    I+CE +SCG+  DP  G       YTY       C  G+++    +++        CQ+DG W+        + T+++CP    P+NG+        NS+ +++C+ GY L G    +C  +  W G+  TC   NCG P  +   + +     T  GA   ++C+    + G  S +   ++D +  W     P+CL  C    +    VY    I + N TT  I+H                  ++V HGT +  KC+  YE    +L  P C NG+W+ IPRCV A C + P   K+  V     +H   AR+ C  G+ +   +    T    + + C+ GNWT   T  C    C+ P    NG++ L+G            K ++N+ + Y+C   Y L+ GP  A C+ G W P  +P C    H
Sbjct:  109 VCGNSCIKPDRECPELAQPSLGQVTVAGRHFGARASYACPHGYHVVGLQSRLCQADGNWAGAEPAC-KQNIYCLKPPQIEHARNSALPEQETFDLDSTVQYHCHTGYVTNGFPRAKCLAIDNLASWYGPDIQCEPRSCGQPPDPAYGWHA-GECYTYGCKITYNCGTGYELVGKHERY--------CQSDGSWTPKELPTCVLVTSVVCPTPENPKNGKATYTTLAYNSVVSYECRYGYTLVGESSSRCGADRKWSGTLPTCKEINCGHPGVLYNGWIENIEAGTGLGASIIFRCQPEMMINGLGSSVC--QIDGR--WR-NALPECLAPCVVPTISQGNVYPIEIITDENGTT--IVHPPTTTTQSPTQTQSIGGVEKVKHGTALEVKCDENYEFPVSLLSPPTCNNGTWSIIPRCVPARCKSMPRPPKHGMVMAPKTEHGMKARFKCKDGFKLVSPEGKDVTDPHDYVLTCSFGNWTGE-TPKCDEVFCSFPGYIPNGKVLLVGNMGLYDYRPYVKKIVNNKQIMYDCDKGYVLEVGPPGATCVGGKWRPLDLPQCLLGQH 653          

HSP 2 Score: 50.447 bits (119), Expect = 5.913e-6
Identity = 60/256 (23.44%), Postives = 95/256 (37.11%), Query Frame = 3
Query:  789 KNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPEL-----SPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPP--PEIVFAK--VAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCK-PFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYEL-NSDILPACYNGSW-NFIPRCV 1520
            + G  +  N+    + A+  C +G  +   ++ F        C   G WS    +C ++ C ++     S   +  V  +   V     F C  GY L G     C   G W     TC+   C  P  P+  +A+    Y A   G   ++ C     + G+   + C +    SG L    PKC+  C  P  V S ++       +  F        G  +   C+ G +L  S +L    NG W + IP CV
Sbjct: 1414 RRGLIVNTNDTKLSTRALLSCANGNSLIGASELF--------CLPSGNWSAPLPVCESVECGDIPLGMGSNASSPRVSVLSREVGGRAAFSCASGYGLRGPAEAICNPTGEWSAPLPTCVEVQCDNPGAPQNGYAQGSAPYRA---GDVVQFNCNPEYMMQGQ-PIIACQDNARWSGGL----PKCVQACSYPGTVISGRM------SSVKFYY----AIGESITFTCDAGLDLRGSKVLKCLKNGKWSSAIPTCV 1643          
BLAST of C4b binding protein beta chain vs. Ensembl Fly
Match: Hasp (gene:FBgn0032797 transcript:FBtr0302107)

HSP 1 Score: 190.66 bits (483), Expect = 2.528e-50
Identity = 154/563 (27.35%), Postives = 242/563 (42.98%), Query Frame = 3
Query:  363 LCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGY--EDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDT----AICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIV--FAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVY----IHENNKTTNFIMH------------------DEVTHGTHVRAKCNFGYELNSDIL--PACYNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLK-GPKIAVCLNGHWSPPQMPTCEFIMH 1952
            +CG  C++ D +C    QP  G    +    G +  Y C  GY + G + R CQA+   +G+EP C  Q   C   P I + +      ++ F     V+  C  GY      ++  +A  N   W    I+CE +SCG+  DP  G       YTY       C  G+++    +++        CQ+DG W+        + T+++CP    P+NG+        NS+ +++C+ GY L G    +C  +  W G+  TC   NCG P  +   + +     T  GA   ++C+    + G  S +   ++D +  W     P+CL  C    +    VY    I + N TT  I+H                  ++V HGT +  KC+  YE    +L  P C NG+W+ IPRCV A C + P   K+  V     +H   AR+ C  G+ +   +    T    + + C+ GNWT   T  C    C+ P    NG++ L+G            K ++N+ + Y+C   Y L+ GP  A C+ G W P  +P C    H
Sbjct:  109 VCGNSCIKPDRECPELAQPSLGQVTVAGRHFGARASYACPHGYHVVGLQSRLCQADGNWAGAEPAC-KQNIYCLKPPQIEHARNSALPEQETFDLDSTVQYHCHTGYVTNGFPRAKCLAIDNLASWYGPDIQCEPRSCGQPPDPAYGWHA-GECYTYGCKITYNCGTGYELVGKHERY--------CQSDGSWTPKELPTCVLVTSVVCPTPENPKNGKATYTTLAYNSVVSYECRYGYTLVGESSSRCGADRKWSGTLPTCKEINCGHPGVLYNGWIENIEAGTGLGASIIFRCQPEMMINGLGSSVC--QIDGR--WR-NALPECLAPCVVPTISQGNVYPIEIITDENGTT--IVHPPTTTTQSPTQTQSIGGVEKVKHGTALEVKCDENYEFPVSLLSPPTCNNGTWSIIPRCVPARCKSMPRPPKHGMVMAPKTEHGMKARFKCKDGFKLVSPEGKDVTDPHDYVLTCSFGNWTGE-TPKCDEVFCSFPGYIPNGKVLLVGNMGLYDYRPYVKKIVNNKQIMYDCDKGYVLEVGPPGATCVGGKWRPLDLPQCLLGQH 653          

HSP 2 Score: 50.447 bits (119), Expect = 5.913e-6
Identity = 60/256 (23.44%), Postives = 95/256 (37.11%), Query Frame = 3
Query:  789 KNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPEL-----SPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPP--PEIVFAK--VAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCK-PFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYEL-NSDILPACYNGSW-NFIPRCV 1520
            + G  +  N+    + A+  C +G  +   ++ F        C   G WS    +C ++ C ++     S   +  V  +   V     F C  GY L G     C   G W     TC+   C  P  P+  +A+    Y A   G   ++ C     + G+   + C +    SG L    PKC+  C  P  V S ++       +  F        G  +   C+ G +L  S +L    NG W + IP CV
Sbjct: 1414 RRGLIVNTNDTKLSTRALLSCANGNSLIGASELF--------CLPSGNWSAPLPVCESVECGDIPLGMGSNASSPRVSVLSREVGGRAAFSCASGYGLRGPAEAICNPTGEWSAPLPTCVEVQCDNPGAPQNGYAQGSAPYRA---GDVVQFNCNPEYMMQGQ-PIIACQDNARWSGGL----PKCVQACSYPGTVISGRM------SSVKFYY----AIGESITFTCDAGLDLRGSKVLKCLKNGKWSSAIPTCV 1643          
BLAST of C4b binding protein beta chain vs. Ensembl Fly
Match: Hasp (gene:FBgn0032797 transcript:FBtr0081280)

HSP 1 Score: 190.66 bits (483), Expect = 2.770e-50
Identity = 154/563 (27.35%), Postives = 242/563 (42.98%), Query Frame = 3
Query:  363 LCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGY--EDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDT----AICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIV--FAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVY----IHENNKTTNFIMH------------------DEVTHGTHVRAKCNFGYELNSDIL--PACYNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLK-GPKIAVCLNGHWSPPQMPTCEFIMH 1952
            +CG  C++ D +C    QP  G    +    G +  Y C  GY + G + R CQA+   +G+EP C  Q   C   P I + +      ++ F     V+  C  GY      ++  +A  N   W    I+CE +SCG+  DP  G       YTY       C  G+++    +++        CQ+DG W+        + T+++CP    P+NG+        NS+ +++C+ GY L G    +C  +  W G+  TC   NCG P  +   + +     T  GA   ++C+    + G  S +   ++D +  W     P+CL  C    +    VY    I + N TT  I+H                  ++V HGT +  KC+  YE    +L  P C NG+W+ IPRCV A C + P   K+  V     +H   AR+ C  G+ +   +    T    + + C+ GNWT   T  C    C+ P    NG++ L+G            K ++N+ + Y+C   Y L+ GP  A C+ G W P  +P C    H
Sbjct:  109 VCGNSCIKPDRECPELAQPSLGQVTVAGRHFGARASYACPHGYHVVGLQSRLCQADGNWAGAEPAC-KQNIYCLKPPQIEHARNSALPEQETFDLDSTVQYHCHTGYVTNGFPRAKCLAIDNLASWYGPDIQCEPRSCGQPPDPAYGWHA-GECYTYGCKITYNCGTGYELVGKHERY--------CQSDGSWTPKELPTCVLVTSVVCPTPENPKNGKATYTTLAYNSVVSYECRYGYTLVGESSSRCGADRKWSGTLPTCKEINCGHPGVLYNGWIENIEAGTGLGASIIFRCQPEMMINGLGSSVC--QIDGR--WR-NALPECLAPCVVPTISQGNVYPIEIITDENGTT--IVHPPTTTTQSPTQTQSIGGVEKVKHGTALEVKCDENYEFPVSLLSPPTCNNGTWSIIPRCVPARCKSMPRPPKHGMVMAPKTEHGMKARFKCKDGFKLVSPEGKDVTDPHDYVLTCSFGNWTGE-TPKCDEVFCSFPGYIPNGKVLLVGNMGLYDYRPYVKKIVNNKQIMYDCDKGYVLEVGPPGATCVGGKWRPLDLPQCLLGQH 653          

HSP 2 Score: 50.447 bits (119), Expect = 5.763e-6
Identity = 60/256 (23.44%), Postives = 95/256 (37.11%), Query Frame = 3
Query:  789 KNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPEL-----SPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPP--PEIVFAK--VAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCK-PFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYEL-NSDILPACYNGSW-NFIPRCV 1520
            + G  +  N+    + A+  C +G  +   ++ F        C   G WS    +C ++ C ++     S   +  V  +   V     F C  GY L G     C   G W     TC+   C  P  P+  +A+    Y A   G   ++ C     + G+   + C +    SG L    PKC+  C  P  V S ++       +  F        G  +   C+ G +L  S +L    NG W + IP CV
Sbjct: 1413 RRGLIVNTNDTKLSTRALLSCANGNSLIGASELF--------CLPSGNWSAPLPVCESVECGDIPLGMGSNASSPRVSVLSREVGGRAAFSCASGYGLRGPAEAICNPTGEWSAPLPTCVEVQCDNPGAPQNGYAQGSAPYRA---GDVVQFNCNPEYMMQGQ-PIIACQDNARWSGGL----PKCVQACSYPGTVISGRM------SSVKFYY----AIGESITFTCDAGLDLRGSKVLKCLKNGKWSSAIPTCV 1642          
BLAST of C4b binding protein beta chain vs. Ensembl Fly
Match: fw (gene:FBgn0001083 transcript:FBtr0112806)

HSP 1 Score: 105.145 bits (261), Expect = 5.373e-23
Identity = 103/400 (25.75%), Postives = 151/400 (37.75%), Query Frame = 3
Query:  375 VCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTH--GAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPK------PEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTH--GTHVRAKCNFGYELNSDILPACYN-GSWN-FIPRCVEAACSA 1538
             C  +D    P ++  + H +      G    Y+C   Y L G   R C  +   SG +PEC    D C     I    V  N    D + G     +C+ GY    ++ II+   G EW      C    CG    P  G  +  N  T         N   K +C  D + D      C  +GKWSG+  +C  + C   S P    V+G    V+S   + C  G+ +HG+ + +C   G W      C   +CG    I +    Y   T   G++  + C     L G     TC E    S   PK      PEPK   H       + ++Y     +T+    +   T+  G   + +C  GY++  + L  C + G W+  IP CV   C A
Sbjct:   41 TCKYVDCGSLPELKFGSIHMSEERTSFGVVATYSCHENYTLIGNENRTCAMD-GWSGKQPECL--VDWCPDPQPIAGGDVRFN----DKRAGSTATYVCEPGYVLVGEA-IISCGLGGEWSSKTPSCRFVDCGAPARPNRGIAILLNGTT-------TVNSVVKYECDEDHWLDGQSELYCTREGKWSGEAPVCELVTCETPSVPSGSFVIGYDYNVHSKIQYNCDPGHIMHGTPVLECLDSGEWSADAPYCEYIDCGTILPIPYGSHKYVTNTTYVGSEVVFSCSQSHKLSGVLK-RTCLESAVWSDASPKCEEIRCPEPKLAAHSLLSVTGNDRMYGRTLIRTSESSQNTAQTYKIGALAKYRCERGYKMVGEALATCTDSGQWSGTIPECVYVECGA 424          

HSP 2 Score: 98.5969 bits (244), Expect = 6.288e-21
Identity = 83/307 (27.04%), Postives = 126/307 (41.04%), Query Frame = 3
Query:  453 VGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTD-----------------QTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKC-NGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQF-CNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAY--EATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPE 1310
            VG +V ++C   + L G  KR C  +   S + P+C +                   D  +    I  ++   N+ +  +K G   K  C+ GY+       +A C +  +W     +C    CG  E   NG+ +   N TY   A+ + CN  FK+   +        RR C   G WS +   C  ++C   +  EN  V      V S+ TFKC +G  + G+  R C + G W G + TC   +CG P  I   +V    ++T +G  AEY C      IG+     C E    SG  P+ E
Sbjct:  302 VGSEVVFSCSQSHKLSGVLKRTCLESAVWSDASPKCEEIRCPEPKLAAHSLLSVTGNDRMYGRTLIRTSESSQNTAQT-YKIGALAKYRCERGYK--MVGEALATCTDSGQWSGTIPECVYVECGAPEGINNGKVVLATNATYYGAAVLYECNVNFKLNGVS--------RRLCTEHGNWSHEAPECVEVVCDTPNINENLIVEAGPRAVGSVATFKCAKGRIMMGNDTRVCQKNGKWTGKSPTCRPVDCGRPLAIENGRVIVVNDSTLYGGSAEYHCIPNYNRIGQY-LRKCTEDGAWSGKQPRCE 596          

HSP 3 Score: 65.855 bits (159), Expect = 9.795e-11
Identity = 83/321 (25.86%), Postives = 133/321 (41.43%), Query Frame = 3
Query: 1005 MGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKV--AYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF-IPRCVEAACSARP-PSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWT-KMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLN-GHWSPPQMPTCEFI 1946
            MG   T+     + C +G+ L G   R+C  +G W GS+ TC   +CG  PE+ F  +  + E T+ G  A Y C    TLIG  +  TC       GW  K +P+CL+   P     A   +  N+K            G+     C  GY L  + + +C   G W+   P C    C A   P+   + +   +   +S+ +Y C   +++    DG   L         +G W+ + P   C+   C  P  P     +++G              +H++ ++Y C P + + G  +  CL+ G WS    P CE+I
Sbjct:    1 MGKKFTLGEKIQYTCPKGHSLLGQTERECRLDGTWSGSSPTCKYVDCGSLPELKFGSIHMSEERTSFGVVATYSCHENYTLIGNEN-RTCA----MDGWSGK-QPECLVDWCPDPQPIAGGDVRFNDKRA----------GSTATYVCEPGYVLVGEAIISCGLGGEWSSKTPSCRFVDCGAPARPNRGIAILLNGTTTVNSVVKYECDEDHWL----DGQSELYCT-----REGKWSGEAPV--CELVTCETPSVPSGS--FVIGYDYN----------VHSK-IQYNCDPGHIMHGTPVLECLDSGEWS-ADAPYCEYI 280          
BLAST of C4b binding protein beta chain vs. Ensembl Zebrafish
Match: svep1 (sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-110726-1])

HSP 1 Score: 122.479 bits (306), Expect = 4.305e-28
Identity = 141/572 (24.65%), Postives = 219/572 (38.29%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRD--DFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCG-----------KLEDPKNGRTMY-------NNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTC---GEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFI-PRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHW------------SPPQMPTCEFIMHDELPISWLYYRSDD 1994
            ++C  P +  NG   +S L     + Y C+ GY ++GP    C  N +     P C       + +P  P     DN   +  D K G  +   C  G+     +H+   C  + W     KC    CG           K+++      M        +N++ + S+    C+ G++I        +      C+ DG W+G   +CT   C     PENG VM   + + S+  + C EGY+L+G  +R+C     W      C+  +CG P  I   +V  ++        Y+C S   L G  +  TC   G+ DNK+       P C       +V   +  + ++      +  D+ T G  +   CN G+ L       C  NGSWN + P+C+ A C  +PPS++   V      ++ + RY C  GY +     G  TL    D     G W   P   C    C  P    +G  YL G S              + +V+Y C P Y + G  I  C   G W            SPP       +  D    + +++R DD
Sbjct: 2498 VKCAAPKEIPNGSVRYSKLQFSQSITYFCQRGYRIQGPETLTCLENGQWDQEAPTCVP----IYCSPPKPI----DNGFVEGRDRKFGVTIFYSCFPGFLLVGNNHLT--CEDHGWSSSEPKCVLADCGLPPHIDFGDYSKVQELSAEYDMVTSQQLPVDNSFLHGSLVKYHCHSGYEI--------NGAIMLMCREDGTWNGTAPMCTPAQCEAPPSPENGSVMVTDSALGSLAEYSCAEGYELNGQTIRQCISGQQWSDDAPRCLPISCGNPGGIANGEVIGKSFHFKELIHYECHSGFVLEGVET-RTCQVDGKWDNKA-------PLCK------EVSCGRPVVSKD----VLVRGDDHTFGKRLLFSCNLGFILLGAPTIVCLANGSWNEVPPKCLPANC-GQPPSIENGRVTGTDYGYNGMVRYACDIGYVLT----GNPTLICRAD-----GLWDDPPPR-CDIITCDPPEDISHG--YLNGSSFN-----------FDDIVEYICFPGYEVVGSPILRCAAEGVWLGQVPECRPCVCSPPVFKYGSILGRDHTCGASIWFRCDD 3009          

HSP 2 Score: 121.709 bits (304), Expect = 8.503e-28
Identity = 142/539 (26.35%), Postives = 219/539 (40.63%), Query Frame = 3
Query:  330 DRAQLCVCDSYLCG--LVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYN-NNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELN-SDILPACYNGSWNFIPR---CVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTK-MPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWS 1916
            D + +C C +   G    C E  ++C+ P  P  G    +  ++G +V ++CK GY L G  +  C          P C     L    P +P   +   +N   F  G  V   C+ GY  P +  I ++C  + +W  +P  C+  +CG  E P      Y  N   Y+S     C +G+++Q   +         QC++ G+W+    +C  + C +  P ++  + G   T+ S   + CK+GY L G+  ++C   GNW  ++S C+ R+CGPPP++  A         G  A Y C    T  G  + L C    N  G    P+   + HC            H      + I   +    T V  KC  G+ LN +  L     G W   P    C+   CS +P S++   V   +    ++  Y C  GY+I   K  +   S         G W   +PT  CQP  C  PP   NG  ++ GQ  +          ++N  V Y C+  YRL G     C+ N  WS
Sbjct: 1765 DGSHICTCIAPYSGDGRNCTE-PVKCKDPGVPEFGQREGTNFIMGSEVVFSCKEGYELIGSSQLTCTEEGFWKQDVPYCKA---LSCPHPTLPKYGILKGAN---FTYGSKVTFSCEKGYV-PLEP-IESQCQSDLKWSREPHICQPITCG--EPPVVDYAEYTLNGKIYRSTLSYTCIEGYRLQGAME--------LQCESSGEWTSPPPMCARVDCGKPPPLKDAVIKGDNFTLGSKIYYICKDGYTLLGAETQECLPSGNWTRNSSQCVPRSCGPPPQVDHALPDTGHQLFGDIAIYFCDDGYT-AGNNTKLFC----NAQGVWAPPDGFGIPHCIANFCQRPPDLPH---AILDSINKPKYASNTEVSYKCEEGFVLNTTGTLKCLIGGEWTPSPSDIGCMPVRCS-KPESIEKGYVSGNNYGFGAVIAYSCDKGYFIRGEKKRICKAS---------GEWGGVLPT--CQPISCPSPPRLANG--FIQGQIRKNSY-------VYNSKVTYACNDGYRLTGKPERTCMANKQWS 2255          

HSP 3 Score: 115.931 bits (289), Expect = 4.747e-26
Identity = 133/522 (25.48%), Postives = 209/522 (40.04%), Query Frame = 3
Query:  378 CMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQF-CNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAI---CTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCL-LHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYEL--NSDILPACYNGSW-NFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTK-MPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWS 1916
            CM +  +C  P     G+ + +    G  + Y+C  GY ++G +KR C+A+    G  P C  Q   C S P +    +     ++ +     V   C +GY    K       N      + + C   +C    D KNG  +Y+ +       ++F CN+G+++   T           C   G W  D +I   C+ + CPE    EN  V+   ++ +      C+EGY LHG+   +CT    W+ S   C    CGPPPE+ F   +   +  G+   Y C    TL  E S + C    N S    KP P+C+ + C            H  +     +    + + +     C  GY++  NS +L    +G W   IP C    C+A P  +   +VR+  L+      Y+C  GY    R  G ETL+ +       G W +  PT  C P  C+ P    NG  ++ G+  +  +T           + Y C P + L G     C +  WS
Sbjct: 2141 CMPV--RCSKPESIEKGYVSGNNYGFGAVIAYSCDKGYFIRGEKKRICKASGEWGGVLPTC--QPISCPSPPRLANGFIQGQIRKNSYVYNSKVTYACNDGYRLTGKPERTCMANKQWSNSNSLVCVLLTCPTPPDIKNG--LYHGSTFEVGSKVEFVCNEGYELIGDT--------VWTCLKFGNW--DKSIIPRCSPVQCPEPPLEENHLVLRGLDSDSGTVELSCEEGYVLHGARTLRCTPSQEWNDSFPVCKQVFCGPPPEVAFGDPSDTQSYFGSVVTYSCMDGFTLRKEGS-VHCQANGNWS----KPYPQCIPVECP-----------HPEDIPNGIVDVQGLMYLSTAVYSCKAGYDILGNSTVLCG-QSGQWIGGIPVCHPVKCAA-PKEIPNGSVRYSKLQFSQSITYFCQRGY----RIQGPETLTCL-----ENGQWDQEAPT--CVPIYCSPPKPIDNG--FVEGRDRKFGVT-----------IFYSCFPGFLLVGNNHLTCEDHGWS 2604          

HSP 4 Score: 107.842 bits (268), Expect = 1.923e-23
Identity = 129/535 (24.11%), Postives = 197/535 (36.82%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPEN---GEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCL---LHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYN-GSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCEFIMHDELPI 1967
            + + C  P    NG          + + Y C SG+ L+G   R CQ + +     P C + +  C      P          DD   G+ +   C  G+       I+   NG+ W   P KC   +CG+    +NGR +   +Y Y  +    C+ G+ +          N    C+ADG W      C  I C    PPE+   G + G     + I  + C  GY++ GS + +C  EG W G    C    C  PP   +  +     T GA   ++C     ++G +  +     D    W P   P C        P  V +A +       +T + + D VT+      +C  GY L      +C   G W       E      PP +  +      L + S A+Y C  G+ +A + D +   S         G W+K     C+P               L        +T K + P+   V+   C P Y L+GP ++ C ++G WSPP       I    LPI
Sbjct: 2746 LPISCGNPGGIANGEVIGKSFHFKELIHYECHSGFVLEGVETRTCQVDGKWDNKAPLCKEVS--CGR----PVVSKDVLVRGDDHTFGKRLLFSCNLGFILLGAPTIVCLANGS-WNEVPPKCLPANCGQPPSIENGR-VTGTDYGYNGMVRYACDIGYVLT--------GNPTLICRADGLWDDPPPRCDIITC---DPPEDISHGYLNGSSFNFDDIVEYICFPGYEVVGSPILRCAAEGVWLGQVPECRPCVCS-PPVFKYGSILGRDHTCGASIWFRCDDGYKILGSSEAI----CDKGGVWSPG-VPICTRGRCSIPPPAVPNAVI-----QGSTAYTI-DTVTY------RCRPGYHLKGFPHISCGRLGRWGEPNLSCEPISCGVPPLISNAETVGAVLTYGSKAQYRCKEGFELATKTDSITCQS--------DGTWSKHGVR-CRPS-----------PCTLPTNLTHVVITGKQLTPVGGTVI-VSCRPGYYLEGPGLSECTVSGKWSPPLASCLPVICEKPLPI 3222          

HSP 5 Score: 98.9821 bits (245), Expect = 9.525e-21
Identity = 92/380 (24.21%), Postives = 141/380 (37.11%), Query Frame = 3
Query:  375 VCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIA---IQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWN 1502
            +C        PP  P N     S     D V Y C+ GY LKG     C    R    EP  + +   C   P I   +            G   +  C+ G+E   K+  I   +   W    ++C    C               N T+  I    +        + C    + +     +C   GKWS   A C  ++C +  P  NG V G+      +  F C++G+ L G  +R C  +  W G+   C   +CGPPP +  A  +    T+ +   Y C+  ++L+ ++  LTC    N S  LP P  +    C+    D     + E+N          ++ G  +   CN GY L  + L  C  NGSW+
Sbjct: 3033 ICTRGRCSIPPPAVP-NAVIQGSTAYTIDTVTYRCRPGYHLKGFPHISCGRLGRWG--EPNLSCEPISCGVPPLISNAETVGAV----LTYGSKAQYRCKEGFELATKTDSITCQSDGTWSKHGVRCRPSPC-----------TLPTNLTHVVITGKQLTPVGGTVIVSCRPGYYLEGPGLSECTVSGKWSPPLASCLPVICEKPLPILNGLVEGISYNYGDVVNFTCQQGFLLQGHSVRTCQGDKTWSGTQPVCAAVSCGPPPVVPNAVASSSGQTYKSIVSYTCRQGTSLV-DSQNLTCQA--NGSWSLPTPICEVPGGCEKI-TDLLNGKVQEHN----------LSSGRALEFHCNKGYTLQGESLVMCVGNGSWS 3380          

HSP 6 Score: 90.8929 bits (224), Expect = 3.317e-18
Identity = 134/569 (23.55%), Postives = 201/569 (35.33%), Query Frame = 3
Query:  399 CQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPE--NGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVD--NKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTH-GTHVRAKCNFGYELNSDILPAC-YNGSWNF-IPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYI----------------------------------ALRKDGMETLSTIFDIKCNKG---------------NWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHN----RVVKYECHPLYRLKGPKIAVCL-NGHWSPP 1922
            C  P    NG    +       V Y C  GY L G     C+A+       P C    D+    P  P    H   N   F   + V+ IC  GYE    S I+       W     +C    C      K G  +  ++    SI  + C+DG+KI  +++   DK         G WS    ICT   C  + PP   N  + G         T++C+ GY L G     C R G W   N +C   +CG PP I  A+      T+G++A+Y+CK    L  +T  +TC      +K G   +P P C L                 N T   I   ++T  G  V   C  GY L    L  C  +G W+  +  C+   C  +P  +    V  +S  +  +  + C  G+ +                                  A+     +T  +I    C +G               +W+ +PT  C+                  G    T L +  ++  HN    R +++ C+  Y L+G  + +C+ NG WS P
Sbjct: 2866 CGQPPSIENGRVTGTDYGYNGMVRYACDIGYVLTGNPTLICRADGLWDDPPPRC----DIITCDP--PEDISHGYLNGSSFNFDDIVEYICFPGYEV-VGSPILRCAAEGVWLGQVPECRPCVCSPPVF-KYGSILGRDHTCGASIWFR-CDDGYKILGSSEAICDKG--------GVWSPGVPICTRGRC-SIPPPAVPNAVIQGSTAYTIDTVTYRCRPGYHLKGFPHISCGRLGRWGEPNLSCEPISCGVPPLISNAETVGAVLTYGSKAQYRCKEGFELATKTDSITCQSDGTWSKHGVRCRPSP-CTL---------------PTNLTHVVITGKQLTPVGGTVIVSCRPGYYLEGPGLSECTVSGKWSPPLASCLPVICE-KPLPILNGLVEGISYNYGDVVNFTCQQGFLLQGHSVRTCQGDKTWSGTQPVCAAVSCGPPPVVPNAVASSSGQTYKSIVSYTCRQGTSLVDSQNLTCQANGSWS-LPTPICEVPG---------------GCEKITDLLNGKVQE-HNLSSGRALEFHCNKGYTLQGESLVMCVGNGSWSSP 3382          

HSP 7 Score: 70.0922 bits (170), Expect = 9.060e-12
Identity = 109/506 (21.54%), Postives = 178/506 (35.18%), Query Frame = 3
Query:  240 HVKSLDNVKHLPNGCPSKACTANIDCWVEYDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLV--GDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKC-------------EKKSCGKLED----------PKNGRT-----------------MYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNF-IPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGY 1625
            +V +   ++ L + CP      N+  W ++         +    + C +  L     V+    H   S   V  G +V+++C  G+ L G   + C    + S +EP C  +   C   P + + Q H     +DF  G  V   C+ G+    +S +    NG +W  +P  C             E  SC   +             +GR                      N+   S  +  C +G+++  ++        +  C  +G W  D   C A+ CP  + P+ G + G   T  S  TF C++GY        +C  +  W      C    CG PP + +A+       + +   Y C     L G    L C      SG    P P C       +VD  K    ++      I  D  T G+ +   C  GY L       C  +G+W     +CV  +C   PP + ++           +A Y+C  GY
Sbjct: 1582 YVLTPQQIRSLASSCPHDLQKGNVFAWPDFLGGVTGRVKTTSKSIFCADCPL-----VETSVPHLLSSSKAVSPGSKVQFSCSPGFYLVGEPVQLCLNRGQWSHAEPIC--ERVECGPPPDLEHGQYHG----EDFYAGSSVLYQCKPGFYLLGESKMQCTNNG-KWIGNPPACLDVDECSLGSECDEHASCQNTDGSHICTCIAPYSGDGRNCTEPVKCKDPGVPEFGQREGTNFIMGSEVVFSCKEGYELIGSS--------QLTCTEEGFWKQDVPYCKALSCPHPTLPKYGILKGANFTYGSKVTFSCEKGYVPLEPIESQCQSDLKWSREPHICQPITCGEPPVVDYAEYTLNGKIYRSTLSYTCIEGYRLQGAME-LQC----ESSGEWTSPPPMCA------RVDCGKPPPLKD----AVIKGDNFTLGSKIYYICKDGYTLLGAETQECLPSGNWTRNSSQCVPRSCGP-PPQVDHALPDTGHQLFGDIAIYFCDDGY 2051          

HSP 8 Score: 65.0846 bits (157), Expect = 2.701e-10
Identity = 54/189 (28.57%), Postives = 81/189 (42.86%), Query Frame = 3
Query:  954 CTAILCPELSPPENGEVMG--VWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCG--PPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCL-LHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWN 1502
            C A++CP LSPPENG  +     N  NS    +C  G+ L G  +R C  +G W G   +C +R+C    PP       +  +  +  +   +C+    L G    +TC      SG    P+P+C+ + C P        +IH    T      +EV  G   +  C +GY L  D    C   G+W+
Sbjct:  368 CQAVVCPVLSPPENGFFIQNVCNNQFNSACGVRCLPGFDLQGDGIRLCQPDGTWSGVQPSCRIRSCPDLSPPHHGMLNCSERSAPYRLECLVRCEQGYRLQGRAR-ITCLANSQWSG----PQPRCVEVRCPPIVTLK---HIHLMPSTCG---ENEVRTGAVCQLSCPYGYSLIGDSKVKCLPTGNWS 545          

HSP 9 Score: 62.7734 bits (151), Expect = 1.680e-9
Identity = 74/329 (22.49%), Postives = 128/329 (38.91%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTF------KCKEGYQLH-----GSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPK--CLLHCK 1334
            + + C+ P+  +NG         GD V +TC+ G+ L+G   R CQ +   SG++P C   +  C   P +P      +S+   +K+   V   C+ G       ++  + NG+     PI      C K+ D  NG+   +N  + +++    CN G+ +Q              C  +G WS    +C         P  +G  +G  N   ++ +        C +G ++      G     C  +  W   ++ C   +CGPP  +    V       G    Y C +  T+ G +  +    +DN + W   P  K  C  HC+
Sbjct: 3212 LPVICEKPLPILNGLVEGISYNYGDVVNFTCQQGFLLQGHSVRTCQGDKTWSGTQPVCAAVS--CGPPPVVPNAVA--SSSGQTYKS--IVSYTCRQGTSLVDSQNLTCQANGSWSLPTPICEVPGGCEKITDLLNGKVQEHNLSSGRALEFH-CNKGYTLQ--------GESLVMCVGNGSWSSPFPVCLPK---PCPPLPHGWTVGSANATQTVFSVGQSVQVSCPKGQRVKSNQGKGIATLTCRSDQTWTPISAVCERVSCGPPLYVSNGVVRGAVFQFGDMVLYSCYAGFTMEGSSRSVC---LDNGT-WTQPPTCKAVCWRHCQ 3518          

HSP 10 Score: 58.5362 bits (140), Expect = 3.372e-8
Identity = 49/181 (27.07%), Postives = 71/181 (39.23%), Query Frame = 3
Query:  753 CEKKSCGKLEDPKNGRTMYNN-NYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTF------KCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATT-------HGAQAEYKCKSRSTLIGET 1253
            C+   C  L  P+NG  + N  N  + S     C  GF +Q         +  R CQ DG WSG    C    CP+LSPP +    G+ N       +      +C++GY+L G     C     W G    C+   C  PP +    +    +T        GA  +  C    +LIG++
Sbjct:  368 CQAVVCPVLSPPENGFFIQNVCNNQFNSACGVRCLPGFDLQ--------GDGIRLCQPDGTWSGVQPSCRIRSCPDLSPPHH----GMLNCSERSAPYRLECLVRCEQGYRLQGRARITCLANSQWSGPQPRCVEVRC--PPIVTLKHIHLMPSTCGENEVRTGAVCQLSCPYGYSLIGDS 534          
BLAST of C4b binding protein beta chain vs. Ensembl Zebrafish
Match: csmd3a (CUB and Sushi multiple domains 3a [Source:ZFIN;Acc:ZDB-GENE-050419-118])

HSP 1 Score: 120.168 bits (300), Expect = 2.363e-27
Identity = 115/426 (27.00%), Postives = 158/426 (37.09%), Query Frame = 3
Query:  378 CMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECT-DQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLR--KCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFI-PRCVEAACSA--RPPSMKYSTV-RFLSLKHDSLARYYCHFGYYI 1631
            C+ +D  C  P  P NG  +      G  V Y+C  G  LKG   R CQ N   S   P C+ D +  C      P T  H + +  DF+    V   C  GYE       +   NG  W      C+   CG    P NGR    +  T+    I  C DG+ +  +T         RQCQA+G WSG    CT I C E   P NG   G   T+    TF C+ GY +         CT  G W+     C    C  PP I    +       G    Y C S    +   + LTC      SG +P+        C P            + +  +FI   EV+        C   Y         C  +G+W+   PRC+E   +    P + +Y ++ R    K  S+  + C  G+ +
Sbjct: 2716 CIVVD--CGHPGSPPNGLLSGDKFTFGATVRYSCTGGRQLKGESSRTCQLNGHWSAPMPFCSGDSSGTCGD----PGTPSHGSRDESDFRIRSKVHFSCSVGYELFGSVERMCFPNGT-WSGTQPSCKPVQCGNPGTPSNGRVYRLDGTTFSHSVIYSCMDGYLLSGST--------TRQCQANGTWSGTAPNCTLINCGEPGVPANGLRYGEDFTIAQNITFMCQPGYTMEAESFSTITCTGNGTWNAPVPFCKAVTCTAPPPISNGLLEGRDFEWGTSVSYSC-SPGYELSFPAILTCVGNGTWSGEVPQ--------CLPKFCGDPGTPAFGSREGRSFIYQSEVSF------SCMAPYIPVGSTTRICQTDGTWSGSQPRCIEPTRTTCENPGTPRYGSLNRTFGFKVGSMVAFQCQPGHLL 3111          

HSP 2 Score: 109.768 bits (273), Expect = 4.208e-24
Identity = 141/548 (25.73%), Postives = 208/548 (37.96%), Query Frame = 3
Query:  369 GLVCMEIDLQCQPPVQPVNGH-ANHSILLVGDQVEYTCKSGYALKGPRKRYCQAN----LRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EW-------KYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWS--GDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF-IPRCVEAACSARPPSMKYSTVRFLSLKH-----DSLARYYCHFGYYIALRKDGMETLSTIFDIKCN-KGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCE 1940
            G     + L C  P  P++G  ++ +   +   V +TC  GY L G     C+             P C  Q   C     +P   V+      D+  G  V   C +GY    K    A C  +  W       +   + C       LE  +  R +  ++Y Y++  I  C+ G+        +       QC A+G WS   +   C  I C +L+ P +G+ +G   +  +   F C  GY L GS +R+C   G W G+ + C+  +CG P +IV  +V  E   +     Y+C S   LIG +S   C +  N SG LP         C P         I+       F ++D V+        CN GY +       C  N  W+   P C    CS   P +  +++R   ++H      ++  Y C+ GYY+     G   L+      C   G W K P   C    C  P +P NG +                K      V+Y C    +LKG     C LNGHWS P MP C 
Sbjct: 2285 GFSIRYVALYCSTPDSPLHGSISSQTGGHLNSLVRWTCDRGYRLIGKSTAVCKKTPFGFYDWDAPVPAC--QAVSC----GVPKAPVNGGVLAMDYSVGTRVTYFCSDGYRLSSKELTSAVCQPDGTWSNHNKVPRCSVVVCPSIGSFSLEHGR-WRIVNGSHYEYRTKIIFTCDPGY--------YRLGPAYIQCMANGAWSWKNERPHCQIISCGDLATPPSGKKIGTQTSFGATAIFTCDNGYMLVGSSVRECLSSGLWSGTETRCLAGHCGLPEQIVNGQVIGENFGYRDTVVYQCVSGFRLIG-SSVRICQQDHNWSGQLPI--------CVPISCGHPGSPIYGRTIGNGFNLNDVVSF------SCNMGYVMEGPSRAQCQANRQWSQPPPTCKVVNCSD--PGIPANSIRQSKIEHGNFTFGTVVFYDCNPGYYLF----GSPVLT------CQPTGQWDK-PLPECIVVDCGHPGSPPNGLL-------------SGDKFTFGATVRYSCTGGRQLKGESSRTCQLNGHWSAP-MPFCS 2775          

HSP 3 Score: 97.8265 bits (242), Expect = 2.125e-20
Identity = 105/444 (23.65%), Postives = 168/444 (37.84%), Query Frame = 3
Query:  336 AQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNS-NRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAIC---TAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKV-AYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKC-LLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY---NGSWNF-IPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIAL 1637
             ++C  D    G + + + + C  P  P+ G    +   + D V ++C  GY ++GP +  CQAN + S   P C  +   C S P IP   +  +     +F  G  V   C  GY   + S ++      +W     +C    CG    P NG  +  + +T+ +     C  G +++            R CQ +G WS     C   ++  C +   P +G        + S   F C  GY+L GS  R C   G W G+  +C    CG P      +V   + TT      Y C     L G T+   C      SG      P C L++C    V +  +   E           + T   ++   C  GY + ++         NG+WN  +P C    C+A PP +    +     +  +   Y C  GY ++ 
Sbjct: 2580 VRICQQDHNWSGQLPICVPISCGHPGSPIYGRTIGNGFNLNDVVSFSCNMGYVMEGPSRAQCQANRQWSQPPPTC--KVVNC-SDPGIPANSIRQSKIEHGNFTFGTVVFYDCNPGYYL-FGSPVLTCQPTGQWDKPLPECIVVDCGHPGSPPNG-LLSGDKFTFGATVRYSCTGGRQLK--------GESSRTCQLNGHWSAPMPFCSGDSSGTCGDPGTPSHGSRDESDFRIRSKVHFSCSVGYELFGSVERMCFPNGTWSGTQPSCKPVQCGNPGTPSNGRVYRLDGTTFSHSVIYSCMDGYLLSGSTT-RQCQANGTWSG----TAPNCTLINCGEPGVPANGLRYGE-----------DFTIAQNITFMCQPGYTMEAESFSTITCTGNGTWNAPVPFCKAVTCTA-PPPISNGLLEGRDFEWGTSVSYSCSPGYELSF 2993          

HSP 4 Score: 91.2781 bits (225), Expect = 2.342e-18
Identity = 105/422 (24.88%), Postives = 162/422 (38.39%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENG----EVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFI-PRCVEAACS--ARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIA 1634
            + C     P +G    +    G    +TC +GY L G   R C ++   SG+E  C      C     +P   V+     ++F   + V   C +G+     S  I + + N     PI C   SCG    P  GRT+  N +    +    CN G+ ++  +        R QCQA+ +WS     C  + C +   P N     ++     T  ++  + C  GY L GS +  C   G WD     CIV +CG P       ++ +  T GA   Y C     L GE+S  TC      +G    P P C         D      H +   ++F +  +      V   C+ GYEL   +   C+ NG+W+   P C    C     P + +   +   +  H  +  Y C  GY ++
Sbjct: 2483 ISCGDLATPPSGKKIGTQTSFGATAIFTCDNGYMLVGSSVRECLSSGLWSGTETRCL--AGHC----GLPEQIVNGQVIGENFGYRDTVVYQCVSGFRLIGSSVRICQQDHNWSGQLPI-CVPISCGHPGSPIYGRTI-GNGFNLNDVVSFSCNMGYVMEGPS--------RAQCQANRQWSQPPPTCKVVNCSDPGIPANSIRQSKIEHGNFTFGTVVFYDCNPGYYLFGSPVLTCQPTGQWDKPLPECIVVDCGHPGSPPNGLLSGDKFTFGATVRYSCTGGRQLKGESS-RTC----QLNGHWSAPMPFCSGDSSGTCGDPGTPS-HGSRDESDFRIRSK------VHFSCSVGYELFGSVERMCFPNGTWSGTQPSCKPVQCGNPGTPSNGRVYRLDGTTFSHSVI--YSCMDGYLLS 2874          

HSP 5 Score: 90.1225 bits (222), Expect = 5.240e-18
Identity = 145/599 (24.21%), Postives = 211/599 (35.23%), Query Frame = 3
Query:  228 KPECHVKSLDNVKHLPNG-----CPSKACTANIDCWVEY----DRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGY--EDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNG---RTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCI---VRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTL-----IGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWN-FIPRCVEAACSARPPSMKYSTVRF---LSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWSPPQMPTC 1937
            +P C + S  ++   P+G       S   TA   C   Y       + C+      G     +   C  P Q VNG          D V Y C SG+ L G   R CQ +   SG  P C   +  C      P + ++  +  + F   + V   C  GY  E P +    A+C  N +W   P  C+  +C     P N      + + N+T+ ++    CN G+ +  +            CQ  G+W      C  + C     P NG + G   T  +   + C  G QL G   R C   G+W      C       CG P             +HG++ E   + RS +     +G   F +   +   +G     +P C    KP Q  +       N +       D  T    V   C  GY L+      C  NG+W+   P C    C    P +  + +R+    ++  +    + C  GY +       E+ STI    C        P   C+   CT PP   NG   LL   D    T           V Y C P Y L  P I  C+ NG WS  ++P C
Sbjct: 2477 RPHCQIISCGDLATPPSGKKIGTQTSFGATAIFTCDNGYMLVGSSVRECLSSGLWSGTETRCLAGHCGLPEQIVNGQVIGENFGYRDTVVYQCVSGFRLIGSSVRICQQDHNWSGQLPICVPIS--CGH----PGSPIYGRTIGNGFNLNDVVSFSCNMGYVMEGPSR----AQCQANRQWSQPPPTCKVVNCSDPGIPANSIRQSKIEHGNFTFGTVVFYDCNPGYYLFGSP--------VLTCQPTGQWDKPLPECIVVDCGHPGSPPNGLLSGDKFTFGATVRYSCTGGRQLKGESSRTCQLNGHWSAPMPFCSGDSSGTCGDP----------GTPSHGSRDESDFRIRSKVHFSCSVGYELFGSVERMCFPNGTWSGTQPSC----KPVQCGNPGT--PSNGRVYRL---DGTTFSHSVIYSCMDGYLLSGSTTRQCQANGTWSGTAPNCTLINCGE--PGVPANGLRYGEDFTIAQN--ITFMCQPGYTME-----AESFSTI---TCTGNGTWNAPVPFCKAVTCTAPPPISNG---LLEGRDFEWGTS----------VSYSCSPGYELSFPAILTCVGNGTWS-GEVPQC 3012          

HSP 6 Score: 81.2629 bits (199), Expect = 3.063e-15
Identity = 79/313 (25.24%), Postives = 115/313 (36.74%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPR--KRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAIC---TAILCPELSPPENGEVMGVWN-TVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCG---PPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLP 1301
            + C  P  P NG        +   + + C+ GY ++        C  N   +   P C   T  C + P I    +       DF+ G  V   C  GYE  + +  I  C GN  W  +  +C  K CG    P  G +    ++ YQS             C        +  R CQ DG WSG    C   T   C     P  G +   +   V S+  F+C+ G+ L GS  R C  +  W G+   CI  +C     PP +    V  +  ++G    Y C+S   L G +    C      +G +P
Sbjct: 2897 INCGEPGVPANGLRYGEDFTIAQNITFMCQPGYTMEAESFSTITCTGNGTWNAPVPFCKAVT--CTAPPPISNGLLEGR----DFEWGTSVSYSCSPGYELSFPA--ILTCVGNGTWSGEVPQCLPKFCGDPGTPAFG-SREGRSFIYQSEV--------SFSCMAPYIPVGSTTRICQTDGTWSGSQPRCIEPTRTTCENPGTPRYGSLNRTFGFKVGSMVAFQCQPGHLLQGSTTRLCQADLTWSGTQPECIPHSCKQPESPPHV--DVVGMDLPSYGYTLIYSCQSGFFLSGGSEHRVCRSDGTWTGKMP 3190          

HSP 7 Score: 62.003 bits (149), Expect = 2.741e-9
Identity = 65/259 (25.10%), Postives = 92/259 (35.52%), Query Frame = 3
Query:  378 CMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKI------QCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGV-WNTVNSIKTFKCKEGYQLHG-SHLRKCTREGNWDGSNSTC 1130
            C  +     PP+   NG         G  V Y+C  GY L  P    C  N   SG  P+C  +   C      P T    +     F    +V   C   Y     +  I + +G  W     +C + +    E+P   R        Y S+   F   GFK+      QC        +  R CQAD  WSG    C    C +   P + +V+G+   +      + C+ G+ L G S  R C  +G W G    C
Sbjct: 2954 CKAVTCTAPPPIS--NGLLEGRDFEWGTSVSYSCSPGYELSFPAILTCVGNGTWSGEVPQCLPK--FCGD----PGTPAFGSREGRSFIYQSEVSFSCMAPYIPVGSTTRICQTDGT-WSGSQPRCIEPTRTTCENPGTPR--------YGSLNRTF---GFKVGSMVAFQCQPGHLLQGSTTRLCQADLTWSGTQPECIPHSCKQPESPPHVDVVGMDLPSYGYTLIYSCQSGFFLSGGSEHRVCRSDGTWTGKMPVC 3192          

HSP 8 Score: 58.151 bits (139), Expect = 4.264e-8
Identity = 51/206 (24.76%), Postives = 79/206 (38.35%), Query Frame = 3
Query:  345 CVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRD-DFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAIC 956
            CV +    G V   +   C  P  P  G       +   +V ++C + Y   G   R CQ +   SGS+P C + T      P  P    + + NR   FK G  V   CQ G+    +      C  +  W     +C   SC + E P +   +  +  +Y    I  C  GF +   ++        R C++DG W+G   +C
Sbjct: 2999 CVGNGTWSGEVPQCLPKFCGDPGTPAFGSREGRSFIYQSEVSFSCMAPYIPVGSTTRICQTDGTWSGSQPRCIEPTRTTCENPGTPR---YGSLNRTFGFKVGSMVAFQCQPGHL--LQGSTTRLCQADLTWSGTQPECIPHSCKQPESPPHVDVVGMDLPSYGYTLIYSCQSGFFLSGGSEH-------RVCRSDGTWTGKMPVC 3192          
BLAST of C4b binding protein beta chain vs. Ensembl Zebrafish
Match: csmd3a (CUB and Sushi multiple domains 3a [Source:ZFIN;Acc:ZDB-GENE-050419-118])

HSP 1 Score: 109.768 bits (273), Expect = 4.214e-24
Identity = 97/337 (28.78%), Postives = 138/337 (40.95%), Query Frame = 3
Query:  657 VKIICQNGYEDPYKSHIIAKCNGNE-----WKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAI--CTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNG-SWNFIP---RCVEAACSARPP-SMKYSTVRFLSLKHDSLARYYCHFGYYI 1631
            V+  C  G+    K+  +A C   E     W      C+  SCG    P NG  +   +Y+  + A  FCNDGF++         +     CQADG WS    I  CT I C EL  P NG+ +G   T  +   F C  G+ L GS +R+C   G W G+ + C+  +CG P  IV  +V  E   +     Y+C     LIG +S   C +  N SG LP         C           I+       F ++D VT        CN GY L       C +   W+  P   R V       P  S++ S + + +    ++  Y C+ GYY+
Sbjct: 2439 VRWACDRGFRLIGKN--MAVCKRTEIGFLAWDSSVPACQAVSCGMPVAPVNGGVL-AADYSAGTRATYFCNDGFRLS------SKEVTSTVCQADGTWSSHNKIPRCTVISCGELPTPPNGKKIGTQTTFGATAIFTCNSGFILVGSTVRECLPSGLWSGTETHCLAGHCGIPERIVNGQVIGENFGYRDTVVYQCNPGFRLIG-SSVRICQQDHNWSGQLPS--------CVSISCGHPGSPIYGRTVGDGFNLNDVVTF------FCNKGYILEGPSEAQCQSDRQWSQHPPTCRVVNCTDPGIPANSIRKSKIEYGNFTFGTVVSYDCNPGYYL 2751          

HSP 2 Score: 105.145 bits (261), Expect = 1.143e-22
Identity = 144/534 (26.97%), Postives = 203/534 (38.01%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYAL--KGPRKRYCQANLRLSGSE--PECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKC-NGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCG----PPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFI-PRCV---EAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWT-KMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWSPPQMPTCEFI 1946
            + C  PV PVNG    +    G +  Y C  G+ L  K      CQA+   S     P CT  +  C   P  P  +      +  F  G      C +G+        + +C     W      C    CG  E   NG+ +   N+ Y+   +  CN GF++  ++         R CQ D  WSG    C +I C     P  G  +G    +N + TF C +GY L G    +C  +  W     TC V NC     P   I  +K+ Y   T G    Y C     L G +S LTC  V    G+  KP P+CL      +VD      H  +     +  D+ T G+ V  +C     L  +   AC  NG W    P C      AC   P +  ++T    S +  +  R+ C  G+ +    +          I    G W+ + PT  C+P +C  P TP NG           R++  S     + ++ Y C   YRL G     CL NG WS  + P C  I
Sbjct: 2477 VSCGMPVAPVNGGVLAADYSAGTRATYFCNDGFRLSSKEVTSTVCQADGTWSSHNKIPRCTVIS--CGELPTPPNGK--KIGTQTTF--GATAIFTCNSGFI--LVGSTVRECLPSGLWSGTETHCLAGHCGIPERIVNGQVI-GENFGYRDTVVYQCNPGFRLIGSS--------VRICQQDHNWSGQLPSCVSISCGHPGSPIYGRTVGDGFNLNDVVTFFCNKGYILEGPSEAQCQSDRQWSQHPPTCRVVNCTDPGIPANSIRKSKIEYGNFTFGTVVSYDCNPGYYLFG-SSVLTCQPV----GYWDKPLPECL------EVDCG----HPGSPPHAVVTGDKFTFGSTVHYRCLEDRVLIGESTRACQLNGQWGGSQPHCSGDKRGAC-GDPGTPAHATREESSFQQHAKVRFTCSTGHTLYGSAE---------RICFPNGTWSGRQPT--CKPVQCGNPGTPANG-----------RVSHVSGTTFSHSII-YSCVEGYRLSGSPTRQCLANGTWSGGE-PNCTLI 2953          

HSP 3 Score: 88.1965 bits (217), Expect = 2.513e-17
Identity = 128/529 (24.20%), Postives = 187/529 (35.35%), Query Frame = 3
Query:  396 QCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGY--EDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNG---RTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRN---CGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTH-VRAKCNFGYELNSDILPACY-NGSWNFI-PRCVEAACS-ARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWT-KMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWSPPQMPTC 1937
             C  P + VNG          D V Y C  G+ L G   R CQ +   SG  P C   +  C      P + ++  +  D F   + V   C  GY  E P +    A+C  + +W   P  C   +C     P N      +   N+T+ ++    CN G+ +  ++           CQ  G W      C  + C     P +  V G   T  S   ++C E   L G   R C   G W GS   C       CG P     A     +    A+  + C +  TL G    + C      SG  P         CKP Q        +        + H   T  +H +   C  GY L+      C  NG+W+   P C   +C  +  P+    T    ++ H+    Y C  G+        ME  S+      + G W+  +P+  CQ   C+ PP   NGE+          + +  +       V Y C   Y L  P +  C  NG WS  ++P C
Sbjct: 2598 HCGIPERIVNGQVIGENFGYRDTVVYQCNPGFRLIGSSVRICQQDHNWSGQLPSCVSIS--CGH----PGSPIYGRTVGDGFNLNDVVTFFCNKGYILEGPSE----AQCQSDRQWSQHPPTCRVVNCTDPGIPANSIRKSKIEYGNFTFGTVVSYDCNPGYYLFGSS--------VLTCQPVGYWDKPLPECLEVDCGHPGSPPHAVVTGDKFTFGSTVHYRCLEDRVLIGESTRACQLNGQWGGSQPHCSGDKRGACGDPGTPAHATREESSFQQHAKVRFTCSTGHTLYGSAERI-CFPNGTWSGRQPT--------CKPVQCG------NPGTPANGRVSHVSGTTFSHSIIYSCVEGYRLSGSPTRQCLANGTWSGGEPNCTLISCGDSGVPASGLRTGEDFTVGHN--VSYSCQPGFM-------MENGSSAIRTCTHNGTWSGSLPS--CQAVTCSPPPAVSNGEV-------EGSVFEWGVS------VSYRCMMGYELSFPAVLTCAGNGSWS-GEIPLC 3068          

HSP 4 Score: 87.4261 bits (215), Expect = 3.990e-17
Identity = 104/446 (23.32%), Postives = 164/446 (36.77%), Query Frame = 3
Query:  336 AQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPEC--TDQTDLCFSAPYIPYTQVHDNS-NRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTA---ILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAY-EATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKC-LLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYEL---NSDILPACYNGSWN-FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIAL 1637
             ++C  D    G +   + + C  P  P+ G        + D V + C  GY L+GP +  CQ++ + S   P C   + TD     P IP   +  +     +F  G  V   C  GY   + S ++       W     +C +  CG    P +   +  + +T+ S            +C  D+       R CQ +G+W G    C+      C +   P +          ++   F C  G+ L+GS  R C   G W G   TC    CG P      +V++   TT      Y C     L G  +   C      SG     EP C L+ C    V ++ +   E           + T G +V   C  G+ +   +S I    +NG+W+  +P C    CS  PP++    V     +      Y C  GY ++ 
Sbjct: 2636 VRICQQDHNWSGQLPSCVSISCGHPGSPIYGRTVGDGFNLNDVVTFFCNKGYILEGPSEAQCQSDRQWSQHPPTCRVVNCTD-----PGIPANSIRKSKIEYGNFTFGTVVSYDCNPGYYL-FGSSVLTCQPVGYWDKPLPECLEVDCGHPGSPPHA-VVTGDKFTFGSTV--------HYRCLEDRVLIGESTRACQLNGQWGGSQPHCSGDKRGACGDPGTPAHATREESSFQQHAKVRFTCSTGHTLYGSAERICFPNGTWSGRQPTCKPVQCGNPGTPANGRVSHVSGTTFSHSIIYSCVEGYRLSGSPT-RQCLANGTWSGG----EPNCTLISCGDSGVPASGLRTGE-----------DFTVGHNVSYSCQPGFMMENGSSAIRTCTHNGTWSGSLPSCQAVTCSP-PPAVSNGEVEGSVFEWGVSVSYRCMMGYELSF 3049          

HSP 5 Score: 83.5741 bits (205), Expect = 6.314e-16
Identity = 81/322 (25.16%), Postives = 122/322 (37.89%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANH-SILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQF-CNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCI---VRNCGPPPEIVFAKV-AYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLH-CK 1334
            +QC  P  P NG  +H S       + Y+C  GY L G   R C AN   SG EP CT    +      +P + +      +DF  G +V   CQ G+     S  I  C  N  W      C+  +C       NG      +     +++ + C  G+++               C  +G WSG+  +C    C +   P      G      +   F C   Y L GS  R C  +  W G+   CI      C  P    F  + +      G+  ++ C++   L+G T+  TC +    SG     +P+C+ H CK
Sbjct: 2894 VQCGNPGTPANGRVSHVSGTTFSHSIIYSCVEGYRLSGSPTRQCLANGTWSGGEPNCTL---ISCGDSGVPASGLRTG---EDFTVGHNVSYSCQPGFMMENGSSAIRTCTHNGTWSGSLPSCQAVTCSPPPAVSNGEV--EGSVFEWGVSVSYRCMMGYELSFP--------AVLTCAGNGSWSGEIPLCLPKFCGDPGIPSRARREGQSFIFKAEVMFSCSAPYVLVGSSTRTCQADATWSGTQPRCIEPTRTTCENPGTPEFGSLNSSLGFKVGSTVKFVCQTGHLLLGSTT-RTCQQDLTWSG----SQPECIPHSCK 3194          

HSP 6 Score: 82.8037 bits (203), Expect = 1.082e-15
Identity = 79/310 (25.48%), Postives = 120/310 (38.71%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRK--RYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAIC---TAILCPELSPPENGEV-MGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKV-AYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLP 1301
            + C     P +G        VG  V Y+C+ G+ ++      R C  N   SGS P C  Q   C   P +   +V  +     F+ G  V   C  GYE  + + +    NG+ W  +   C  K CG    P   R     ++ +++  +  C+  + +  ++         R CQAD  WSG    C   T   C     PE G +   +   V S   F C+ G+ L GS  R C ++  W GS   CI  +C  P     A V   +  + G    Y C+    L G +    C    + +G +P
Sbjct: 2953 ISCGDSGVPASGLRTGEDFTVGHNVSYSCQPGFMMENGSSAIRTCTHNGTWSGSLPSC--QAVTCSPPPAVSNGEVEGSV----FEWGVSVSYRCMMGYELSFPAVLTCAGNGS-WSGEIPLCLPKFCGDPGIPSRARRE-GQSFIFKAEVMFSCSAPYVLVGSS--------TRTCQADATWSGTQPRCIEPTRTTCENPGTPEFGSLNSSLGFKVGSTVKFVCQTGHLLLGSTTRTCQQDLTWSGSQPECIPHSCKQPKTPPHANVLGMDLPSFGYTLLYSCQPGFILTGGSEHRACRPDGSWTGKVP 3246          

HSP 7 Score: 62.3882 bits (150), Expect = 2.144e-9
Identity = 46/215 (21.40%), Postives = 82/215 (38.14%), Query Frame = 3
Query:  321 VEYDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTA 962
            + +     C  +    G + + +   C  P  P          +   +V ++C + Y L G   R CQA+   SG++P C + T      P  P  +    ++   FK G  VK +CQ G+           C  +  W     +C   SC + + P +   +  +  ++    +  C  GF +   ++        R C+ DG W+G   +C A
Sbjct: 3047 LSFPAVLTCAGNGSWSGEIPLCLPKFCGDPGIPSRARREGQSFIFKAEVMFSCSAPYVLVGSSTRTCQADATWSGTQPRCIEPTRTTCENPGTP--EFGSLNSSLGFKVGSTVKFVCQTGHL--LLGSTTRTCQQDLTWSGSQPECIPHSCKQPKTPPHANVLGMDLPSFGYTLLYSCQPGFILTGGSEH-------RACRPDGSWTGKVPVCRA 3250          
BLAST of C4b binding protein beta chain vs. Ensembl Zebrafish
Match: csmd2 (CUB and Sushi multiple domains 2 [Source:ZFIN;Acc:ZDB-GENE-030616-39])

HSP 1 Score: 108.227 bits (269), Expect = 1.588e-23
Identity = 115/446 (25.78%), Postives = 171/446 (38.34%), Query Frame = 3
Query:  399 CQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAK-CNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTY-QSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAK-VYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFI-PRCVEAACS--ARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMP 1712
            C  P  PV+G         G  V ++C+ GY LKG  +R C AN    G +PEC   +      P     Q HD            +   C+ GY   Y + ++ + C  N  W  D  +C   +CG    P NG  +  +++TY  S++ Q C+ GF +        D+     C  D  W+G   +C AI+C       NG+V+G      S  ++ C +GYQL    +  C   GNW G    C    CG P      K      T+ +   + C     L+G              G     +P C+       VD    ++ H+NN     I       G+ V   C  G+ L   I   C  N +W+ + P C+   C+    P       +   SL +  +  Y C  G+Y+A    G E  +   D     G+WT  P
Sbjct: 2938 CGDPGIPVHGIRLGEEFTTGSVVRFSCEPGYQLKGSSERTCLANGSWVGIQPECHVVSCGNPGTPRNAMIQFHDG-----LVFSRSITYSCREGY---YSTGLLTRHCTVNGTWTGDMPECTVINCGDPGVPANGIRL-GSDFTYSHSVSFQ-CSPGFTMDA------DRASTLICTKDRTWNGTKPVCKAIVCAAPPSIPNGQVVGSDFQWGSSISYSCNQGYQLSLPTILTCQGSGNWSGERPQCFPVFCGDPGIPAQGKREDRGFTYLSSVSFSCYPPLILVGSAR-----RYCQYDGTWSGTQPSCIDPSHTSCVDPGTPLFGHQNNSQGYQI-------GSSVYYSCRKGHLLLGSISRTCLPNLTWSGMQPECIAHHCNQPELPAQADVGAIELPSLGYTLI--YTCQPGFYLA---GGSEHRTCRAD-----GSWTGKP 3345          

HSP 2 Score: 99.7525 bits (247), Expect = 5.982e-21
Identity = 136/581 (23.41%), Postives = 204/581 (35.11%), Query Frame = 3
Query:  399 CQPPVQPVNGHA-NHSILLVGDQVEYTCKSGYALKGPRKRYC----QANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPI----KCEKKSCGKLE----DPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWS--GDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSW-NFIPRCVEAACSARPPSMKYSTVRFL------SLKHDSLARYYCHFGYY------IALRKDGM--ETLSTIFDIKCNKGNWTKMP----TEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIK-------------------PIH----------NRVVKYECHPLYRLKGPKIAVCL-NGHWSPPQMPTCEFI 1946
            C  P  PVNG   + +   +G  + + C  G+ L G     C    Q   + +   P C  Q   C     +P   V+       F  G  V   C  G+       +   C     ++ PI    +C   +C  +     D    R +Y     Y+++ +  C+ G+        F       +CQA+G W        C  I C +L  P NG  +G      +   F C  GY L GS +R+C   G W G+   C+  +CG P  IV  ++  E   +     Y+C     LIG  S   C +    SG  P         C P          +   + T F ++D       VR  CN GY L   +   C  NG W N +PRC    C+   P    + VR +           +   Y C+ GYY      ++ + DG    +L     + C++     MP      G +    +       G+  ++G + R    D                       P+H            VV++ C P Y+LKG     CL NG W   Q P C  +
Sbjct: 2450 CSSPDPPVNGSLHSQTGTKLGSTLRFNCDRGFNLIGQTTATCYRTPQGIYQWNAPVPLC--QVVSC----GMPIAPVNGTVIGQHFTLGSRVTFSCNPGFRLANTQPVSTLCQ-ESGRWSPIETRPRCVPVNCPDIGHSAVDHGRWRLIYGMQNKYEAMMMLTCDPGY--------FYKGQRVIRCQANGTWDYPEPRPSCEIISCGDLGTPPNGNKIGTLTVYGATAIFSCNTGYTLVGSRVRECMSNGLWSGAEVQCLAGHCGTPEPIVNGQIIGENYNYRGSVVYQCNPGFRLIG-VSVRICEQDHRWSGKTPV--------CIPITCGHPGTPANGVTQGTQFNLNDI------VRFACNPGYVLQGALKSQCQSNGQWSNALPRCKIVNCTD--PGHVENGVRQVLPSGPHRYSFQTAVSYNCNPGYYLLGSSILSCQGDGTWDRSLPKCLLVLCDR---PSMPPYAQISGDRRTVGSVIRFSCIGQRSIVGNTTRMCQLDGQWSGSLPHCSGDSAGLCGDPGIPVHGIRLGEEFTTGSVVRFSCEPGYQLKGSSERTCLANGSWVGIQ-PECHVV 2994          

HSP 3 Score: 83.5741 bits (205), Expect = 6.387e-16
Identity = 140/588 (23.81%), Postives = 212/588 (36.05%), Query Frame = 3
Query:  228 KPECHVKSLDNVKHLPNG-----CPSKACTANIDCWVEY----DRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMY----NNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRN---CGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF-IPRCVEAACSARPPSMKYSTVRFLS-LKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEI----YLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWS 1916
            +P C + S  ++   PNG           TA   C   Y     R + C+ +    G     +   C  P   VNG            V Y C  G+ L G   R C+ + R SG  P C   T  C      P T  +  +    F   + V+  C  GY    +  + ++C  N +W     +C+  +C      +NG         + Y++Q+     CN G+ +  ++           CQ DG W      C  +LC   S P   ++ G   TV S+  F C     + G+  R C  +G W GS   C   +   CG P   V      E  T G+   + C+    L G +S  TC  + N S W+   +P+C        V S        N    F  HD +     +   C  GY     +   C  NG+W   +P C    C    P +  + +R  S   +     + C  G+ +   +      ST+   K    N TK P   C+   C  PP+  NG++    +  G S                 + Y C+  Y+L  P I  C  +G+WS
Sbjct: 2632 RPSCEIISCGDLGTPPNGNKIGTLTVYGATAIFSCNTGYTLVGSRVRECMSNGLWSGAEVQCLAGHCGTPEPIVNGQIIGENYNYRGSVVYQCNPGFRLIGVSVRICEQDHRWSGKTPVCIPIT--CGH----PGTPANGVTQGTQFNLNDIVRFACNPGYV--LQGALKSQCQSNGQWSNALPRCKIVNCTDPGHVENGVRQVLPSGPHRYSFQTAVSYNCNPGYYLLGSS--------ILSCQGDGTWDRSLPKCLLVLCDRPSMPPYAQISGDRRTVGSVIRFSCIGQRSIVGNTTRMCQLDGQWSGSLPHCSGDSAGLCGDPGIPVHGIRLGEEFTTGSVVRFSCEPGYQLKG-SSERTC--LANGS-WV-GIQPEC-------HVVSCGNPGTPRNAMIQF--HDGLVFSRSITYSCREGYYSTGLLTRHCTVNGTWTGDMPECTVINCGD--PGVPANGIRLGSDFTYSHSVSFQCSPGFTMDADR-----ASTLICTKDRTWNGTK-PV--CKAIVCAAPPSIPNGQVVGSDFQWGSS-----------------ISYSCNQGYQLSLPTILTCQGSGNWS 3162          
BLAST of C4b binding protein beta chain vs. Ensembl Zebrafish
Match: csmd3a (CUB and Sushi multiple domains 3a [Source:ZFIN;Acc:ZDB-GENE-050419-118])

HSP 1 Score: 93.5893 bits (231), Expect = 3.828e-19
Identity = 103/422 (24.41%), Postives = 160/422 (37.91%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENG----EVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNF-IPRCVEAACS--ARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIA 1634
            + C     P NG    +    G    +TC SG+ L G   R C  +   SG+E  C      C     IP   V+     ++F   + V   C  G+     S  I + + N W      C   SCG    P  GRT+  + +    +   FCN G+ ++  ++         QCQ+D +WS     C  + C +   P N     ++     T  ++ ++ C  GY L GS +  C   G WD     C+  +CG P     A V  +  T G+   Y+C     LIGE++          +G     +P C    K           H   + ++F  H +      VR  C+ G+ L       C+ NG+W+   P C    C     P + + S V   +  H  +  Y C  GY ++
Sbjct:  683 ISCGELPTPPNGKKIGTQTTFGATAIFTCNSGFILVGSTVRECLPSGLWSGTETHCL--AGHC----GIPERIVNGQVIGENFGYRDTVVYQCNPGFRLIGSSVRICQQDHN-WSGQLPSCVSISCGHPGSPIYGRTV-GDGFNLNDVVTFFCNKGYILEGPSEA--------QCQSDRQWSQHPPTCRVVNCTDPGIPANSIRKSKIEYGNFTFGTVVSYDCNPGYYLFGSSVLTCQPVGYWDKPLPECLEVDCGHPGSPPHAVVTGDKFTFGSTVHYRCLEDRVLIGEST-----RACQLNGQWGGSQPHCSGD-KRGACGDPGTPAHATREESSFQQHAK------VRFTCSTGHTLYGSAERICFPNGTWSGRQPTCKPVQCGNPGTPANGRVSHVSGTTFSHSII--YSCVEGYRLS 1074          

HSP 2 Score: 92.8189 bits (229), Expect = 7.951e-19
Identity = 105/440 (23.86%), Postives = 163/440 (37.05%), Query Frame = 3
Query:  369 GLVCMEIDLQCQPPVQPVNGHA-NHSILLVGDQVEYTCKSGYALKGPRKRYCQAN----LRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYK--SHIIAKCNGNEWKYDPI-KCEKKSCGKLE----DPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWS--GDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNG-SWNFIP---RCVEAACSARPP-SMKYSTVRFLSLKHDSLARYYCHFGYYI 1631
            G     + + C  P  P +G   + +   V   V + C  G+ L G     C+      L    S P C  Q   C     +P   V+      D+  G      C +G+    K  +  + + +G    ++ I +C    C  +     D    R +  + Y Y +     CN G+        +        C ++G WS   +   C  I C EL  P NG+ +G   T  +   F C  G+ L GS +R+C   G W G+ + C+  +CG P  IV  +V  E   +     Y+C     LIG +S   C +  N SG LP         C           I+       F ++D VT        CN GY L       C +   W+  P   R V       P  S++ S + + +    ++  Y C+ GYY+
Sbjct:  485 GFRITYVAMYCSTPDSPQHGFVLSQTGGHVNSVVRWACDRGFRLIGKNMAVCKRTEIGFLAWDSSVPAC--QAVSC----GMPVAPVNGGVLAADYSAGTRATYFCNDGFRLSSKEVTSTVCQADGTWSSHNKIPRCTVVVCPSIGSFTLDHGKWRIVNGSRYEYGTKVAFTCNAGY--------YRLGPAHIHCTSNGTWSWRNERPRCKVISCGELPTPPNGKKIGTQTTFGATAIFTCNSGFILVGSTVRECLPSGLWSGTETHCLAGHCGIPERIVNGQVIGENFGYRDTVVYQCNPGFRLIG-SSVRICQQDHNWSGQLPS--------CVSISCGHPGSPIYGRTVGDGFNLNDVVTF------FCNKGYILEGPSEAQCQSDRQWSQHPPTCRVVNCTDPGIPANSIRKSKIEYGNFTFGTVVSYDCNPGYYL 895          

HSP 3 Score: 88.5817 bits (218), Expect = 1.342e-17
Identity = 139/594 (23.40%), Postives = 205/594 (34.51%), Query Frame = 3
Query:  228 KPECHVKSLDNVKHLPNG---------CPSKACTANIDCWVEYDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGY--EDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNG---RTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRN---CGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTH-VRAKCNFGYELNSDILPACY-NGSWNFI-PRCVEAACS-ARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWT-KMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWSPPQMPTC 1937
            +P C V S   +   PNG           +   T N    +     + C+      G     +   C  P + VNG          D V Y C  G+ L G   R CQ +   SG  P C   +  C      P + ++  +  D F   + V   C  GY  E P +    A+C  + +W   P  C   +C     P N      +   N+T+ ++    CN G+ +  ++           CQ  G W      C  + C     P +  V G   T  S   ++C E   L G   R C   G W GS   C       CG P     A     +    A+  + C +  TL G    + C      SG  P         CKP Q        +        + H   T  +H +   C  GY L+      C  NG+W+   P C   +C  +  P+    T    ++ H+    Y C  G+        ME  S+      + G W+  +P+  CQ   C+ PP   NGE+          + +  +       V Y C   Y L  P +  C  NG WS  ++P C
Sbjct:  677 RPRCKVISCGELPTPPNGKKIGTQTTFGATAIFTCNSGFILVGSTVRECLPSGLWSGTETHCLAGHCGIPERIVNGQVIGENFGYRDTVVYQCNPGFRLIGSSVRICQQDHNWSGQLPSCVSIS--CGH----PGSPIYGRTVGDGFNLNDVVTFFCNKGYILEGPSE----AQCQSDRQWSQHPPTCRVVNCTDPGIPANSIRKSKIEYGNFTFGTVVSYDCNPGYYLFGSS--------VLTCQPVGYWDKPLPECLEVDCGHPGSPPHAVVTGDKFTFGSTVHYRCLEDRVLIGESTRACQLNGQWGGSQPHCSGDKRGACGDPGTPAHATREESSFQQHAKVRFTCSTGHTLYGSAERI-CFPNGTWSGRQPT--------CKPVQCG------NPGTPANGRVSHVSGTTFSHSIIYSCVEGYRLSGSPTRQCLANGTWSGGEPNCTLISCGDSGVPASGLRTGEDFTVGHN--VSYSCQPGFM-------MENGSSAIRTCTHNGTWSGSLPS--CQAVTCSPPPAVSNGEV-------EGSVFEWGVS------VSYRCMMGYELSFPAVLTCAGNGSWS-GEIPLC 1212          

HSP 4 Score: 83.9593 bits (206), Expect = 3.707e-16
Identity = 79/319 (24.76%), Postives = 120/319 (37.62%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANH-SILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQF-CNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCI---VRNCGPPPEIVFAKV-AYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLH 1328
            +QC  P  P NG  +H S       + Y+C  GY L G   R C AN   SG EP CT    +      +P + +      +DF  G +V   CQ G+     S  I  C  N  W      C+  +C       NG      +     +++ + C  G+++               C  +G WSG+  +C    C +   P      G      +   F C   Y L GS  R C  +  W G+   CI      C  P    F  + +      G+  ++ C++   L+G T+  TC +    SG     +P+C+ H
Sbjct: 1038 VQCGNPGTPANGRVSHVSGTTFSHSIIYSCVEGYRLSGSPTRQCLANGTWSGGEPNCTL---ISCGDSGVPASGLRTG---EDFTVGHNVSYSCQPGFMMENGSSAIRTCTHNGTWSGSLPSCQAVTCSPPPAVSNGEV--EGSVFEWGVSVSYRCMMGYELSFPA--------VLTCAGNGSWSGEIPLCLPKFCGDPGIPSRARREGQSFIFKAEVMFSCSAPYVLVGSSTRTCQADATWSGTQPRCIEPTRTTCENPGTPEFGSLNSSLGFKVGSTVKFVCQTGHLLLGSTT-RTCQQDLTWSG----SQPECIPH 1335          

HSP 5 Score: 83.1889 bits (204), Expect = 6.695e-16
Identity = 79/310 (25.48%), Postives = 120/310 (38.71%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRK--RYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAIC---TAILCPELSPPENGEV-MGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKV-AYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLP 1301
            + C     P +G        VG  V Y+C+ G+ ++      R C  N   SGS P C  Q   C   P +   +V  +     F+ G  V   C  GYE  + + +    NG+ W  +   C  K CG    P   R     ++ +++  +  C+  + +  ++         R CQAD  WSG    C   T   C     PE G +   +   V S   F C+ G+ L GS  R C ++  W GS   CI  +C  P     A V   +  + G    Y C+    L G +    C    + +G +P
Sbjct: 1097 ISCGDSGVPASGLRTGEDFTVGHNVSYSCQPGFMMENGSSAIRTCTHNGTWSGSLPSC--QAVTCSPPPAVSNGEVEGSV----FEWGVSVSYRCMMGYELSFPAVLTCAGNGS-WSGEIPLCLPKFCGDPGIPSRAR-REGQSFIFKAEVMFSCSAPYVLVGSST--------RTCQADATWSGTQPRCIEPTRTTCENPGTPEFGSLNSSLGFKVGSTVKFVCQTGHLLLGSTTRTCQQDLTWSGSQPECIPHSCKQPKTPPHANVLGMDLPSFGYTLLYSCQPGFILTGGSEHRACRPDGSWTGKVP 1390          

HSP 6 Score: 66.2402 bits (160), Expect = 1.127e-10
Identity = 132/558 (23.66%), Postives = 198/558 (35.48%), Query Frame = 3
Query:  399 CQPPVQPVNGH--ANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWK-------YDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAI--------CTAILCPELSPPENGEVMG-VWNTVNSIKTFKCKEGYQLHGSHLRKCTREG----NWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPE-PKCLLHCKP----FQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGY-ELNSDILPACYNGSW---NFIPRCVEAACS--ARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTCEFIM--HDELPI 1967
            CQPP    N    A      +GD + Y C  G+ L G     C+   RL    P               P  QV    N   F   +   +I   GY D Y +  +     N  K       +   + EK+    + +  +G  +Y+     QS+A+   +       TT            Q   +WS D             A+ C     P++G V+      VNS+  + C  G++L G ++  C R       WD S   C   +CG P   V   V     + G +A Y C     L  +    T  + D    W    + P+C +   P    F +D  K  I   ++           +GT V   CN GY  L    +    NG+W   N  PRC   +C     PP+ K    +       + A + C+ G+ I +     E L +        G W+   T  C    C  P    NG++  +G++   R T           V Y+C+P +RL G  + +C   H    Q+P+C  I   H   PI
Sbjct:  321 CQPPPPVANAEILAEDDEFQIGDIIRYRCLPGFTLLGSEILTCRLGERLQMDGPP--------------PVCQVQCPDNEVLF---DSTGVILSPGYPDSYPNLQMCSWMINVEKGYNITLHFQLFQTEKEF--DILEIFDGPNIYS-----QSLAVLSGDLSVPFNITTTGH---------QLFLRWSSDHGTNKKGFRITYVAMYCSTPDSPQHGFVLSQTGGHVNSVVRWACDRGFRLIGKNMAVCKRTEIGFLAWDSSVPACQAVSCGMPVAPVNGGVLAADYSAGTRATYFCNDGFRLSSKEVTSTVCQADGT--WSSHNKIPRCTVVVCPSIGSFTLDHGKWRIVNGSR---------YEYGTKVAFTCNAGYYRLGPAHIHCTSNGTWSWRNERPRCKVISCGELPTPPNGKKIGTQ---TTFGATAIFTCNSGF-ILVGSTVRECLPS--------GLWSGTETH-CLAGHCGIPERIVNGQV--IGENFGYRDT-----------VVYQCNPGFRLIGSSVRICQQDHNWSGQLPSCVSISCGHPGSPI 808          

HSP 7 Score: 63.1586 bits (152), Expect = 9.259e-10
Identity = 46/215 (21.40%), Postives = 82/215 (38.14%), Query Frame = 3
Query:  321 VEYDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTA 962
            + +     C  +    G + + +   C  P  P          +   +V ++C + Y L G   R CQA+   SG++P C + T      P  P  +    ++   FK G  VK +CQ G+           C  +  W     +C   SC + + P +   +  +  ++    +  C  GF +   ++        R C+ DG W+G   +C A
Sbjct: 1191 LSFPAVLTCAGNGSWSGEIPLCLPKFCGDPGIPSRARREGQSFIFKAEVMFSCSAPYVLVGSSTRTCQADATWSGTQPRCIEPTRTTCENPGTP--EFGSLNSSLGFKVGSTVKFVCQTGHL--LLGSTTRTCQQDLTWSGSQPECIPHSCKQPKTPPHANVLGMDLPSFGYTLLYSCQPGFILTGGSEH-------RACRPDGSWTGKVPVCRA 1394          
BLAST of C4b binding protein beta chain vs. Ensembl Xenopus
Match: SVEP1 (sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1 [Source:NCBI gene;Acc:100493788])

HSP 1 Score: 129.798 bits (325), Expect = 3.104e-30
Identity = 137/537 (25.51%), Postives = 206/537 (38.36%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDF------KNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGSWNFIP-----RCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWT-KMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCEFIMHDELP 1964
            + C  P +  NG  N   L  G  V Y C  GY L G  + +C  N   +G  P C D  D C             N+N           +G+  K + + GY        +   N   W +    CE  +C K ++ +NG     +  T+ S A   C  G+ +Q              C+A G WS +   C  + C       + +  G   T ++I T+KCKEGY L G     C+  G W      C+  +C  PP + +A         G  A Y C    +++     L     + +  W+P P+ K + +C     +      H   ++ N     +   G+ V  KC  G+ LN+     C  G   +IP     +C+   C   PPS+K   V   +    S+  Y C  GYYI   K      S         G W+ ++P   C P  C  PP  +NG +       +T L       ++   V Y C+P Y+L G  + VC LN HW     PTC  +  ++ P
Sbjct: 1645 ISCGKPPRLENGFYNAEDLFAGSTVTYQCNIGYYLLGDSRMFCTDNGSWNGISPSCLD-VDECEIGSDCDEHASCMNTNGSYICTCIPPYHGDGKKCLGKCGYTLIGNEETVCLAN-RSWSHALPTCESVTCSKPKEIENG-IFSLSGLTFNSTASYACKTGYSLQGPATLI--------CEASGNWSSEVPSCDLVSCGPPPLVRDADATGDNYTYSNIITYKCKEGYTLVGPDTINCSSSGKWSEHIPQCMAVSCDEPPNVDYASSHSSHRLFGDTAYYYCSDGYSMVDNAQML----CNTEGNWVP-PDGKEIPNCIADFCERPSSVAHSILESVN---KAKFVSGSTVSFKCMEGFVLNTTARIECVRGG-QWIPSSLTIQCIPVRC-GEPPSIKNGYVSGTNYSFGSVVAYSCDKGYYIKGEKKRTCLAS---------GEWSGRLPA--CHPGSCDDPPKLENGFV-----KSKTGL-------LYESKVIYACNPGYKLVGSNVRVCQLNRHWYSESPPTCVLLTCEKPP 2137          

HSP 2 Score: 100.138 bits (248), Expect = 5.711e-21
Identity = 131/571 (22.94%), Postives = 203/571 (35.55%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGV-------------------------------WNT---------------------------VNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTN-FIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNF-IPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLN-GHWSP 1919
            ++C  P  P NG  +++   +G  V + CK GY L G  K  C AN + +   P+C         +   P   +H  +   ++     +   C  GY+    S    + +  +W  +   C   SCG+     NG+ +  N YT+       CN+G+++             R C  +G WSG T  C AI C   +   NGEV G                                WN+                            N    + C  GY++HGS  R+C   G W GS  TC+   C P P +    ++ +  T G     KC+    L+G +S LTC      S   P        HC        KV         N FI     T    +R  C  GY +       C   G W+   P C   +C   PPS+  + +   S  + +L  Y C  GY   + +D + + + + D   + G+   +P +                    L QS   ++ +   +   N+ +   C   Y L GP  + C+N G+W P
Sbjct: 2558 IECSIPTDPENGVMHYTDNTIGSSVHFECKPGYELNGSDKSICLANKQWNNEIPKCV------IISCKTPNKILHGYTEVSNYTYMSVIHYKCDKGYQIYGLSQRTCQIS-KQWDGEEPICVPVSCGQPPMVINGKVI-GNEYTFSKTIEYVCNEGYRLYGEE--------IRTCLENGNWSGTTPSCLAITCKISTTVNNGEVTGTECGVGKEILYRCNHGYKMQGTPKLTCLNDGTWNSNAPLCEPIHCEPPEDISNGYLNSSNFKYNEYIHYVCFPGYEMHGSSTRQCLANGAWSGSPPTCLPCEC-PTPVVQNGIMSGDDFTCGHSVSIKCREGFKLLG-SSELTCQSAGKWSSGFP--------HC-------GKVPCGPPPSIPNAFINGSSSTDEDAIRYNCVAGYIMQGKSELLCTKEGVWSKPYPNCQLLSC-GLPPSVLNAVLIADSYTYGNLF-YRCQDGY--VMHQD-VSSKTCLEDGSWSPGDIVCVPKK-------------------CLLQSTLIQIKNDETEYDINKTITIVCKEGYTLTGPSTSTCMNDGNWIP 3071          

HSP 3 Score: 100.138 bits (248), Expect = 5.861e-21
Identity = 133/543 (24.49%), Postives = 205/543 (37.75%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNG--RTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKW----SGDTAICTAILCPELSPPENGEVMGVWNTVNSIK-------TFKCKEGYQLHGSHLRKCTREGNWDGSNST--CIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSW--NFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNK-GNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTCEFIMHDELP 1964
            + C  P +  NG  + S L       Y CK+GY+L+GP    C+A+   S   P C    DL    P  P      ++  D++     +   C+ GY       I    +G +W     +C   SC   ++P N    + ++++  +   A  +C+DG+ +          N +  C  +G W      +   C A  C   S         +  +VN  K       +FKC EG+ L+ +   +C R G W  S+ T  CI   CG PP I    V+    + G+   Y C     + GE    TC      SG LP         C P   D      +   K+   ++++     + V   CN GY+L    +  C  N  W     P CV   C  +PP +KY +++  + +  S   ++C  GY           LS      C K G W K  T  C P KC  PP  +N             L  K + P    +V++ C   + L+G  +  CL         P C+ +     P
Sbjct: 1772 VTCSKPKEIENGIFSLSGLTFNSTASYACKTGYSLQGPATLICEASGNWSSEVPSC----DLVSCGP--PPLVRDADATGDNYTYSNIITYKCKEGYTLVGPDTINCSSSG-KWSEHIPQCMAVSC---DEPPNVDYASSHSSHRLFGDTAYYYCSDGYSMV--------DNAQMLCNTEGNWVPPDGKEIPNCIADFCERPS----SVAHSILESVNKAKFVSGSTVSFKCMEGFVLNTTARIECVRGGQWIPSSLTIQCIPVRCGEPPSIKNGYVSGTNYSFGSVVAYSCDKGYYIKGEKK-RTCLASGEWSGRLPA--------CHPGSCDDPPKLENGFVKSKTGLLYE-----SKVIYACNPGYKLVGSNVRVCQLNRHWYSESPPTCVLLTCE-KPPPVKYGSMKGENFEVGSKVEFFCEDGY----------ELSGDLSWTCQKNGEWDKKQTPTCMPSKCQDPPLYEN------------HLVLKEV-PNEVGIVRFSCKEGHVLEGSSVLKCLPSQQWNDSFPLCKLVFCSSPP 2254          

HSP 4 Score: 98.2117 bits (243), Expect = 2.732e-20
Identity = 126/522 (24.14%), Postives = 196/522 (37.55%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWS-GDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAK-VAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSG-WLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSW-NFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTC 1937
            I ++C  P    NG+ + +    G  V Y+C  GY +KG +KR C A+   SG  P C   +  C   P +    V    ++        V   C  GY+    +  + + N + +   P  C   +C K    K G +M   N+   S    FC DG+++          +    CQ +G+W    T  C    C +    EN  V+        I  F CKEG+ L GS + KC     W+ S   C +  C  PPE+ + + ++  +   G+  +Y C     L GE S +TC    N SG W P        +C P +    +  ++        +    +T  +     C  GYEL  +    C  +G W    P C    CS +   +      F SL +     Y C+ G+    R +G   L+ +       G W   P   C+   C  P    NG +     S             +  ++ + C P ++L G  +  C    WS    P C
Sbjct: 2011 IPVRCGEPPSIKNGYVSGTNYSFGSVVAYSCDKGYYIKGEKKRTCLASGEWSGRLPACHPGS--CDDPPKLENGFVK---SKTGLLYESKVIYACNPGYKLVGSNVRVCQLNRHWYSESPPTCVLLTCEKPPPVKYG-SMKGENFEVGSKVEFFCEDGYELS--------GDLSWTCQKNGEWDKKQTPTCMPSKCQDPPLYENHLVLKEVPNEVGIVRFSCKEGHVLEGSSVLKCLPSQQWNDSFPLCKLVFCSSPPELAYGEPISVPSLYFGSTVKYTCVDGFLLKGE-SVITC----NASGMWSPD-----FPNCSPIECPQPEEILN------GIVDVQGLTFLSAALYTCKPGYELIGNSTLICGADGYWQGGKPICKPIKCS-KAKEILNGKFSFQSLNYGQTITYTCNRGF----RLEGQNVLTCL-----ETGEWNSNPPI-CKEITCDPPQGIDNGFVEGADYS-------------YGAMIIFSCMPGFQLVGLAMQTCEESGWS-SSTPVC 2477          

HSP 5 Score: 95.5153 bits (236), Expect = 1.762e-19
Identity = 135/561 (24.06%), Postives = 206/561 (36.72%), Query Frame = 3
Query:  342 LCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRD--DFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGK------------------LEDPKNGRTMYN-NNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWN-FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKC-NKGNW-TKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHW--SPPQMPTCE 1940
            +C  D Y  G   +   ++C    + +NG  +   L  G  + YTC  G+ L+G     C      + + P C + T            Q  DN   +  D+  G  +   C  G++       +  C  + W      C    CG                   L D +   +++  + Y Y +  I  CN+G++I   +           C+ DG W+G    C  I C   + PENG +    NT+ S   F+CK GY+L+GS    C     W+     C++ +C  P +I+         T+ +   YKC     + G  S  TC       G     EP C+    P       + I  N K    ++ +E T    +   CN GY L  + +  C  NG+W+   P C+   C       K ST    ++ +  +    C  G  I  R +    +     + C N G W +  P   C+P  C  P    NG            L   + K  +N  + Y C P Y + G     CL NG W  SPP    CE
Sbjct: 2348 ICGADGYWQGGKPICKPIKCSKAKEILNGKFSFQSLNYGQTITYTCNRGFRLEGQNVLTCLETGEWNSNPPICKEIT--------CDPPQGIDNGFVEGADYSYGAMIIFSCMPGFQ--LVGLAMQTCEESGWSSSTPVCLHTDCGLPPHIDFGQYTIVTFEEKILTDDELKHSIFGLSEYLYGTNVIYSCNNGYEILGMS--------VLTCKEDGTWNGSAPACAPIECSIPTDPENGVMHYTDNTIGSSVHFECKPGYELNGSDKSICLANKQWNNEIPKCVIISCKTPNKILHGYTEVSNYTYMSVIHYKCDKGYQIYG-LSQRTCQISKQWDG----EEPICV----PVSCGQPPMVI--NGK----VIGNEYTFSKTIEYVCNEGYRLYGEEIRTCLENGNWSGTTPSCLAITC-------KIST----TVNNGEVTGTECGVGKEILYRCNHGYKMQGTPKLTCLNDGTWNSNAPL--CEPIHCEPPEDISNG-----------YLNSSNFK--YNEYIHYVCFPGYEMHGSSTRQCLANGAWSGSPPTCLPCE 2849          

HSP 6 Score: 93.2041 bits (230), Expect = 8.690e-19
Identity = 146/600 (24.33%), Postives = 214/600 (35.67%), Query Frame = 3
Query:  396 QCQPPVQPVNGHA-NHSILLVGDQVEYTCKSGYALKGPRKRYCQANLR-LSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYE-----------------------------DP--YKSHIIAKCNGNE---------------------------WKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQ-VDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGSW-NFIPRCVEAACSARPPSM---KYSTVRFL-------SLKHDSLAR----------YYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWSPPQMPTCEFI 1946
             C  P +  NG   + + LL   +V Y C  GY L G   R CQ N    S S P C   T  C   P + Y  +      ++F+ G  V+  C++GYE                             DP  Y++H++ K   NE                           W      C+   C    +   G  +   +  + S     C DGF ++  +           C A G WS D   C+ I CP+     NG V     T  S   + CK GY+L G+    C  +G W G    C    C    EI+  K ++++  +G    Y C     L G+ + LTC E      W   P     + C P Q +D+             F+   + ++G  +   C  G++L    +  C    W +  P C+   C   PP +   +Y+ V F         LKH               Y C+ GY I     GM  L+   D     G W       C P +C+ P  P+NG ++          TD +I       V +EC P Y L G   ++CL N  W+  ++P C  I
Sbjct: 2072 SCDDPPKLENGFVKSKTGLLYESKVIYACNPGYKLVGSNVRVCQLNRHWYSESPPTCVLLT--CEKPPPVKYGSMKG----ENFEVGSKVEFFCEDGYELSGDLSWTCQKNGEWDKKQTPTCMPSKCQDPPLYENHLVLKEVPNEVGIVRFSCKEGHVLEGSSVLKCLPSQQWNDSFPLCKLVFCSSPPELAYGEPISVPSLYFGSTVKYTCVDGFLLKGES--------VITCNASGMWSPDFPNCSPIECPQPEEILNGIVDVQGLTFLSAALYTCKPGYELIGNSTLICGADGYWQGGKPICKPIKCSKAKEILNGKFSFQSLNYGQTITYTCNRGFRLEGQ-NVLTCLETGE---WNSNPPICKEITCDPPQGIDNG------------FVEGADYSYGAMIIFSCMPGFQLVGLAMQTCEESGWSSSTPVCLHTDC-GLPPHIDFGQYTIVTFEEKILTDDELKHSIFGLSEYLYGTNVIYSCNNGYEIL----GMSVLTCKED-----GTWNGS-APACAPIECSIPTDPENGVMH---------YTDNTI----GSSVHFECKPGYELNGSDKSICLANKQWN-NEIPKCVII 2616          

HSP 7 Score: 93.2041 bits (230), Expect = 9.468e-19
Identity = 77/286 (26.92%), Postives = 110/286 (38.46%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCP-ELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIG 1247
            + C  P  P +G    +  L  D V Y C  G+ L GP +R C  + +     P C      C S PYI         N        ++   C  GY      H+    NG  W     +C++  C   + P+NG   Y N     ++  Q C +G+ +     + ED     +C  +G WS    IC A  CP     PEN  +      V    + KC++GYQL G  +  C  +  W  +N  C   +CGPP  I    +       G    Y C S   L+G
Sbjct: 3081 VSCGEPAAPEHGIVLGTRYLFKDSVLYHCNHGFELNGPSRRICHIDKQWIPPPPTCV----TCDSLPYIENAVYTSTGNTYT----HNITFTCNFGYHLVGPPHVRCLVNGT-WSKPLPQCKETRCEVPQQPENGHAEYENVTVGSTVRYQ-CQNGYTL-----EGED---LAECTTNGTWSHPVPICKANPCPVPFVIPENAILTETDFYVGQKVSIKCRKGYQLQGQAVITCNADETWTDANVKCEKISCGPPHTIQNGILRGMYHQFGDVVTYSCYSGYMLLG 3348          

HSP 8 Score: 88.9669 bits (219), Expect = 1.820e-17
Identity = 125/521 (23.99%), Postives = 196/521 (37.62%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNS--NRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQF-CNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRK-CTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCE 1940
            + C+PP    NG+ N S     + + Y C  GY + G   R C AN   SGS P C          P    T V  N   + DDF  G  V I C+ G++    S +  +  G +W      C K  CG    P       N + +    AI++ C  G+ +Q  ++          C  +G WS     C  + C  L P     V+   +       ++C++GY +H     K C  +G+W   +  C+ + C     ++  K               CK   TL G ++  TC    N   W+P+        C P          H     T ++  D V +       CN G+ELN      C+       P      C + P  ++ +        +     + C+FGY++     G   +  + +     G W+K P   C+  +C  P  P+NG       ++   +T  S        V+Y+C   Y L+G  +A C  NG WS P +P C+
Sbjct: 2790 IHCEPPEDISNGYLNSSNFKYNEYIHYVCFPGYEMHGSSTRQCLANGAWSGSPPTCL---------PCECPTPVVQNGIMSGDDFTCGHSVSIKCREGFKLLGSSELTCQSAG-KWSSGFPHCGKVPCGP--PPSIPNAFINGSSSTDEDAIRYNCVAGYIMQGKSELL--------CTKEGVWSKPYPNCQLLSC-GLPPSVLNAVLIADSYTYGNLFYRCQDGYVMHQDVSSKTCLEDGSWSPGDIVCVPKKCLLQSTLIQIKNDETEYDINKTITIVCKEGYTLTGPSTS-TC---MNDGNWIPEVNNNI---CTPVSCGEPAAPEHGIVLGTRYLFKDSVLY------HCNHGFELNGPSRRICHIDKQWIPPPPTCVTCDSLP-YIENAVYTSTGNTYTHNITFTCNFGYHLV----GPPHVRCLVN-----GTWSK-PLPQCKETRCEVPQQPENG------HAEYENVTVGS-------TVRYQCQNGYTLEGEDLAECTTNGTWSHP-VPICK 3251          

HSP 9 Score: 78.9518 bits (193), Expect = 2.118e-14
Identity = 125/531 (23.54%), Postives = 191/531 (35.97%), Query Frame = 3
Query:  567 QTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAK-----CNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNS-----IKTF-----KC--KEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYEL-NSDILPACYNGSWN-FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIA-------------LRKDGMETLSTIFDI-------------KCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIH-------------------NRVVKYECHPLYRLKGPKIAVCL-NGHWSPPQMPTCEFIMHDELP 1964
            ++  C   P +  T  H ++ + D K G  + + C  G++      I+ K      N  EW      CE+ SCGK    +NG   YN    +    + +       QC    +   + R  C  +G W+G +  C  +   E+   +  E     NT  S     I  +     KC  K GY L G+    C    +W  +  TC    C  P EI     +    T  + A Y CK+  +L G  + L C    N S  +P  +   L+ C P  +      + + + T      D  T+   +  KC  GY L   D +    +G W+  IP+C+  +C   PP++ Y++           A YYC  GY +              +  DG E  + I D                NK  +    T   +  +     T    E    GQ   + LT + I P+                      VV Y C   Y +KG K   CL +G WS  ++P C     D+ P
Sbjct: 1581 KSKFCADCPALEGTSPHLHATKSDHKPGSKISLFCNPGFQ------IVGKPERQCLNLGEWDQPLPHCERISCGKPPRLENG--FYNAEDLFAGSTVTY-------QCNIGYYLLGDSRMFCTDNGSWNGISPSCLDVDECEIG-SDCDEHASCMNTNGSYICTCIPPYHGDGKKCLGKCGYTLIGNEETVCLANRSWSHALPTCESVTCSKPKEIENGIFSLSGLTFNSTASYACKTGYSLQGPAT-LICEASGNWSSEVPSCD---LVSCGPPPL------VRDADAT-----GDNYTYSNIITYKCKEGYTLVGPDTINCSSSGKWSEHIPQCMAVSCD-EPPNVDYASSHSSHRLFGDTAYYYCSDGYSMVDNAQMLCNTEGNWVPPDGKEIPNCIADFCERPSSVAHSILESVNKAKFVSGSTVSFKCMEGFVLNTTARIECVRGGQWIPSSLTIQCI-PVRCGEPPSIKNGYVSGTNYSFGSVVAYSCDKGYYIKGEKKRTCLASGEWS-GRLPACHPGSCDDPP 2077          

HSP 10 Score: 72.7886 bits (177), Expect = 2.027e-12
Identity = 55/187 (29.41%), Postives = 83/187 (44.39%), Query Frame = 3
Query:  390 DLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNE-WKYDPIKCEKKSCGKLEDPKNG--RTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSG 941
            + +C+ P QP NGHA +  + VG  V Y C++GY L+G     C  N   S   P C  + + C     IP   +   +   DF  G+ V I C+ GY+   +   +  CN +E W    +KCEK SCG     +NG  R MY   + +  +    C  G+ +          + R  C  +G W+ 
Sbjct: 3194 ETRCEVPQQPENGHAEYENVTVGSTVRYQCQNGYTLEGEDLAECTTNGTWSHPVPIC--KANPCPVPFVIPENAILTET---DFYVGQKVSIKCRKGYQ--LQGQAVITCNADETWTDANVKCEKISCGPPHTIQNGILRGMY---HQFGDVVTYSCYSGYMLL--------GSFRSVCLENGTWTA 3362          

HSP 11 Score: 59.3066 bits (142), Expect = 2.782e-8
Identity = 37/114 (32.46%), Postives = 56/114 (49.12%), Query Frame = 3
Query:  942 DTAICTAILCPELSPPENGE-VMGVWNT-VNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKV--AYEATTHGAQAEYKCKSRSTLIGETSFLTCG 1271
            + ++C  + CPEL PPENG  V  + N   ++    +CK GY L GS++R C   G W GS++TC VR C     +   ++  +   T++G      C     L G +  L  G
Sbjct:  342 EGSVCKVVHCPELRPPENGYFVQNICNNHFDAACGIRCKTGYDLVGSNIRLCQPNGLWTGSDATCRVRTCPKLHTLEHGRMNCSSSDTSYGTMCIAYCNDGYVLEGSSKLLCLG 455          

HSP 12 Score: 53.9138 bits (128), Expect = 1.063e-6
Identity = 89/362 (24.59%), Postives = 124/362 (34.25%), Query Frame = 3
Query:  453 VGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQ--TDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNG-RTMYNNNYTYQSIAIQF-CNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTH-GAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEV-THGTHVRAKCNFGYELNSDILPACY-NGSWNFIPRC 1517
            +   +   CK GY L GP    C  +       PE  +   T +    P  P   +   + R  FK  + V   C +G+E    S  I   +  +W   P  C   +C  L   +N   T   N YT+    I F CN G+ +              +C  +G WS     C    C     PENG       TV S   ++C+ GY L G  L +CT  G W      C    C  P  I    +  E   + G +   KC+    L G+ + +TC   +    W                V   K+     +   N I+       G  V   C  GY L       C  NG+W   P C
Sbjct: 3041 INKTITIVCKEGYTLTGPSTSTCMNDGNWI---PEVNNNICTPVSCGEPAAPEHGIVLGT-RYLFK--DSVLYHCNHGFELNGPSRRICHID-KQWIPPPPTC--VTCDSLPYIENAVYTSTGNTYTHN---ITFTCNFGYHLVGPP--------HVRCLVNGTWSKPLPQCKETRCEVPQQPENGHAEYENVTVGSTVRYQCQNGYTLEGEDLAECTTNGTWSHPVPICKANPCPVPFVIPENAILTETDFYVGQKVSIKCRKGYQLQGQ-AVITCNADET---WTDA------------NVKCEKISCGPPHTIQNGILRGMYHQFGDVVTYSCYSGYMLLGSFRSVCLENGTWTAPPSC 3366          
BLAST of C4b binding protein beta chain vs. Ensembl Xenopus
Match: SVEP1 (sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1 [Source:NCBI gene;Acc:100493788])

HSP 1 Score: 112.079 bits (279), Expect = 1.248e-24
Identity = 136/559 (24.33%), Postives = 210/559 (37.57%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMH-DEVTHGTHVRAKCNFGYE-LNSDILPACYNGSWNF-IPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEI------------------YLLGQ--SDRTRLTDKSIKP------------------IHNRVVKYE--------CHPLYRLKGPKIAVCLN-GHWSP 1919
            ++C  P  P NG  +++   +G  V + CK GY L G  K  C AN + +   P+C         +   P   +H  +   ++     +   C  GY+    S    + +  +W  +   C   SCG+     NG+ +  N YT+       CN+G+++             R C  +G WSG T  C AI C   +   NGEV G    V     ++C  GY++ G+    C  +G W+ +   C   +C PP +I    +      +     Y C     + G ++     +      W   P P CL    P +  +  V         N IM  D+ T G  V  KC  G++ L S  L     G W+   P C +  C   PPS+  + +   S   +   RY C  GY +  + + + T          +G W+K P   CQ   C  PP+  N  +                  Y++ Q  S +T L D S  P                  I N   +Y+        C   Y L GP  + C+N G+W P
Sbjct: 2554 IECSIPTDPENGVMHYTDNTIGSSVHFECKPGYELNGSDKSICLANKQWNNEIPKCV------IISCKTPNKILHGYTEVSNYTYMSVIHYKCDKGYQIYGLSQRTCQIS-KQWDGEEPICVPVSCGQPPMVINGKVI-GNEYTFSKTIEYVCNEGYRLYGEE--------IRTCLENGNWSGTTPSCLAITCKISTTVNNGEVTGTECGVGKEILYRCNHGYKMQGTPKLTCLNDGTWNSNAPLCEPIHCEPPEDISNGYLNSSNFKYNEYIHYVCFPGYEMHGSSTR----QCLANGAWSGSP-PTCL----PCECPTPVV--------QNGIMSGDDFTCGHSVSIKCREGFKLLGSSELTCQSAGKWSSGFPHCGKVPCGP-PPSIPNAFINGSSSTDEDAIRYNCVAGYIMQGKSELLCT---------KEGVWSK-PYPNCQLLSCGLPPSVLNAVLIADSYTYGSTANYRCQDGYVMHQDVSSKTCLEDGSWSPGDIVCVPKKCLLQSTLIQIKNDETEYDINKTITIVCKEGYTLTGPSTSTCMNDGNWIP 3068          

HSP 2 Score: 105.916 bits (263), Expect = 1.036e-22
Identity = 99/376 (26.33%), Postives = 148/376 (39.36%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKC-LLHCK-PFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILP-ACY-NGSWN 1502
            + + C  P   +NG    +       +EY C  GY L G   R C  N   SG+ P C   T        I  T  +      +   G+++   C +GY+      +    N   W  +   CE   C   ED  NG  + ++N+ Y       C  G+++  ++         RQC A+G WSG    C    CP     +NG + G   T     + KC+EG++L GS    C   G W      C    CGPPP I  A +   ++T      Y C +   + G++  L       K G   KP P C LL C  P  V +A             ++ D  T+G+    +C  GY ++ D+    C  +GSW+
Sbjct: 2668 VPVSCGQPPMVINGKVIGNEYTFSKTIEYVCNEGYRLYGEEIRTCLENGNWSGTTPSCLAITC------KISTTVNNGEVTGTECGVGKEILYRCNHGYKMQGTPKLTCL-NDGTWNSNAPLCEPIHCEPPEDISNGY-LNSSNFKYNEYIHYVCFPGYEMHGSS--------TRQCLANGAWSGSPPTCLPCECP-TPVVQNGIMSGDDFTCGHSVSIKCREGFKLLGSSELTCQSAGKWSSGFPHCGKVPCGPPPSIPNAFINGSSSTDEDAIRYNCVAGYIMQGKSELLC-----TKEGVWSKPYPNCQLLSCGLPPSVLNA------------VLIADSYTYGSTANYRCQDGYVMHQDVSSKTCLEDGSWS 3009          

HSP 3 Score: 98.5969 bits (244), Expect = 1.867e-20
Identity = 126/522 (24.14%), Postives = 196/522 (37.55%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWS-GDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAK-VAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSG-WLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSW-NFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTC 1937
            I ++C  P    NG+ + +    G  V Y+C  GY +KG +KR C A+   SG  P C   +  C   P +    V    ++        V   C  GY+    +  + + N + +   P  C   +C K    K G +M   N+   S    FC DG+++          +    CQ +G+W    T  C    C +    EN  V+        I  F CKEG+ L GS + KC     W+ S   C +  C  PPE+ + + ++  +   G+  +Y C     L GE S +TC    N SG W P        +C P +    +  ++        +    +T  +     C  GYEL  +    C  +G W    P C    CS +   +      F SL +     Y C+ G+    R +G   L+ +       G W   P   C+   C  P    NG +     S             +  ++ + C P ++L G  +  C    WS    P C
Sbjct: 1982 IPVRCGEPPSIKNGYVSGTNYSFGSVVAYSCDKGYYIKGEKKRTCLASGEWSGRLPACHPGS--CDDPPKLENGFVK---SKTGLLYESKVIYACNPGYKLVGSNVRVCQLNRHWYSESPPTCVLLTCEKPPPVKYG-SMKGENFEVGSKVEFFCEDGYELS--------GDLSWTCQKNGEWDKKQTPTCMPSKCQDPPLYENHLVLKEVPNEVGIVRFSCKEGHVLEGSSVLKCLPSQQWNDSFPLCKLVFCSSPPELAYGEPISVPSLYFGSTVKYTCVDGFLLKGE-SVITC----NASGMWSPD-----FPNCSPIECPQPEEILN------GIVDVQGLTFLSAALYTCKPGYELIGNSTLICGADGYWQGGKPICKPIKCS-KAKEILNGKFSFQSLNYGQTITYTCNRGF----RLEGQNVLTCL-----ETGEWNSNPPI-CKEITCDPPQGIDNGFVEGADYS-------------YGAMIIFSCMPGFQLVGLAMQTCEESGWS-SSTPVC 2448          

HSP 4 Score: 94.3597 bits (233), Expect = 4.219e-19
Identity = 125/525 (23.81%), Postives = 200/525 (38.10%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNS-NRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGSWNFIPR-----CVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCE 1940
            + + C+      NG    +   VG ++ Y C  GY ++G  K  C  +   + + P       LC      P   + +   N  +FK  E +  +C  GYE    S      NG  W   P  C    C      +NG    ++     S++I+ C +GFK+  +++          CQ+ GKWS     C  + C       N  + G  +T      + C  GY + G     CT+EG W      C + +CG PP ++ A +  ++ T+G+ A Y+C+    +  + S  TC E      W P       + C P +       I   N  T + ++  +T        C  GY L       C N   N+IP      C   +C   P + ++  V            Y+C+ G+ +    +G        D +     W   P   C   +C  P  P+N      G ++   +T  S        V+Y+C   Y L+G  +A C  NG WS P +P C+
Sbjct: 2726 LAITCKISTTVNNGEVTGTECGVGKEILYRCNHGYKMQGTPKLTCLNDGTWNSNAP-------LCEPIHCEPPEDISNGYLNSSNFKYNEYIHYVCFPGYEMHGSSTRQCLANG-AWSGSPPTCLPCEC-PTPVVQNGIMSGDDFTCGHSVSIK-CREGFKLLGSSE--------LTCQSAGKWSSGFPHCGKVPCGPPPSIPNAFINGSSSTDEDAIRYNCVAGYIMQGKSELLCTKEGVWSKPYPNCQLLSCGLPPSVLNAVLIADSYTYGSTANYRCQDGYVMHQDVSSKTCLE---DGSWSPGD-----IVCVPKKCLLQSTLIQIKNDETEYDINKTIT------IVCKEGYTLTGPSTSTCMNDG-NWIPEVNNNICTPVSC-GEPAAPEHGIVLGTRYLFKDSVLYHCNHGFEL----NGPSRRICHIDKQ-----WIPPPPT-CVKTRCEVPQQPEN------GHAEYENVTVGS-------TVRYQCQNGYTLEGEDLAECTTNGTWSHP-VPICK 3192          

HSP 5 Score: 93.5893 bits (231), Expect = 6.938e-19
Identity = 104/447 (23.27%), Postives = 157/447 (35.12%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSC---GKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTA--ICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPT 1715
            + C PP    N   N S     D + Y C +GY ++G  +  C      S   P C  Q   C     +P + ++     D +  G      CQ+GY                W    I C  K C     L   KN  T Y+ N T   +    C +G+ +   +           C  DG W  +    ICT + C E + PE+G V+G          + C  G++L+G   R C  +  W     TC+   C  P +       YE  T G+   Y+C++  TL GE       E      W   P P C  +  P         I EN      +   +   G  V  KC  GY+L    +  C  + +W       E      P +++   +R +  +   +  Y C+ GY +         L +   +    G WT  P+
Sbjct: 2901 VPCGPPPSIPNAFINGSSSTDEDAIRYNCVAGYIMQGKSELLCTKEGVWSKPYPNC--QLLSCG----LPPSVLNAVLIADSYTYGSTANYRCQDGYVMHQDVSSKTCLEDGSWSPGDIVCVPKKCLLQSTLIQIKNDETEYDINKTITIV----CKEGYTLTGPS--------TSTCMNDGNWIPEVNNNICTPVSCGEPAAPEHGIVLGTRYLFKDSVLYHCNHGFELNGPSRRICHIDKQWIPPPPTCVKTRCEVPQQPENGHAEYENVTVGSTVRYQCQNGYTLEGE----DLAECTTNGTW-SHPVPICKANPCP-----VPFVIPEN----AILTETDFYVGQKVSIKCRKGYQLQGQAVITCNADETWTDANVKCEKISCGPPHTIQNGILRGMYHQFGDVVTYSCYSGYML---------LGSFRSVCLENGTWTAPPS 3306          

HSP 6 Score: 92.4337 bits (228), Expect = 1.752e-18
Identity = 134/529 (25.33%), Postives = 199/529 (37.62%), Query Frame = 3
Query:  375 VCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWN-FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKC-NKGNW-TKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHW--SPPQMPTCE 1940
            +C EI   C PP    NG    +    G  + ++C  G+ L G   + C+ +   S S P C   TD C   P+I + Q    +  +        KI+     +D  K  I    N        I     +   L+   +      + Y Y +  I  CN+G++I   +           C+ DG W+G    C  I C   + PENG +    NT+ S   F+CK GY+L+GS    C     W+     C++ +C  P +I+         T+ +   YKC     + G  S  TC       G     EP C+    P       + I  N K    ++ +E T    +   CN GY L  + +  C  NG+W+   P C+   C       K ST    ++ +  +    C  G  I  R +    +     + C N G W +  P   C+P  C  P    NG            L   + K  +N  + Y C P Y + G     CL NG W  SPP    CE
Sbjct: 2390 ICKEI--TCDPPQGIDNGFVEGADYSYGAMIIFSCMPGFQLVGLAMQTCEES-GWSSSTPVCL-HTD-CGLPPHIDFGQYTIVTFEE--------KIL----TDDELKHSIFGVSN-------IILSPTTTSNTLKTENHSENSQLSEYLYGTNVIYSCNNGYEILGMS--------VLTCKEDGTWNGSAPACAPIECSIPTDPENGVMHYTDNTIGSSVHFECKPGYELNGSDKSICLANKQWNNEIPKCVIISCKTPNKILHGYTEVSNYTYMSVIHYKCDKGYQIYG-LSQRTCQISKQWDG----EEPICV----PVSCGQPPMVI--NGK----VIGNEYTFSKTIEYVCNEGYRLYGEEIRTCLENGNWSGTTPSCLAITC-------KIST----TVNNGEVTGTECGVGKEILYRCNHGYKMQGTPKLTCLNDGTWNSNAPL--CEPIHCEPPEDISNG-----------YLNSSNFK--YNEYIHYVCFPGYEMHGSSTRQCLANGAWSGSPPTCLPCE 2845          

HSP 7 Score: 85.5001 bits (210), Expect = 2.345e-16
Identity = 106/464 (22.84%), Postives = 162/464 (34.91%), Query Frame = 3
Query:  396 QCQPPVQPVNGHA-NHSILLVGDQVEYTCKSGYALKGPRKRYCQANLR-LSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYE-----------------------------DP--YKSHIIAKCNGNE---------------------------WKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQ-VDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGSW-NFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLA 1601
             C  P +  NG   + + LL   +V Y C  GY L G   R CQ N    S S P C   T  C   P + Y  +      ++F+ G  V+  C++GYE                             DP  Y++H++ K   NE                           W      C+   C    +   G  +   +  + S     C DGF ++  +           C A G WS D   C+ I CP+     NG V     T  S   + CK GY+L G+    C  +G W G    C    C    EI+  K ++++  +G    Y C     L G+ + LTC E      W   P     + C P Q +D+             F+   + ++G  +   C  G++L    +  C    W +  P C+   C   PP + +     ++ +   L 
Sbjct: 2043 SCDDPPKLENGFVKSKTGLLYESKVIYACNPGYKLVGSNVRVCQLNRHWYSESPPTCVLLT--CEKPPPVKYGSMKG----ENFEVGSKVEFFCEDGYELSGDLSWTCQKNGEWDKKQTPTCMPSKCQDPPLYENHLVLKEVPNEVGIVRFSCKEGHVLEGSSVLKCLPSQQWNDSFPLCKLVFCSSPPELAYGEPISVPSLYFGSTVKYTCVDGFLLKGES--------VITCNASGMWSPDFPNCSPIECPQPEEILNGIVDVQGLTFLSAALYTCKPGYELIGNSTLICGADGYWQGGKPICKPIKCSKAKEILNGKFSFQSLNYGQTITYTCNRGFRLEGQ-NVLTCLETGE---WNSNPPICKEITCDPPQGIDNG------------FVEGADYSYGAMIIFSCMPGFQLVGLAMQTCEESGWSSSTPVCLHTDC-GLPPHIDFGQYTIVTFEEKILT 2475          

HSP 8 Score: 82.8037 bits (203), Expect = 1.591e-15
Identity = 131/572 (22.90%), Postives = 213/572 (37.24%), Query Frame = 3
Query:  369 GLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEP------ECTDQTDLCFS----APYIPYTQVHDNSNRDDFKNG----------EDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNG--RTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKW----SGDTAICTAILCPELSPPENGEVMGVWNTVNSIK-------TFKCKEGYQLHGSHLRKCTREGNWDGSNST--CIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSW--NFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNK-GNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTCEFIMHDELP 1964
            G  C+E  ++C+ P +  NG+ + +   VG Q+ ++C  GY L G  K  C  +     + P         ++  +C +    +  +P  +    S   + +NG                C+ GY           C+ + +W     +C   SC   ++P N    + ++++  +   A  +C+DG+ +          N +  C  +G W      +   C A  C   S         +  +VN  K       +FKC EG+ L+ +   +C R G W  S+ T  CI   CG PP I    V+    + G+   Y C     + GE    TC      SG LP         C P   D      +   K+   ++++     + V   CN GY+L    +  C  N  W     P CV   C  +PP +KY +++  + +  S   ++C  GY           LS      C K G W K  T  C P KC  PP  +N             L  K + P    +V++ C   + L+G  +  CL         P C+ +     P
Sbjct: 1708 GKKCLE-PVKCKDPGEIENGNYSGNHFGVGSQLMFSCHEGYDLIGLVKVTCLESGEWDDALPCNEGYTLIGNEETVCLANRSWSHALPTCESVTCSKPKEIENGIFSLSGLTFNSTASYACKTGYSYTLVGPDTINCSSSGKWSEHIPQCMAVSC---DEPPNVDYASSHSSHRLFGDTAYYYCSDGYSMV--------DNAQMLCNTEGNWVPPDGKEIPNCIADFCERPS----SVAHSILESVNKAKFVSGSTVSFKCMEGFVLNTTARIECVRGGQWIPSSLTIQCIPVRCGEPPSIKNGYVSGTNYSFGSVVAYSCDKGYYIKGEKK-RTCLASGEWSGRLPA--------CHPGSCDDPPKLENGFVKSKTGLLYE-----SKVIYACNPGYKLVGSNVRVCQLNRHWYSESPPTCVLLTCE-KPPPVKYGSMKGENFEVGSKVEFFCEDGY----------ELSGDLSWTCQKNGEWDKKQTPTCMPSKCQDPPLYEN------------HLVLKEV-PNEVGIVRFSCKEGHVLEGSSVLKCLPSQQWNDSFPLCKLVFCSSPP 2225          

HSP 9 Score: 82.4185 bits (202), Expect = 1.871e-15
Identity = 131/541 (24.21%), Postives = 201/541 (37.15%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYA--LKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIK--------CEKKSC---GKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKW--SGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKV-AYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKC-LLHC-KPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWN--FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIH-NRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCEFI 1946
            + C  P +  NG  + S L       Y CK+GY+  L GP    C ++ + S   P+C   +  C   P + Y   H  S+   F  G+     C +GY     + ++    GN    D  +        CE+ S      LE     + +  +  +++      C +GF +  T         R +C   G+W  S  T  C  + C E    +NG V G   +  S+  + C +GY + G   R C   G W G    C   +C  PP++    V +     + ++  Y C     L+G    +          W  +  P C LL C KP  V    +      K  NF +      G+ V   C  GYEL+ D+   C  NG W+    P C+ + C   PP  +   V         + R+ C  G+ +    +G   L  +   + N       P   C+   C+ PP    GE               S+  ++    VKY C   + LKG  +  C  +G WS P  P C  I
Sbjct: 1799 VTCSKPKEIENGIFSLSGLTFNSTASYACKTGYSYTLVGPDTINCSSSGKWSEHIPQCMAVS--CDEPPNVDYASSH--SSHRLF--GDTAYYYCSDGYSMVDNAQMLCNTEGNWVPPDGKEIPNCIADFCERPSSVAHSILESVNKAKFVSGSTVSFK------CMEGFVLNTTA--------RIECVRGGQWIPSSLTIQCIPVRCGEPPSIKNGYVSGTNYSFGSVVAYSCDKGYYIKGEKKRTCLASGEWSGRLPACHPGSCDDPPKLENGFVKSKTGLLYESKVIYACNPGYKLVGSNVRV----CQLNRHWYSESPPTCVLLTCEKPPPVKYGSM------KGENFEV------GSKVEFFCEDGYELSGDLSWTCQKNGEWDKKQTPTCMPSKCQ-DPPLYENHLVLKEVPNEVGIVRFSCKEGHVL----EGSSVLKCLPSQQWND----SFPL--CKLVFCSSPPELAYGEPI-------------SVPSLYFGSTVKYTCVDGFLLKGESVITCNASGMWS-PDFPNCSPI 2278          

HSP 10 Score: 73.1738 bits (178), Expect = 1.333e-12
Identity = 55/188 (29.26%), Postives = 83/188 (44.15%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNE-WKYDPIKCEKKSCGKLEDPKNG--RTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSG 941
            +  +C+ P QP NGHA +  + VG  V Y C++GY L+G     C  N   S   P C  + + C     IP   +   +   DF  G+ V I C+ GY+   +   +  CN +E W    +KCEK SCG     +NG  R MY   + +  +    C  G+ +          + R  C  +G W+ 
Sbjct: 3134 VKTRCEVPQQPENGHAEYENVTVGSTVRYQCQNGYTLEGEDLAECTTNGTWSHPVPIC--KANPCPVPFVIPENAILTET---DFYVGQKVSIKCRKGYQ--LQGQAVITCNADETWTDANVKCEKISCGPPHTIQNGILRGMY---HQFGDVVTYSCYSGYMLL--------GSFRSVCLENGTWTA 3303          

HSP 11 Score: 71.633 bits (174), Expect = 4.068e-12
Identity = 134/594 (22.56%), Postives = 199/594 (33.50%), Query Frame = 3
Query:  567 QTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAK-----CNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQF-CNDGF------KIQCT---------------------TDQFEDKNCRRQ-----CQADGKWSGDTAICTA-ILCPELSPPENGEVMGVWNTVNSIKTFKC--------------------------KEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCK---------------------------------------------SRSTLIGETSFLTCGE----VDN-------KSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGSWNFIP-----RCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWT-KMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCEFIMHDELP 1964
            ++  C   P +  T  H ++ + D K G  + + C  G++      I+ K      N  EW      CE+ SCGK    +NG   YN    +    + + CN G+      ++ CT                     +D  E  +C        C     + GD   C   + C +    ENG   G    V S   F C                           EGY L G+    C    +W  +  TC    C  P EI     +    T  + A Y CK                                             S   L G+T++  C +    VDN       +  W+P P+ K + +C     +      H   ++ N     +   G+ V  KC  G+ LN+     C  G   +IP     +C+   C   PPS+K   V   +    S+  Y C  GYYI   K      S         G W+ ++P   C P  C  PP  +NG +       +T L       ++   V Y C+P Y+L G  + VC LN HW     PTC  +  ++ P
Sbjct: 1552 KSKFCADCPALEGTSPHLHATKSDHKPGSKISLFCNPGFQ------IVGKPERQCLNLGEWDQPLPHCERISCGKPPRLENG--FYNAEDLFAGSTVTYQCNIGYYLLGDSRMFCTDNGSWNGISPSCLDVDECEIGSDCDEHASCMNTNGSYICTCIPPYHGDGKKCLEPVKCKDPGEIENGNYSGNHFGVGSQLMFSCHEGYDLIGLVKVTCLESGEWDDALPCNEGYTLIGNEETVCLANRSWSHALPTCESVTCSKPKEIENGIFSLSGLTFNSTASYACKTGYSYTLVGPDTINCSSSGKWSEHIPQCMAVSCDEPPNVDYASSHSSHRLFGDTAYYYCSDGYSMVDNAQMLCNTEGNWVP-PDGKEIPNCIADFCERPSSVAHSILESVN---KAKFVSGSTVSFKCMEGFVLNTTARIECVRGG-QWIPSSLTIQCIPVRC-GEPPSIKNGYVSGTNYSFGSVVAYSCDKGYYIKGEKKRTCLAS---------GEWSGRLPA--CHPGSCDDPPKLENGFV-----KSKTGL-------LYESKVIYACNPGYKLVGSNVRVCQLNRHWYSESPPTCVLLTCEKPP 2108          

HSP 12 Score: 64.6994 bits (156), Expect = 5.382e-10
Identity = 55/194 (28.35%), Postives = 84/194 (43.30%), Query Frame = 3
Query:  942 DTAICTAILCPELSPPENGE-VMGVWNT-VNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKV--AYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCL-LHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNS--DILPACYNGSWN 1502
            + ++C  + CPEL PPENG  V  + N   ++    +CK GY L GS++R C   G W GS++TC VR C     +   ++  +   T++G      C     L G +  L  G     S W  K  P+C  +HC  F   +  +    N         +   +G      CN G+ L+   D +    NG W+
Sbjct:  346 EGSVCKVVHCPELRPPENGYFVQNICNNHFDAACGIRCKTGYDLVGSNIRLCQPNGLWTGSDATCRVRTCPKLHTLEHGRMNCSSSDTSYGTMCIAYCNDGYVLEGSSKLLCLG----SSQWDSK-VPQCKEMHCPVFHKPNGVLSSPSN------CGQEPAKYGYSCHVGCNKGFMLSGVKDKIKCVANGKWS 528          
BLAST of C4b binding protein beta chain vs. Ensembl Xenopus
Match: SVEP1 (sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1 [Source:NCBI gene;Acc:100493788])

HSP 1 Score: 111.694 bits (278), Expect = 1.632e-24
Identity = 136/559 (24.33%), Postives = 210/559 (37.57%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMH-DEVTHGTHVRAKCNFGYE-LNSDILPACYNGSWNF-IPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEI------------------YLLGQ--SDRTRLTDKSIKP------------------IHNRVVKYE--------CHPLYRLKGPKIAVCLN-GHWSP 1919
            ++C  P  P NG  +++   +G  V + CK GY L G  K  C AN + +   P+C         +   P   +H  +   ++     +   C  GY+    S    + +  +W  +   C   SCG+     NG+ +  N YT+       CN+G+++             R C  +G WSG T  C AI C   +   NGEV G    V     ++C  GY++ G+    C  +G W+ +   C   +C PP +I    +      +     Y C     + G ++     +      W   P P CL    P +  +  V         N IM  D+ T G  V  KC  G++ L S  L     G W+   P C +  C   PPS+  + +   S   +   RY C  GY +  + + + T          +G W+K P   CQ   C  PP+  N  +                  Y++ Q  S +T L D S  P                  I N   +Y+        C   Y L GP  + C+N G+W P
Sbjct: 2544 IECSIPTDPENGVMHYTDNTIGSSVHFECKPGYELNGSDKSICLANKQWNNEIPKCV------IISCKTPNKILHGYTEVSNYTYMSVIHYKCDKGYQIYGLSQRTCQIS-KQWDGEEPICVPVSCGQPPMVINGKVI-GNEYTFSKTIEYVCNEGYRLYGEE--------IRTCLENGNWSGTTPSCLAITCKISTTVNNGEVTGTECGVGKEILYRCNHGYKMQGTPKLTCLNDGTWNSNAPLCEPIHCEPPEDISNGYLNSSNFKYNEYIHYVCFPGYEMHGSSTR----QCLANGAWSGSP-PTCL----PCECPTPVV--------QNGIMSGDDFTCGHSVSIKCREGFKLLGSSELTCQSAGKWSSGFPHCGKVPCGP-PPSIPNAFINGSSSTDEDAIRYNCVAGYIMQGKSELLCT---------KEGVWSK-PYPNCQLLSCGLPPSVLNAVLIADSYTYGSTANYRCQDGYVMHQDVSSKTCLEDGSWSPGDIVCVPKKCLLQSTLIQIKNDETEYDINKTITIVCKEGYTLTGPSTSTCMNDGNWIP 3058          

HSP 2 Score: 105.531 bits (262), Expect = 1.425e-22
Identity = 99/376 (26.33%), Postives = 148/376 (39.36%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKC-LLHCK-PFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILP-ACY-NGSWN 1502
            + + C  P   +NG    +       +EY C  GY L G   R C  N   SG+ P C   T        I  T  +      +   G+++   C +GY+      +    N   W  +   CE   C   ED  NG  + ++N+ Y       C  G+++  ++         RQC A+G WSG    C    CP     +NG + G   T     + KC+EG++L GS    C   G W      C    CGPPP I  A +   ++T      Y C +   + G++  L       K G   KP P C LL C  P  V +A             ++ D  T+G+    +C  GY ++ D+    C  +GSW+
Sbjct: 2658 VPVSCGQPPMVINGKVIGNEYTFSKTIEYVCNEGYRLYGEEIRTCLENGNWSGTTPSCLAITC------KISTTVNNGEVTGTECGVGKEILYRCNHGYKMQGTPKLTCL-NDGTWNSNAPLCEPIHCEPPEDISNGY-LNSSNFKYNEYIHYVCFPGYEMHGSS--------TRQCLANGAWSGSPPTCLPCECP-TPVVQNGIMSGDDFTCGHSVSIKCREGFKLLGSSELTCQSAGKWSSGFPHCGKVPCGPPPSIPNAFINGSSSTDEDAIRYNCVAGYIMQGKSELLC-----TKEGVWSKPYPNCQLLSCGLPPSVLNA------------VLIADSYTYGSTANYRCQDGYVMHQDVSSKTCLEDGSWS 2999          

HSP 3 Score: 103.219 bits (256), Expect = 7.464e-22
Identity = 114/460 (24.78%), Postives = 168/460 (36.52%), Query Frame = 3
Query:  375 VCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQV-----------------------------------------HDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYN-GSWNF-IPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGY 1625
            +C EI   C PP    NG    +    G  + ++C  G+ L G   + C+ +   S S P C   TD C   P+I + Q                                           +NS   ++  G +V   C NGYE    S +  K +G  W      C    C    DP+NG   Y +N    S+  + C  G+++  +         +  C A+ +W+ +   C  I C   +   +G       T  S+  +KC +GYQ++G   R C     WDG    C+  +CG PP ++  KV     T     EY C     L GE    TC E  N SG      P CL         + K+    NN     +   E   G  +  +CN GY++       C N G+WN   P C    C   P  +    +   + K++    Y C  GY
Sbjct: 2380 ICKEI--TCDPPQGIDNGFVEGADYSYGAMIIFSCMPGFQLVGLAMQTCEES-GWSSSTPVCL-HTD-CGLPPHIDFGQYTIVTFEEKILTDDELKHSIFGVSNIILSPTTTSNTLKTENHSENSQLSEYLYGTNVIYSCNNGYEILGMSVLTCKEDGT-WNGSAPACAPIECSIPTDPENGVMHYTDNTIGSSVHFE-CKPGYELNGSD--------KSICLANKQWNNEIPKCVIISCKTPNKILHGYTEVSNYTYMSVIHYKCDKGYQIYGLSQRTCQISKQWDGEEPICVPVSCGQPPMVINGKVIGNEYTFSKTIEYVCNEGYRLYGE-EIRTCLENGNWSG----TTPSCL-------AITCKISTTVNNGE---VTGTECGVGKEILYRCNHGYKMQGTPKLTCLNDGTWNSNAPLCEPIHCEP-PEDISNGYLNSSNFKYNEYIHYVCFPGY 2808          

HSP 4 Score: 101.679 bits (252), Expect = 2.229e-21
Identity = 136/526 (25.86%), Postives = 211/526 (40.11%), Query Frame = 3
Query:  378 CMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQAN---LRLSGSE-PECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKC-NGNEW--KYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKT-FKCKEGYQLHGSHLRKCTREGNW-DGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSG-WLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYEL-NSDILPACYNGSWN-FIPRCVEAACSARPPSMKYST-VRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHW 1913
            CM +     P V   + H++H   L GD   Y C  GY++    +  C      +   G E P C    D C     + ++ + ++ N+  F +G  V   C  G+     + I  +C  G +W      I+C    CG+    KNG  +   NY++ S+    C+ G+ I+           +R C A G+WSG    C    C +    ENG V      +   K  + C  GY+L GS++R C    +W   S  TC++  C  PP + +  +  E    G++ E+ C+    L G+ S+ TC     K+G W  K  P C+    P +     +Y  EN+     ++ +       VR  C  G+ L  S +L    +  WN   P C    CS+ PP + Y   +   SL   S  +Y C  G+   L+ + +        I CN           C P +C +P    NG + + G      LT  S          Y C P Y L G    +C  +G+W
Sbjct: 1846 CMAVSCDEPPNVDYASSHSSHR--LFGDTAYYYCSDGYSMVDNAQMLCNTEGNWVPPDGKEIPNCI--ADFCERPSSVAHS-ILESVNKAKFVSGSTVSFKCMEGFVLNTTARI--ECVRGGQWIPSSLTIQCIPVRCGEPPSIKNGY-VSGTNYSFGSVVAYSCDKGYYIKGEK--------KRTCLASGEWSGRLPACHPGSCDDPPKLENGFVKSKTGLLYESKVIYACNPGYKLVGSNVRVCQLNRHWYSESPPTCVLLTCEKPPPVKYGSMKGENFEVGSKVEFFCEDGYELSGDLSW-TC----QKNGEWDKKQTPTCM----PSKCQDPPLY--ENH----LVLKEVPNEVGIVRFSCKEGHVLEGSSVLKCLPSQQWNDSFPLCKLVFCSS-PPELAYGEPISVPSLYFGSTVKYTCVDGFL--LKGESV--------ITCNASGMWSPDFPNCSPIECPQPEEILNGIVDVQG------LTFLS-------AALYTCKPGYELIGNSTLICGADGYW 2316          

HSP 5 Score: 92.8189 bits (229), Expect = 1.102e-18
Identity = 127/541 (23.48%), Postives = 191/541 (35.30%), Query Frame = 3
Query:  567 QTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAK-----CNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSG---------------------------DTAICTAI--------------LCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWD--------GSNST--------------CIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGSWNFIP-----RCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWT-KMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCEFIMHDELP 1964
            ++  C   P +  T  H ++ + D K G  + + C  G++      I+ K      N  EW      CE+ SCGK    +NG   YN    +    + +       QC    +   + R  C  +G W+G                            + ICT I               C +    ENG   G    V S   F C EGY L G     C   G WD        G ++               C+  +C  PP + +A         G  A Y C    +++     L     + +  W+P P+ K + +C     +      H   ++ N     +   G+ V  KC  G+ LN+     C  G   +IP     +C+   C   PPS+K   V   +    S+  Y C  GYYI   K      S         G W+ ++P   C P  C  PP  +NG +       +T L       ++   V Y C+P Y+L G  + VC LN HW     PTC  +  ++ P
Sbjct: 1606 KSKFCADCPALEGTSPHLHATKSDHKPGSKISLFCNPGFQ------IVGKPERQCLNLGEWDQPLPHCERISCGKPPRLENG--FYNAEDLFAGSTVTY-------QCNIGYYLLGDSRMFCTDNGSWNGISPSCLDVDECEIGSDCDEHASCMNTNGSYICTCIPPYHGDGKKCLEPVKCKDPGEIENGNYSGNHFGVGSQLMFSCHEGYDLIGLVKVTCLESGEWDDALPYTLVGPDTINCSSSGKWSEHIPQCMAVSCDEPPNVDYASSHSSHRLFGDTAYYYCSDGYSMVDNAQML----CNTEGNWVP-PDGKEIPNCIADFCERPSSVAHSILESVN---KAKFVSGSTVSFKCMEGFVLNTTARIECVRGG-QWIPSSLTIQCIPVRC-GEPPSIKNGYVSGTNYSFGSVVAYSCDKGYYIKGEKKRTCLAS---------GEWSGRLPA--CHPGSCDDPPKLENGFV-----KSKTGL-------LYESKVIYACNPGYKLVGSNVRVCQLNRHWYSESPPTCVLLTCEKPP 2098          

HSP 6 Score: 92.4337 bits (228), Expect = 1.751e-18
Identity = 120/529 (22.68%), Postives = 195/529 (36.86%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNS-NRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGSWNFIPR-----CVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGM----ETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCE 1940
            + + C+      NG    +   VG ++ Y C  GY ++G  K  C  +   + + P       LC      P   + +   N  +FK  E +  +C  GYE    S      NG  W   P  C    C      +NG    ++     S++I+ C +GFK+  +++          CQ+ GKWS     C  + C       N  + G  +T      + C  GY + G     CT+EG W      C + +CG PP ++ A +  ++ T+G+ A Y+C+    +  + S  TC E      W P       + C P +       I   N  T + ++  +T        C  GY L       C N   N+IP      C   +C   P + ++  V            Y C+ G+ +      +    +  ST+   K  +    + P                       G ++   +T  S        V+Y+C   Y L+G  +A C  NG WS P +P C+
Sbjct: 2716 LAITCKISTTVNNGEVTGTECGVGKEILYRCNHGYKMQGTPKLTCLNDGTWNSNAP-------LCEPIHCEPPEDISNGYLNSSNFKYNEYIHYVCFPGYEMHGSSTRQCLANG-AWSGSPPTCLPCEC-PTPVVQNGIMSGDDFTCGHSVSIK-CREGFKLLGSSE--------LTCQSAGKWSSGFPHCGKVPCGPPPSIPNAFINGSSSTDEDAIRYNCVAGYIMQGKSELLCTKEGVWSKPYPNCQLLSCGLPPSVLNAVLIADSYTYGSTANYRCQDGYVMHQDVSSKTCLE---DGSWSPGD-----IVCVPKKCLLQSTLIQIKNDETEYDINKTIT------IVCKEGYTLTGPSTSTCMNDG-NWIPEVNNNICTPVSC-GEPAAPEHGIVLGTRYLFKDSLHYSCNHGFELNGPSRRICHIDKHQSTVGKCKKTRCEVPQQPEN---------------------GHAEYENVTVGS-------TVRYQCQNGYTLEGEDLAECTTNGTWSHP-VPICK 3181          

HSP 7 Score: 85.1149 bits (209), Expect = 2.781e-16
Identity = 106/464 (22.84%), Postives = 162/464 (34.91%), Query Frame = 3
Query:  396 QCQPPVQPVNGHA-NHSILLVGDQVEYTCKSGYALKGPRKRYCQANLR-LSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYE-----------------------------DP--YKSHIIAKCNGNE---------------------------WKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQ-VDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGSW-NFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLA 1601
             C  P +  NG   + + LL   +V Y C  GY L G   R CQ N    S S P C   T  C   P + Y  +      ++F+ G  V+  C++GYE                             DP  Y++H++ K   NE                           W      C+   C    +   G  +   +  + S     C DGF ++  +           C A G WS D   C+ I CP+     NG V     T  S   + CK GY+L G+    C  +G W G    C    C    EI+  K ++++  +G    Y C     L G+ + LTC E      W   P     + C P Q +D+             F+   + ++G  +   C  G++L    +  C    W +  P C+   C   PP + +     ++ +   L 
Sbjct: 2033 SCDDPPKLENGFVKSKTGLLYESKVIYACNPGYKLVGSNVRVCQLNRHWYSESPPTCVLLT--CEKPPPVKYGSMKG----ENFEVGSKVEFFCEDGYELSGDLSWTCQKNGEWDKKQTPTCMPSKCQDPPLYENHLVLKEVPNEVGIVRFSCKEGHVLEGSSVLKCLPSQQWNDSFPLCKLVFCSSPPELAYGEPISVPSLYFGSTVKYTCVDGFLLKGES--------VITCNASGMWSPDFPNCSPIECPQPEEILNGIVDVQGLTFLSAALYTCKPGYELIGNSTLICGADGYWQGGKPICKPIKCSKAKEILNGKFSFQSLNYGQTITYTCNRGFRLEGQ-NVLTCLETGE---WNSNPPICKEITCDPPQGIDNG------------FVEGADYSYGAMIIFSCMPGFQLVGLAMQTCEESGWSSSTPVCLHTDC-GLPPHIDFGQYTIVTFEEKILT 2465          

HSP 8 Score: 83.9593 bits (206), Expect = 6.106e-16
Identity = 138/600 (23.00%), Postives = 207/600 (34.50%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLC--------------FSAPYI----------------------PYTQVHDNSNRDDFKNGEDVKIICQNGYED------------------PYK---SHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNG--RTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKW----SGDTAICTAILCPELSPPENGEVMGVWNTVNSIK-------TFKCKEGYQLHGSHLRKCTREGNWDGSNST--CIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSW--NFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNK-GNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTCEFIMHDELP 1964
            + C  P +  NG  N   L  G  V Y C  GY L G  + +C  N   +G  P C D  D C               +  YI                      P    + N + + F  G  +   C  GY+                   PY       I   +  +W     +C   SC   ++P N    + ++++  +   A  +C+DG+ +          N +  C  +G W      +   C A  C   S         +  +VN  K       +FKC EG+ L+ +   +C R G W  S+ T  CI   CG PP I    V+    + G+   Y C     + GE    TC      SG LP         C P   D      +   K+   ++++     + V   CN GY+L    +  C  N  W     P CV   C  +PP +KY +++  + +  S   ++C  GY           LS      C K G W K  T  C P KC  PP  +N             L  K + P    +V++ C   + L+G  +  CL         P C+ +     P
Sbjct: 1670 ISCGKPPRLENGFYNAEDLFAGSTVTYQCNIGYYLLGDSRMFCTDNGSWNGISPSCLD-VDECEIGSDCDEHASCMNTNGSYICTCIPPYHGDGKKCLEPVKCKDPGEIENGNYSGNHFGVGSQLMFSCHEGYDLIGLVKVTCLESGEWDDALPYTLVGPDTINCSSSGKWSEHIPQCMAVSC---DEPPNVDYASSHSSHRLFGDTAYYYCSDGYSMV--------DNAQMLCNTEGNWVPPDGKEIPNCIADFCERPS----SVAHSILESVNKAKFVSGSTVSFKCMEGFVLNTTARIECVRGGQWIPSSLTIQCIPVRCGEPPSIKNGYVSGTNYSFGSVVAYSCDKGYYIKGEKK-RTCLASGEWSGRLPA--------CHPGSCDDPPKLENGFVKSKTGLLYE-----SKVIYACNPGYKLVGSNVRVCQLNRHWYSESPPTCVLLTCE-KPPPVKYGSMKGENFEVGSKVEFFCEDGY----------ELSGDLSWTCQKNGEWDKKQTPTCMPSKCQDPPLYEN------------HLVLKEV-PNEVGIVRFSCKEGHVLEGSSVLKCLPSQQWNDSFPLCKLVFCSSPP 2215          

HSP 9 Score: 76.6406 bits (187), Expect = 1.204e-13
Identity = 133/569 (23.37%), Postives = 209/569 (36.73%), Query Frame = 3
Query:  369 GLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGY----------------------ALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIK--------CEKKSC---GKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKW--SGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKV-AYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKC-LLHC-KPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWN--FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIH-NRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCEFI 1946
            G  C+E  ++C+ P +  NG+ + +   VG Q+ ++C  GY                       L GP    C ++ + S   P+C   +  C   P + Y   H  S+   F  G+     C +GY     + ++    GN    D  +        CE+ S      LE     + +  +  +++      C +GF +  T         R +C   G+W  S  T  C  + C E    +NG V G   +  S+  + C +GY + G   R C   G W G    C   +C  PP++    V +     + ++  Y C     L+G    +          W  +  P C LL C KP  V    +      K  NF +      G+ V   C  GYEL+ D+   C  NG W+    P C+ + C   PP  +   V         + R+ C  G+ +    +G   L  +   + N       P   C+   C+ PP    GE               S+  ++    VKY C   + LKG  +  C  +G WS P  P C  I
Sbjct: 1762 GKKCLE-PVKCKDPGEIENGNYSGNHFGVGSQLMFSCHEGYDLIGLVKVTCLESGEWDDALPYTLVGPDTINCSSSGKWSEHIPQCMAVS--CDEPPNVDYASSH--SSHRLF--GDTAYYYCSDGYSMVDNAQMLCNTEGNWVPPDGKEIPNCIADFCERPSSVAHSILESVNKAKFVSGSTVSFK------CMEGFVLNTTA--------RIECVRGGQWIPSSLTIQCIPVRCGEPPSIKNGYVSGTNYSFGSVVAYSCDKGYYIKGEKKRTCLASGEWSGRLPACHPGSCDDPPKLENGFVKSKTGLLYESKVIYACNPGYKLVGSNVRV----CQLNRHWYSESPPTCVLLTCEKPPPVKYGSM------KGENFEV------GSKVEFFCEDGYELSGDLSWTCQKNGEWDKKQTPTCMPSKCQ-DPPLYENHLVLKEVPNEVGIVRFSCKEGHVL----EGSSVLKCLPSQQWND----SFPL--CKLVFCSSPPELAYGEPI-------------SVPSLYFGSTVKYTCVDGFLLKGESVITCNASGMWS-PDFPNCSPI 2268          

HSP 10 Score: 72.4034 bits (176), Expect = 2.298e-12
Identity = 55/185 (29.73%), Postives = 82/185 (44.32%), Query Frame = 3
Query:  396 QCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNE-WKYDPIKCEKKSCGKLEDPKNG--RTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSG 941
            +C+ P QP NGHA +  + VG  V Y C++GY L+G     C  N   S   P C  + + C     IP   +   +   DF  G+ V I C+ GY+   +   +  CN +E W    +KCEK SCG     +NG  R MY   + +  +    C  G+ +          + R  C  +G W+ 
Sbjct: 3126 RCEVPQQPENGHAEYENVTVGSTVRYQCQNGYTLEGEDLAECTTNGTWSHPVPIC--KANPCPVPFVIPENAILTET---DFYVGQKVSIKCRKGYQ--LQGQAVITCNADETWTDANVKCEKISCGPPHTIQNGILRGMY---HQFGDVVTYSCYSGYMLL--------GSFRSVCLENGTWTA 3292          

HSP 11 Score: 64.6994 bits (156), Expect = 5.520e-10
Identity = 55/194 (28.35%), Postives = 84/194 (43.30%), Query Frame = 3
Query:  942 DTAICTAILCPELSPPENGE-VMGVWNT-VNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKV--AYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCL-LHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNS--DILPACYNGSWN 1502
            + ++C  + CPEL PPENG  V  + N   ++    +CK GY L GS++R C   G W GS++TC VR C     +   ++  +   T++G      C     L G +  L  G     S W  K  P+C  +HC  F   +  +    N         +   +G      CN G+ L+   D +    NG W+
Sbjct:  346 EGSVCKVVHCPELRPPENGYFVQNICNNHFDAACGIRCKTGYDLVGSNIRLCQPNGLWTGSDATCRVRTCPKLHTLEHGRMNCSSSDTSYGTMCIAYCNDGYVLEGSSKLLCLG----SSQWDSK-VPQCKEMHCPVFHKPNGVLSSPSN------CGQEPAKYGYSCHVGCNKGFMLSGVKDKIKCVANGKWS 528          

HSP 12 Score: 62.7734 bits (151), Expect = 1.926e-9
Identity = 89/386 (23.06%), Postives = 135/386 (34.97%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYAL-KGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEW--KYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTH-GAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEV-THGTHVRAKCNFGYELNSDILPACY-NGSWNFIPRCVEAAC 1532
            L C  P   +N          G    Y C+ GY + +    + C  +   S  +  C  +  L  S      T +   ++  ++   + + I+C+ GY     S      +GN W  + +   C   SCG+   P++G  +    Y ++      CN GF++   +        RR C  D K       C    C     PENG       TV S   ++C+ GY L G  L +CT  G W      C    C  P  I    +  E   + G +   KC+    L G+ + +TC   +    W                V   K+     +   N I+       G  V   C  GY L       C  NG+W   P C +A C
Sbjct: 2949 LSCGLPPSVLNAVLIADSYTYGSTANYRCQDGYVMHQDVSSKTCLEDGSWSPGDIVCVPKKCLLQS------TLIQIKNDETEYDINKTITIVCKEGYTLTGPSTSTCMNDGN-WIPEVNNNICTPVSCGEPAAPEHGIVL-GTRYLFKDSLHYSCNHGFELNGPS--------RRICHID-KHQSTVGKCKKTRCEVPQQPENGHAEYENVTVGSTVRYQCQNGYTLEGEDLAECTTNGTWSHPVPICKANPCPVPFVIPENAILTETDFYVGQKVSIKCRKGYQLQGQ-AVITC---NADETWTDA------------NVKCEKISCGPPHTIQNGILRGMYHQFGDVVTYSCYSGYMLLGSFRSVCLENGTWTAPPSC-KAVC 3300          
BLAST of C4b binding protein beta chain vs. Ensembl Xenopus
Match: SVEP1 (sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1 [Source:NCBI gene;Acc:100493788])

HSP 1 Score: 111.694 bits (278), Expect = 1.638e-24
Identity = 136/559 (24.33%), Postives = 210/559 (37.57%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMH-DEVTHGTHVRAKCNFGYE-LNSDILPACYNGSWNF-IPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEI------------------YLLGQ--SDRTRLTDKSIKP------------------IHNRVVKYE--------CHPLYRLKGPKIAVCLN-GHWSP 1919
            ++C  P  P NG  +++   +G  V + CK GY L G  K  C AN + +   P+C         +   P   +H  +   ++     +   C  GY+    S    + +  +W  +   C   SCG+     NG+ +  N YT+       CN+G+++             R C  +G WSG T  C AI C   +   NGEV G    V     ++C  GY++ G+    C  +G W+ +   C   +C PP +I    +      +     Y C     + G ++     +      W   P P CL    P +  +  V         N IM  D+ T G  V  KC  G++ L S  L     G W+   P C +  C   PPS+  + +   S   +   RY C  GY +  + + + T          +G W+K P   CQ   C  PP+  N  +                  Y++ Q  S +T L D S  P                  I N   +Y+        C   Y L GP  + C+N G+W P
Sbjct: 2629 IECSIPTDPENGVMHYTDNTIGSSVHFECKPGYELNGSDKSICLANKQWNNEIPKCV------IISCKTPNKILHGYTEVSNYTYMSVIHYKCDKGYQIYGLSQRTCQIS-KQWDGEEPICVPVSCGQPPMVINGKVI-GNEYTFSKTIEYVCNEGYRLYGEE--------IRTCLENGNWSGTTPSCLAITCKISTTVNNGEVTGTECGVGKEILYRCNHGYKMQGTPKLTCLNDGTWNSNAPLCEPIHCEPPEDISNGYLNSSNFKYNEYIHYVCFPGYEMHGSSTR----QCLANGAWSGSP-PTCL----PCECPTPVV--------QNGIMSGDDFTCGHSVSIKCREGFKLLGSSELTCQSAGKWSSGFPHCGKVPC-GPPPSIPNAFINGSSSTDEDAIRYNCVAGYIMQGKSELLCT---------KEGVWSK-PYPNCQLLSCGLPPSVLNAVLIADSYTYGSTANYRCQDGYVMHQDVSSKTCLEDGSWSPGDIVCVPKKCLLQSTLIQIKNDETEYDINKTITIVCKEGYTLTGPSTSTCMNDGNWIP 3143          

HSP 2 Score: 105.531 bits (262), Expect = 1.493e-22
Identity = 99/376 (26.33%), Postives = 148/376 (39.36%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKC-LLHCK-PFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILP-ACY-NGSWN 1502
            + + C  P   +NG    +       +EY C  GY L G   R C  N   SG+ P C   T        I  T  +      +   G+++   C +GY+      +    N   W  +   CE   C   ED  NG  + ++N+ Y       C  G+++  ++         RQC A+G WSG    C    CP     +NG + G   T     + KC+EG++L GS    C   G W      C    CGPPP I  A +   ++T      Y C +   + G++  L       K G   KP P C LL C  P  V +A             ++ D  T+G+    +C  GY ++ D+    C  +GSW+
Sbjct: 2743 VPVSCGQPPMVINGKVIGNEYTFSKTIEYVCNEGYRLYGEEIRTCLENGNWSGTTPSCLAIT------CKISTTVNNGEVTGTECGVGKEILYRCNHGYKMQGTPKLTCL-NDGTWNSNAPLCEPIHCEPPEDISNGY-LNSSNFKYNEYIHYVCFPGYEMHGSS--------TRQCLANGAWSGSPPTCLPCECP-TPVVQNGIMSGDDFTCGHSVSIKCREGFKLLGSSELTCQSAGKWSSGFPHCGKVPCGPPPSIPNAFINGSSSTDEDAIRYNCVAGYIMQGKSELLC-----TKEGVWSKPYPNCQLLSCGLPPSVLNA------------VLIADSYTYGSTANYRCQDGYVMHQDVSSKTCLEDGSWS 3084          

HSP 3 Score: 98.2117 bits (243), Expect = 2.664e-20
Identity = 126/522 (24.14%), Postives = 196/522 (37.55%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWS-GDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAK-VAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSG-WLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSW-NFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTC 1937
            I ++C  P    NG+ + +    G  V Y+C  GY +KG +KR C A+   SG  P C   +  C   P +    V    ++        V   C  GY+    +  + + N + +   P  C   +C K    K G +M   N+   S    FC DG+++          +    CQ +G+W    T  C    C +    EN  V+        I  F CKEG+ L GS + KC     W+ S   C +  C  PPE+ + + ++  +   G+  +Y C     L GE S +TC    N SG W P        +C P +    +  ++        +    +T  +     C  GYEL  +    C  +G W    P C    CS +   +      F SL +     Y C+ G+    R +G   L+ +       G W   P   C+   C  P    NG +     S             +  ++ + C P ++L G  +  C    WS    P C
Sbjct: 2057 IPVRCGEPPSIKNGYVSGTNYSFGSVVAYSCDKGYYIKGEKKRTCLASGEWSGRLPACHPGS--CDDPPKLENGFVK---SKTGLLYESKVIYACNPGYKLVGSNVRVCQLNRHWYSESPPTCVLLTCEKPPPVKYG-SMKGENFEVGSKVEFFCEDGYELS--------GDLSWTCQKNGEWDKKQTPTCMPSKCQDPPLYENHLVLKEVPNEVGIVRFSCKEGHVLEGSSVLKCLPSQQWNDSFPLCKLVFCSSPPELAYGEPISVPSLYFGSTVKYTCVDGFLLKGE-SVITC----NASGMWSPD-----FPNCSPIECPQPEEILN------GIVDVQGLTFLSAALYTCKPGYELIGNSTLICGADGYWQGGKPICKPIKCS-KAKEILNGKFSFQSLNYGQTITYTCNRGF----RLEGQNVLTCL-----ETGEWNSNPPI-CKEITCDPPQGIDNGFVEGADYS-------------YGAMIIFSCMPGFQLVGLAMQTCEESGWS-SSTPVC 2523          

HSP 4 Score: 96.6709 bits (239), Expect = 6.796e-20
Identity = 126/525 (24.00%), Postives = 202/525 (38.48%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNS-NRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGSWNFIPR-----CVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCE 1940
            + + C+      NG    +   VG ++ Y C  GY ++G  K  C  +   + + P       LC      P   + +   N  +FK  E +  +C  GYE    S      NG  W   P  C    C      +NG    ++     S++I+ C +GFK+  +++          CQ+ GKWS     C  + C       N  + G  +T      + C  GY + G     CT+EG W      C + +CG PP ++ A +  ++ T+G+ A Y+C+    +  + S  TC E      W P       + C P +       I   N  T + ++  +T        C  GY L       C N   N+IP      C   +C   P + ++  V            Y C+ G+ I       E +  I       G W+ +  + C+  +C  P  P+N      G ++   +T  S        V+Y+C   Y L+G  +A C  NG WS P +P C+
Sbjct: 2801 LAITCKISTTVNNGEVTGTECGVGKEILYRCNHGYKMQGTPKLTCLNDGTWNSNAP-------LCEPIHCEPPEDISNGYLNSSNFKYNEYIHYVCFPGYEMHGSSTRQCLANG-AWSGSPPTCLPCEC-PTPVVQNGIMSGDDFTCGHSVSIK-CREGFKLLGSSE--------LTCQSAGKWSSGFPHCGKVPCGPPPSIPNAFINGSSSTDEDAIRYNCVAGYIMQGKSELLCTKEGVWSKPYPNCQLLSCGLPPSVLNAVLIADSYTYGSTANYRCQDGYVMHQDVSSKTCLE---DGSWSPGD-----IVCVPKKCLLQSTLIQIKNDETEYDINKTIT------IVCKEGYTLTGPSTSTCMNDG-NWIPEVNNNICTPVSC-GEPAAPEHGIVLGTRYLFKDSVLYQCNAGFEI---HGPTERVCQI------NGLWSDVEPQ-CKKTRCEVPQQPEN------GHAEYENVTVGS-------TVRYQCQNGYTLEGEDLAECTTNGTWSHP-VPICK 3267          

HSP 5 Score: 94.7449 bits (234), Expect = 3.384e-19
Identity = 102/447 (22.82%), Postives = 155/447 (34.68%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSC---GKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKW--SGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPT 1715
            + C PP    N   N S     D + Y C +GY ++G  +  C      S   P C         +  +P + ++     D +  G      CQ+GY                W    I C  K C     L   KN  T Y+ N T   +    C +G+ +   +           C  DG W    +  ICT + C E + PE+G V+G          ++C  G+++HG   R C   G W      C    C  P +       YE  T G+   Y+C++  TL GE       E      W   P P C  +  P         I EN      +   +   G  V  KC  GY+L    +  C  + +W       E      P +++   +R +  +   +  Y C+ GY +         L +   +    G WT  P+
Sbjct: 2976 VPCGPPPSIPNAFINGSSSTDEDAIRYNCVAGYIMQGKSELLCTKEGVWSKPYPNCQ------LLSCGLPPSVLNAVLIADSYTYGSTANYRCQDGYVMHQDVSSKTCLEDGSWSPGDIVCVPKKCLLQSTLIQIKNDETEYDINKTITIV----CKEGYTLTGPS--------TSTCMNDGNWIPEVNNNICTPVSCGEPAAPEHGIVLGTRYLFKDSVLYQCNAGFEIHGPTERVCQINGLWSDVEPQCKKTRCEVPQQPENGHAEYENVTVGSTVRYQCQNGYTLEGE----DLAECTTNGTW-SHPVPICKANPCP-----VPFVIPEN----AILTETDFYVGQKVSIKCRKGYQLQGQAVITCNADETWTDANVKCEKISCGPPHTIQNGILRGMYHQFGDVVTYSCYSGYML---------LGSFRSVCLENGTWTAPPS 3381          

HSP 6 Score: 91.6633 bits (226), Expect = 2.539e-18
Identity = 134/529 (25.33%), Postives = 199/529 (37.62%), Query Frame = 3
Query:  375 VCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWN-FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKC-NKGNW-TKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHW--SPPQMPTCE 1940
            +C EI   C PP    NG    +    G  + ++C  G+ L G   + C+ +   S S P C   TD C   P+I + Q    +  +        KI+     +D  K  I    N        I     +   L+   +      + Y Y +  I  CN+G++I   +           C+ DG W+G    C  I C   + PENG +    NT+ S   F+CK GY+L+GS    C     W+     C++ +C  P +I+         T+ +   YKC     + G  S  TC       G     EP C+    P       + I  N K    ++ +E T    +   CN GY L  + +  C  NG+W+   P C+   C       K ST    ++ +  +    C  G  I  R +    +     + C N G W +  P   C+P  C  P    NG            L   + K  +N  + Y C P Y + G     CL NG W  SPP    CE
Sbjct: 2465 ICKEI--TCDPPQGIDNGFVEGADYSYGAMIIFSCMPGFQLVGLAMQTCEES-GWSSSTPVCL-HTD-CGLPPHIDFGQYTIVTFEE--------KIL----TDDELKHSIFGVSN-------IILSPTTTSNTLKTENHSENSQLSEYLYGTNVIYSCNNGYEILGMS--------VLTCKEDGTWNGSAPACAPIECSIPTDPENGVMHYTDNTIGSSVHFECKPGYELNGSDKSICLANKQWNNEIPKCVIISCKTPNKILHGYTEVSNYTYMSVIHYKCDKGYQIYG-LSQRTCQISKQWDG----EEPICV----PVSCGQPPMVI--NGK----VIGNEYTFSKTIEYVCNEGYRLYGEEIRTCLENGNWSGTTPSCLAITC-------KIST----TVNNGEVTGTECGVGKEILYRCNHGYKMQGTPKLTCLNDGTWNSNAPL--CEPIHCEPPEDISNG-----------YLNSSNFK--YNEYIHYVCFPGYEMHGSSTRQCLANGAWSGSPPTCLPCE 2920          

HSP 7 Score: 84.7297 bits (208), Expect = 4.028e-16
Identity = 106/464 (22.84%), Postives = 162/464 (34.91%), Query Frame = 3
Query:  396 QCQPPVQPVNGHA-NHSILLVGDQVEYTCKSGYALKGPRKRYCQANLR-LSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYE-----------------------------DP--YKSHIIAKCNGNE---------------------------WKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQ-VDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGSW-NFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLA 1601
             C  P +  NG   + + LL   +V Y C  GY L G   R CQ N    S S P C   T  C   P + Y  +      ++F+ G  V+  C++GYE                             DP  Y++H++ K   NE                           W      C+   C    +   G  +   +  + S     C DGF ++  +           C A G WS D   C+ I CP+     NG V     T  S   + CK GY+L G+    C  +G W G    C    C    EI+  K ++++  +G    Y C     L G+ + LTC E      W   P     + C P Q +D+             F+   + ++G  +   C  G++L    +  C    W +  P C+   C   PP + +     ++ +   L 
Sbjct: 2118 SCDDPPKLENGFVKSKTGLLYESKVIYACNPGYKLVGSNVRVCQLNRHWYSESPPTCVLLT--CEKPPPVKYGSMKG----ENFEVGSKVEFFCEDGYELSGDLSWTCQKNGEWDKKQTPTCMPSKCQDPPLYENHLVLKEVPNEVGIVRFSCKEGHVLEGSSVLKCLPSQQWNDSFPLCKLVFCSSPPELAYGEPISVPSLYFGSTVKYTCVDGFLLKGES--------VITCNASGMWSPDFPNCSPIECPQPEEILNGIVDVQGLTFLSAALYTCKPGYELIGNSTLICGADGYWQGGKPICKPIKCSKAKEILNGKFSFQSLNYGQTITYTCNRGFRLEGQ-NVLTCLETGE---WNSNPPICKEITCDPPQGIDNG------------FVEGADYSYGAMIIFSCMPGFQLVGLAMQTCEESGWSSSTPVCLHTDC-GLPPHIDFGQYTIVTFEEKILT 2550          

HSP 8 Score: 82.0333 bits (201), Expect = 2.244e-15
Identity = 131/572 (22.90%), Postives = 213/572 (37.24%), Query Frame = 3
Query:  369 GLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEP------ECTDQTDLCFS----APYIPYTQVHDNSNRDDFKNG----------EDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNG--RTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKW----SGDTAICTAILCPELSPPENGEVMGVWNTVNSIK-------TFKCKEGYQLHGSHLRKCTREGNWDGSNST--CIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSW--NFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNK-GNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTCEFIMHDELP 1964
            G  C+E  ++C+ P +  NG+ + +   VG Q+ ++C  GY L G  K  C  +     + P         ++  +C +    +  +P  +    S   + +NG                C+ GY           C+ + +W     +C   SC   ++P N    + ++++  +   A  +C+DG+ +          N +  C  +G W      +   C A  C   S         +  +VN  K       +FKC EG+ L+ +   +C R G W  S+ T  CI   CG PP I    V+    + G+   Y C     + GE    TC      SG LP         C P   D      +   K+   ++++     + V   CN GY+L    +  C  N  W     P CV   C  +PP +KY +++  + +  S   ++C  GY           LS      C K G W K  T  C P KC  PP  +N             L  K + P    +V++ C   + L+G  +  CL         P C+ +     P
Sbjct: 1783 GKKCLE-PVKCKDPGEIENGNYSGNHFGVGSQLMFSCHEGYDLIGLVKVTCLESGEWDDALPCNEGYTLIGNEETVCLANRSWSHALPTCESVTCSKPKEIENGIFSLSGLTFNSTASYACKTGYSYTLVGPDTINCSSSGKWSEHIPQCMAVSC---DEPPNVDYASSHSSHRLFGDTAYYYCSDGYSMV--------DNAQMLCNTEGNWVPPDGKEIPNCIADFCERPS----SVAHSILESVNKAKFVSGSTVSFKCMEGFVLNTTARIECVRGGQWIPSSLTIQCIPVRCGEPPSIKNGYVSGTNYSFGSVVAYSCDKGYYIKGEKK-RTCLASGEWSGRLPA--------CHPGSCDDPPKLENGFVKSKTGLLYE-----SKVIYACNPGYKLVGSNVRVCQLNRHWYSESPPTCVLLTCE-KPPPVKYGSMKGENFEVGSKVEFFCEDGY----------ELSGDLSWTCQKNGEWDKKQTPTCMPSKCQDPPLYEN------------HLVLKEV-PNEVGIVRFSCKEGHVLEGSSVLKCLPSQQWNDSFPLCKLVFCSSPP 2300          

HSP 9 Score: 82.0333 bits (201), Expect = 2.486e-15
Identity = 131/541 (24.21%), Postives = 201/541 (37.15%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYA--LKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIK--------CEKKSC---GKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKW--SGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKV-AYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKC-LLHC-KPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWN--FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIH-NRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCEFI 1946
            + C  P +  NG  + S L       Y CK+GY+  L GP    C ++ + S   P+C   +  C   P + Y   H  S+   F  G+     C +GY     + ++    GN    D  +        CE+ S      LE     + +  +  +++      C +GF +  T         R +C   G+W  S  T  C  + C E    +NG V G   +  S+  + C +GY + G   R C   G W G    C   +C  PP++    V +     + ++  Y C     L+G    +          W  +  P C LL C KP  V    +      K  NF +      G+ V   C  GYEL+ D+   C  NG W+    P C+ + C   PP  +   V         + R+ C  G+ +    +G   L  +   + N       P   C+   C+ PP    GE               S+  ++    VKY C   + LKG  +  C  +G WS P  P C  I
Sbjct: 1874 VTCSKPKEIENGIFSLSGLTFNSTASYACKTGYSYTLVGPDTINCSSSGKWSEHIPQCMAVS--CDEPPNVDYASSH--SSHRLF--GDTAYYYCSDGYSMVDNAQMLCNTEGNWVPPDGKEIPNCIADFCERPSSVAHSILESVNKAKFVSGSTVSFK------CMEGFVLNTTA--------RIECVRGGQWIPSSLTIQCIPVRCGEPPSIKNGYVSGTNYSFGSVVAYSCDKGYYIKGEKKRTCLASGEWSGRLPACHPGSCDDPPKLENGFVKSKTGLLYESKVIYACNPGYKLVGSNVRV----CQLNRHWYSESPPTCVLLTCEKPPPVKYGSM------KGENFEV------GSKVEFFCEDGYELSGDLSWTCQKNGEWDKKQTPTCMPSKCQ-DPPLYENHLVLKEVPNEVGIVRFSCKEGHVL----EGSSVLKCLPSQQWND----SFPL--CKLVFCSSPPELAYGEPI-------------SVPSLYFGSTVKYTCVDGFLLKGESVITCNASGMWS-PDFPNCSPI 2353          

HSP 10 Score: 71.2478 bits (173), Expect = 4.916e-12
Identity = 134/594 (22.56%), Postives = 199/594 (33.50%), Query Frame = 3
Query:  567 QTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAK-----CNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQF-CNDGF------KIQCT---------------------TDQFEDKNCRRQ-----CQADGKWSGDTAICTA-ILCPELSPPENGEVMGVWNTVNSIKTFKC--------------------------KEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCK---------------------------------------------SRSTLIGETSFLTCGE----VDN-------KSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGSWNFIP-----RCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWT-KMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCEFIMHDELP 1964
            ++  C   P +  T  H ++ + D K G  + + C  G++      I+ K      N  EW      CE+ SCGK    +NG   YN    +    + + CN G+      ++ CT                     +D  E  +C        C     + GD   C   + C +    ENG   G    V S   F C                           EGY L G+    C    +W  +  TC    C  P EI     +    T  + A Y CK                                             S   L G+T++  C +    VDN       +  W+P P+ K + +C     +      H   ++ N     +   G+ V  KC  G+ LN+     C  G   +IP     +C+   C   PPS+K   V   +    S+  Y C  GYYI   K      S         G W+ ++P   C P  C  PP  +NG +       +T L       ++   V Y C+P Y+L G  + VC LN HW     PTC  +  ++ P
Sbjct: 1627 KSKFCADCPALEGTSPHLHATKSDHKPGSKISLFCNPGFQ------IVGKPERQCLNLGEWDQPLPHCERISCGKPPRLENG--FYNAEDLFAGSTVTYQCNIGYYLLGDSRMFCTDNGSWNGISPSCLDVDECEIGSDCDEHASCMNTNGSYICTCIPPYHGDGKKCLEPVKCKDPGEIENGNYSGNHFGVGSQLMFSCHEGYDLIGLVKVTCLESGEWDDALPCNEGYTLIGNEETVCLANRSWSHALPTCESVTCSKPKEIENGIFSLSGLTFNSTASYACKTGYSYTLVGPDTINCSSSGKWSEHIPQCMAVSCDEPPNVDYASSHSSHRLFGDTAYYYCSDGYSMVDNAQMLCNTEGNWVP-PDGKEIPNCIADFCERPSSVAHSILESVN---KAKFVSGSTVSFKCMEGFVLNTTARIECVRGG-QWIPSSLTIQCIPVRC-GEPPSIKNGYVSGTNYSFGSVVAYSCDKGYYIKGEKKRTCLAS---------GEWSGRLPA--CHPGSCDDPPKLENGFV-----KSKTGL-------LYESKVIYACNPGYKLVGSNVRVCQLNRHWYSESPPTCVLLTCEKPP 2183          

HSP 11 Score: 64.6994 bits (156), Expect = 5.674e-10
Identity = 55/194 (28.35%), Postives = 84/194 (43.30%), Query Frame = 3
Query:  942 DTAICTAILCPELSPPENGE-VMGVWNT-VNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKV--AYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCL-LHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNS--DILPACYNGSWN 1502
            + ++C  + CPEL PPENG  V  + N   ++    +CK GY L GS++R C   G W GS++TC VR C     +   ++  +   T++G      C     L G +  L  G     S W  K  P+C  +HC  F   +  +    N         +   +G      CN G+ L+   D +    NG W+
Sbjct:  361 EGSVCKVVHCPELRPPENGYFVQNICNNHFDAACGIRCKTGYDLVGSNIRLCQPNGLWTGSDATCRVRTCPKLHTLEHGRMNCSSSDTSYGTMCIAYCNDGYVLEGSSKLLCLG----SSQWDSK-VPQCKEMHCPVFHKPNGVLSSPSN------CGQEPAKYGYSCHVGCNKGFMLSGVKDKIKCVANGKWS 543          
BLAST of C4b binding protein beta chain vs. Ensembl Xenopus
Match: SVEP1 (sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1 [Source:NCBI gene;Acc:100493788])

HSP 1 Score: 111.694 bits (278), Expect = 1.811e-24
Identity = 136/559 (24.33%), Postives = 210/559 (37.57%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMH-DEVTHGTHVRAKCNFGYE-LNSDILPACYNGSWNF-IPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEI------------------YLLGQ--SDRTRLTDKSIKP------------------IHNRVVKYE--------CHPLYRLKGPKIAVCLN-GHWSP 1919
            ++C  P  P NG  +++   +G  V + CK GY L G  K  C AN + +   P+C         +   P   +H  +   ++     +   C  GY+    S    + +  +W  +   C   SCG+     NG+ +  N YT+       CN+G+++             R C  +G WSG T  C AI C   +   NGEV G    V     ++C  GY++ G+    C  +G W+ +   C   +C PP +I    +      +     Y C     + G ++     +      W   P P CL    P +  +  V         N IM  D+ T G  V  KC  G++ L S  L     G W+   P C +  C   PPS+  + +   S   +   RY C  GY +  + + + T          +G W+K P   CQ   C  PP+  N  +                  Y++ Q  S +T L D S  P                  I N   +Y+        C   Y L GP  + C+N G+W P
Sbjct: 2548 IECSIPTDPENGVMHYTDNTIGSSVHFECKPGYELNGSDKSICLANKQWNNEIPKCV------IISCKTPNKILHGYTEVSNYTYMSVIHYKCDKGYQIYGLSQRTCQIS-KQWDGEEPICVPVSCGQPPMVINGKVI-GNEYTFSKTIEYVCNEGYRLYGEE--------IRTCLENGNWSGTTPSCLAITCKISTTVNNGEVTGTECGVGKEILYRCNHGYKMQGTPKLTCLNDGTWNSNAPLCEPIHCEPPEDISNGYLNSSNFKYNEYIHYVCFPGYEMHGSSTR----QCLANGAWSGSP-PTCL----PCECPTPVV--------QNGIMSGDDFTCGHSVSIKCREGFKLLGSSELTCQSAGKWSSGFPHCGKVPC-GPPPSIPNAFINGSSSTDEDAIRYNCVAGYIMQGKSELLCT---------KEGVWSK-PYPNCQLLSCGLPPSVLNAVLIADSYTYGSTANYRCQDGYVMHQDVSSKTCLEDGSWSPGDIVCVPKKCLLQSTLIQIKNDETEYDINKTITIVCKEGYTLTGPSTSTCMNDGNWIP 3062          

HSP 2 Score: 105.531 bits (262), Expect = 1.515e-22
Identity = 99/376 (26.33%), Postives = 148/376 (39.36%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKC-LLHCK-PFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILP-ACY-NGSWN 1502
            + + C  P   +NG    +       +EY C  GY L G   R C  N   SG+ P C   T        I  T  +      +   G+++   C +GY+      +    N   W  +   CE   C   ED  NG  + ++N+ Y       C  G+++  ++         RQC A+G WSG    C    CP     +NG + G   T     + KC+EG++L GS    C   G W      C    CGPPP I  A +   ++T      Y C +   + G++  L       K G   KP P C LL C  P  V +A             ++ D  T+G+    +C  GY ++ D+    C  +GSW+
Sbjct: 2662 VPVSCGQPPMVINGKVIGNEYTFSKTIEYVCNEGYRLYGEEIRTCLENGNWSGTTPSCLAITC------KISTTVNNGEVTGTECGVGKEILYRCNHGYKMQGTPKLTCL-NDGTWNSNAPLCEPIHCEPPEDISNGY-LNSSNFKYNEYIHYVCFPGYEMHGSS--------TRQCLANGAWSGSPPTCLPCECP-TPVVQNGIMSGDDFTCGHSVSIKCREGFKLLGSSELTCQSAGKWSSGFPHCGKVPCGPPPSIPNAFINGSSSTDEDAIRYNCVAGYIMQGKSELLC-----TKEGVWSKPYPNCQLLSCGLPPSVLNA------------VLIADSYTYGSTANYRCQDGYVMHQDVSSKTCLEDGSWS 3003          

HSP 3 Score: 102.834 bits (255), Expect = 1.018e-21
Identity = 114/460 (24.78%), Postives = 168/460 (36.52%), Query Frame = 3
Query:  375 VCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQV-----------------------------------------HDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYN-GSWNF-IPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGY 1625
            +C EI   C PP    NG    +    G  + ++C  G+ L G   + C+ +   S S P C   TD C   P+I + Q                                           +NS   ++  G +V   C NGYE    S +  K +G  W      C    C    DP+NG   Y +N    S+  + C  G+++  +         +  C A+ +W+ +   C  I C   +   +G       T  S+  +KC +GYQ++G   R C     WDG    C+  +CG PP ++  KV     T     EY C     L GE    TC E  N SG      P CL         + K+    NN     +   E   G  +  +CN GY++       C N G+WN   P C    C   P  +    +   + K++    Y C  GY
Sbjct: 2384 ICKEI--TCDPPQGIDNGFVEGADYSYGAMIIFSCMPGFQLVGLAMQTCEES-GWSSSTPVCL-HTD-CGLPPHIDFGQYTIVTFEEKILTDDELKHSIFGVSNIILSPTTTSNTLKTENHSENSQLSEYLYGTNVIYSCNNGYEILGMSVLTCKEDGT-WNGSAPACAPIECSIPTDPENGVMHYTDNTIGSSVHFE-CKPGYELNGSD--------KSICLANKQWNNEIPKCVIISCKTPNKILHGYTEVSNYTYMSVIHYKCDKGYQIYGLSQRTCQISKQWDGEEPICVPVSCGQPPMVINGKVIGNEYTFSKTIEYVCNEGYRLYGE-EIRTCLENGNWSG----TTPSCL-------AITCKISTTVNNGE---VTGTECGVGKEILYRCNHGYKMQGTPKLTCLNDGTWNSNAPLCEPIHCEP-PEDISNGYLNSSNFKYNEYIHYVCFPGY 2812          

HSP 4 Score: 101.293 bits (251), Expect = 2.912e-21
Identity = 136/526 (25.86%), Postives = 211/526 (40.11%), Query Frame = 3
Query:  378 CMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQAN---LRLSGSE-PECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKC-NGNEW--KYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKT-FKCKEGYQLHGSHLRKCTREGNW-DGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSG-WLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYEL-NSDILPACYNGSWN-FIPRCVEAACSARPPSMKYST-VRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHW 1913
            CM +     P V   + H++H   L GD   Y C  GY++    +  C      +   G E P C    D C     + ++ + ++ N+  F +G  V   C  G+     + I  +C  G +W      I+C    CG+    KNG  +   NY++ S+    C+ G+ I+           +R C A G+WSG    C    C +    ENG V      +   K  + C  GY+L GS++R C    +W   S  TC++  C  PP + +  +  E    G++ E+ C+    L G+ S+ TC     K+G W  K  P C+    P +     +Y  EN+     ++ +       VR  C  G+ L  S +L    +  WN   P C    CS+ PP + Y   +   SL   S  +Y C  G+   L+ + +        I CN           C P +C +P    NG + + G      LT  S          Y C P Y L G    +C  +G+W
Sbjct: 1850 CMAVSCDEPPNVDYASSHSSHR--LFGDTAYYYCSDGYSMVDNAQMLCNTEGNWVPPDGKEIPNCI--ADFCERPSSVAHS-ILESVNKAKFVSGSTVSFKCMEGFVLNTTARI--ECVRGGQWIPSSLTIQCIPVRCGEPPSIKNGY-VSGTNYSFGSVVAYSCDKGYYIKGEK--------KRTCLASGEWSGRLPACHPGSCDDPPKLENGFVKSKTGLLYESKVIYACNPGYKLVGSNVRVCQLNRHWYSESPPTCVLLTCEKPPPVKYGSMKGENFEVGSKVEFFCEDGYELSGDLSW-TC----QKNGEWDKKQTPTCM----PSKCQDPPLY--ENH----LVLKEVPNEVGIVRFSCKEGHVLEGSSVLKCLPSQQWNDSFPLCKLVFCSS-PPELAYGEPISVPSLYFGSTVKYTCVDGFL--LKGESV--------ITCNASGMWSPDFPNCSPIECPQPEEILNGIVDVQG------LTFLS-------AALYTCKPGYELIGNSTLICGADGYW 2320          

HSP 5 Score: 92.8189 bits (229), Expect = 1.309e-18
Identity = 127/541 (23.48%), Postives = 191/541 (35.30%), Query Frame = 3
Query:  567 QTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAK-----CNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSG---------------------------DTAICTAI--------------LCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWD--------GSNST--------------CIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGSWNFIP-----RCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWT-KMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCEFIMHDELP 1964
            ++  C   P +  T  H ++ + D K G  + + C  G++      I+ K      N  EW      CE+ SCGK    +NG   YN    +    + +       QC    +   + R  C  +G W+G                            + ICT I               C +    ENG   G    V S   F C EGY L G     C   G WD        G ++               C+  +C  PP + +A         G  A Y C    +++     L     + +  W+P P+ K + +C     +      H   ++ N     +   G+ V  KC  G+ LN+     C  G   +IP     +C+   C   PPS+K   V   +    S+  Y C  GYYI   K      S         G W+ ++P   C P  C  PP  +NG +       +T L       ++   V Y C+P Y+L G  + VC LN HW     PTC  +  ++ P
Sbjct: 1610 KSKFCADCPALEGTSPHLHATKSDHKPGSKISLFCNPGFQ------IVGKPERQCLNLGEWDQPLPHCERISCGKPPRLENG--FYNAEDLFAGSTVTY-------QCNIGYYLLGDSRMFCTDNGSWNGISPSCLDVDECEIGSDCDEHASCMNTNGSYICTCIPPYHGDGKKCLEPVKCKDPGEIENGNYSGNHFGVGSQLMFSCHEGYDLIGLVKVTCLESGEWDDALPYTLVGPDTINCSSSGKWSEHIPQCMAVSCDEPPNVDYASSHSSHRLFGDTAYYYCSDGYSMVDNAQML----CNTEGNWVP-PDGKEIPNCIADFCERPSSVAHSILESVN---KAKFVSGSTVSFKCMEGFVLNTTARIECVRGG-QWIPSSLTIQCIPVRC-GEPPSIKNGYVSGTNYSFGSVVAYSCDKGYYIKGEKKRTCLAS---------GEWSGRLPA--CHPGSCDDPPKLENGFV-----KSKTGL-------LYESKVIYACNPGYKLVGSNVRVCQLNRHWYSESPPTCVLLTCEKPP 2102          

HSP 6 Score: 91.2781 bits (225), Expect = 3.724e-18
Identity = 125/529 (23.63%), Postives = 199/529 (37.62%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNS-NRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGSWNFIPR-----CVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMP----TEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCE 1940
            + + C+      NG    +   VG ++ Y C  GY ++G  K  C  +   + + P       LC      P   + +   N  +FK  E +  +C  GYE    S      NG  W   P  C    C      +NG    ++     S++I+ C +GFK+  +++          CQ+ GKWS     C  + C       N  + G  +T      + C  GY + G     CT+EG W      C + +CG PP ++ A +  ++ T+G+ A Y+C+    +  + S  TC E      W P       + C P +       I   N  T + ++  +T        C  GY L       C N   N+IP      C   +C   P + ++  V            Y C+ G+ +    +G        D +     W   P       C   +C  P  P+N      G ++   +T  S        V+Y+C   Y L+G  +A C  NG WS P +P C+
Sbjct: 2720 LAITCKISTTVNNGEVTGTECGVGKEILYRCNHGYKMQGTPKLTCLNDGTWNSNAP-------LCEPIHCEPPEDISNGYLNSSNFKYNEYIHYVCFPGYEMHGSSTRQCLANG-AWSGSPPTCLPCEC-PTPVVQNGIMSGDDFTCGHSVSIK-CREGFKLLGSSE--------LTCQSAGKWSSGFPHCGKVPCGPPPSIPNAFINGSSSTDEDAIRYNCVAGYIMQGKSELLCTKEGVWSKPYPNCQLLSCGLPPSVLNAVLIADSYTYGSTANYRCQDGYVMHQDVSSKTCLE---DGSWSPGD-----IVCVPKKCLLQSTLIQIKNDETEYDINKTIT------IVCKEGYTLTGPSTSTCMNDG-NWIPEVNNNICTPVSC-GEPAAPEHGIVLGTRYLFKDSLHYSCNHGFEL----NGPSRRICHIDKQ-----WIPPPPTCVISLCHNTRCEVPQQPEN------GHAEYENVTVGS-------TVRYQCQNGYTLEGEDLAECTTNGTWSHP-VPICK 3191          

HSP 7 Score: 88.9669 bits (219), Expect = 1.832e-17
Identity = 102/452 (22.57%), Postives = 157/452 (34.73%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSC---GKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKW--SGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVR-----NCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPT 1715
            + C PP    N   N S     D + Y C +GY ++G  +  C      S   P C         +  +P + ++     D +  G      CQ+GY                W    I C  K C     L   KN  T Y+ N T   +    C +G+ +   +           C  DG W    +  ICT + C E + PE+G V+G          + C  G++L+G   R C  +  W     TC++       C  P +       YE  T G+   Y+C++  TL GE       E      W   P P C  +  P         I EN      +   +   G  V  KC  GY+L    +  C  + +W       E      P +++   +R +  +   +  Y C+ GY +         L +   +    G WT  P+
Sbjct: 2895 VPCGPPPSIPNAFINGSSSTDEDAIRYNCVAGYIMQGKSELLCTKEGVWSKPYPNCQ------LLSCGLPPSVLNAVLIADSYTYGSTANYRCQDGYVMHQDVSSKTCLEDGSWSPGDIVCVPKKCLLQSTLIQIKNDETEYDINKTITIV----CKEGYTLTGPS--------TSTCMNDGNWIPEVNNNICTPVSCGEPAAPEHGIVLGTRYLFKDSLHYSCNHGFELNGPSRRICHIDKQWIPPPPTCVISLCHNTRCEVPQQPENGHAEYENVTVGSTVRYQCQNGYTLEGE----DLAECTTNGTW-SHPVPICKANPCP-----VPFVIPEN----AILTETDFYVGQKVSIKCRKGYQLQGQAVITCNADETWTDANVKCEKISCGPPHTIQNGILRGMYHQFGDVVTYSCYSGYML---------LGSFRSVCLENGTWTAPPS 3305          

HSP 8 Score: 84.7297 bits (208), Expect = 3.917e-16
Identity = 106/464 (22.84%), Postives = 162/464 (34.91%), Query Frame = 3
Query:  396 QCQPPVQPVNGHA-NHSILLVGDQVEYTCKSGYALKGPRKRYCQANLR-LSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYE-----------------------------DP--YKSHIIAKCNGNE---------------------------WKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQ-VDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGSW-NFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLA 1601
             C  P +  NG   + + LL   +V Y C  GY L G   R CQ N    S S P C   T  C   P + Y  +      ++F+ G  V+  C++GYE                             DP  Y++H++ K   NE                           W      C+   C    +   G  +   +  + S     C DGF ++  +           C A G WS D   C+ I CP+     NG V     T  S   + CK GY+L G+    C  +G W G    C    C    EI+  K ++++  +G    Y C     L G+ + LTC E      W   P     + C P Q +D+             F+   + ++G  +   C  G++L    +  C    W +  P C+   C   PP + +     ++ +   L 
Sbjct: 2037 SCDDPPKLENGFVKSKTGLLYESKVIYACNPGYKLVGSNVRVCQLNRHWYSESPPTCVLLT--CEKPPPVKYGSMKG----ENFEVGSKVEFFCEDGYELSGDLSWTCQKNGEWDKKQTPTCMPSKCQDPPLYENHLVLKEVPNEVGIVRFSCKEGHVLEGSSVLKCLPSQQWNDSFPLCKLVFCSSPPELAYGEPISVPSLYFGSTVKYTCVDGFLLKGES--------VITCNASGMWSPDFPNCSPIECPQPEEILNGIVDVQGLTFLSAALYTCKPGYELIGNSTLICGADGYWQGGKPICKPIKCSKAKEILNGKFSFQSLNYGQTITYTCNRGFRLEGQ-NVLTCLETGE---WNSNPPICKEITCDPPQGIDNG------------FVEGADYSYGAMIIFSCMPGFQLVGLAMQTCEESGWSSSTPVCLHTDC-GLPPHIDFGQYTIVTFEEKILT 2469          

HSP 9 Score: 83.5741 bits (205), Expect = 8.452e-16
Identity = 138/600 (23.00%), Postives = 207/600 (34.50%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLC--------------FSAPYI----------------------PYTQVHDNSNRDDFKNGEDVKIICQNGYED------------------PYK---SHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNG--RTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKW----SGDTAICTAILCPELSPPENGEVMGVWNTVNSIK-------TFKCKEGYQLHGSHLRKCTREGNWDGSNST--CIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSW--NFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNK-GNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTCEFIMHDELP 1964
            + C  P +  NG  N   L  G  V Y C  GY L G  + +C  N   +G  P C D  D C               +  YI                      P    + N + + F  G  +   C  GY+                   PY       I   +  +W     +C   SC   ++P N    + ++++  +   A  +C+DG+ +          N +  C  +G W      +   C A  C   S         +  +VN  K       +FKC EG+ L+ +   +C R G W  S+ T  CI   CG PP I    V+    + G+   Y C     + GE    TC      SG LP         C P   D      +   K+   ++++     + V   CN GY+L    +  C  N  W     P CV   C  +PP +KY +++  + +  S   ++C  GY           LS      C K G W K  T  C P KC  PP  +N             L  K + P    +V++ C   + L+G  +  CL         P C+ +     P
Sbjct: 1674 ISCGKPPRLENGFYNAEDLFAGSTVTYQCNIGYYLLGDSRMFCTDNGSWNGISPSCLD-VDECEIGSDCDEHASCMNTNGSYICTCIPPYHGDGKKCLEPVKCKDPGEIENGNYSGNHFGVGSQLMFSCHEGYDLIGLVKVTCLESGEWDDALPYTLVGPDTINCSSSGKWSEHIPQCMAVSC---DEPPNVDYASSHSSHRLFGDTAYYYCSDGYSMV--------DNAQMLCNTEGNWVPPDGKEIPNCIADFCERPS----SVAHSILESVNKAKFVSGSTVSFKCMEGFVLNTTARIECVRGGQWIPSSLTIQCIPVRCGEPPSIKNGYVSGTNYSFGSVVAYSCDKGYYIKGEKK-RTCLASGEWSGRLPA--------CHPGSCDDPPKLENGFVKSKTGLLYE-----SKVIYACNPGYKLVGSNVRVCQLNRHWYSESPPTCVLLTCE-KPPPVKYGSMKGENFEVGSKVEFFCEDGY----------ELSGDLSWTCQKNGEWDKKQTPTCMPSKCQDPPLYEN------------HLVLKEV-PNEVGIVRFSCKEGHVLEGSSVLKCLPSQQWNDSFPLCKLVFCSSPP 2219          

HSP 10 Score: 76.2554 bits (186), Expect = 1.556e-13
Identity = 133/569 (23.37%), Postives = 209/569 (36.73%), Query Frame = 3
Query:  369 GLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGY----------------------ALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIK--------CEKKSC---GKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKW--SGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKV-AYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKC-LLHC-KPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWN--FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIH-NRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCEFI 1946
            G  C+E  ++C+ P +  NG+ + +   VG Q+ ++C  GY                       L GP    C ++ + S   P+C   +  C   P + Y   H  S+   F  G+     C +GY     + ++    GN    D  +        CE+ S      LE     + +  +  +++      C +GF +  T         R +C   G+W  S  T  C  + C E    +NG V G   +  S+  + C +GY + G   R C   G W G    C   +C  PP++    V +     + ++  Y C     L+G    +          W  +  P C LL C KP  V    +      K  NF +      G+ V   C  GYEL+ D+   C  NG W+    P C+ + C   PP  +   V         + R+ C  G+ +    +G   L  +   + N       P   C+   C+ PP    GE               S+  ++    VKY C   + LKG  +  C  +G WS P  P C  I
Sbjct: 1766 GKKCLE-PVKCKDPGEIENGNYSGNHFGVGSQLMFSCHEGYDLIGLVKVTCLESGEWDDALPYTLVGPDTINCSSSGKWSEHIPQCMAVS--CDEPPNVDYASSH--SSHRLF--GDTAYYYCSDGYSMVDNAQMLCNTEGNWVPPDGKEIPNCIADFCERPSSVAHSILESVNKAKFVSGSTVSFK------CMEGFVLNTTA--------RIECVRGGQWIPSSLTIQCIPVRCGEPPSIKNGYVSGTNYSFGSVVAYSCDKGYYIKGEKKRTCLASGEWSGRLPACHPGSCDDPPKLENGFVKSKTGLLYESKVIYACNPGYKLVGSNVRV----CQLNRHWYSESPPTCVLLTCEKPPPVKYGSM------KGENFEV------GSKVEFFCEDGYELSGDLSWTCQKNGEWDKKQTPTCMPSKCQ-DPPLYENHLVLKEVPNEVGIVRFSCKEGHVL----EGSSVLKCLPSQQWND----SFPL--CKLVFCSSPPELAYGEPI-------------SVPSLYFGSTVKYTCVDGFLLKGESVITCNASGMWS-PDFPNCSPI 2272          

HSP 11 Score: 72.4034 bits (176), Expect = 2.590e-12
Identity = 55/187 (29.41%), Postives = 83/187 (44.39%), Query Frame = 3
Query:  390 DLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNE-WKYDPIKCEKKSCGKLEDPKNG--RTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSG 941
            + +C+ P QP NGHA +  + VG  V Y C++GY L+G     C  N   S   P C  + + C     IP   +   +   DF  G+ V I C+ GY+   +   +  CN +E W    +KCEK SCG     +NG  R MY   + +  +    C  G+ +          + R  C  +G W+ 
Sbjct: 3134 NTRCEVPQQPENGHAEYENVTVGSTVRYQCQNGYTLEGEDLAECTTNGTWSHPVPIC--KANPCPVPFVIPENAILTET---DFYVGQKVSIKCRKGYQ--LQGQAVITCNADETWTDANVKCEKISCGPPHTIQNGILRGMY---HQFGDVVTYSCYSGYMLL--------GSFRSVCLENGTWTA 3302          

HSP 12 Score: 64.3142 bits (155), Expect = 6.326e-10
Identity = 55/194 (28.35%), Postives = 84/194 (43.30%), Query Frame = 3
Query:  942 DTAICTAILCPELSPPENGE-VMGVWNT-VNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKV--AYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCL-LHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNS--DILPACYNGSWN 1502
            + ++C  + CPEL PPENG  V  + N   ++    +CK GY L GS++R C   G W GS++TC VR C     +   ++  +   T++G      C     L G +  L  G     S W  K  P+C  +HC  F   +  +    N         +   +G      CN G+ L+   D +    NG W+
Sbjct:  361 EGSVCKVVHCPELRPPENGYFVQNICNNHFDAACGIRCKTGYDLVGSNIRLCQPNGLWTGSDATCRVRTCPKLHTLEHGRMNCSSSDTSYGTMCIAYCNDGYVLEGSSKLLCLG----SSQWDSK-VPQCKEMHCPVFHKPNGVLSSPSN------CGQEPAKYGYSCHVGCNKGFMLSGVKDKIKCVANGKWS 543          
BLAST of C4b binding protein beta chain vs. Ensembl Mouse
Match: Svep1 (sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1 [Source:MGI Symbol;Acc:MGI:1928849])

HSP 1 Score: 131.724 bits (330), Expect = 6.965e-31
Identity = 136/516 (26.36%), Postives = 202/516 (39.15%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLP---KPEPKCLLH-CKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFIP---RCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHW 1913
            ++C+ P  P NGH++  I  VG  V ++C  G+ L G     C          P C     +    P +P     D S    F  G  V   C  GY            +G+ W +    CE   C + ED  NG+ +  +  TY SIA   C +G+ +Q  +          +C A G W      C  + C E    ++  + G   T  +   + CKEGY L G     C   G W+ SN  C+  +C  PP +  A         G  A Y C    +L  + S L C    N   W+P   +  P+C+ H C+  +  S    I E+     F        G+ V  KC  G+ LN+     C   G W+  P   +C+   C   PPS+        +    ++  Y CH G+YI   K      +         G W+K PT  C P  C +PP  +NG  +L   + RT  ++           +++C+P Y+  G  + VC  N HW
Sbjct: 1786 VKCKAPENPENGHSSGEIYTVGTAVTFSCDEGHELVGVSTITCLETGEWDRLRPSC---EAISCGVPPVPENGGVDGSA---FTYGSKVVYRCDKGYTLSGDEESACLASGS-WSHSSPVCELVKCSQPEDINNGKYIL-SGLTYLSIASYSCENGYSLQGPS--------LLECTASGSWDRAPPSCQLVSCGEPPIVKDAVITGSNFTFGNTVAYTCKEGYTLAGPDTIVCQANGKWNSSNHQCLAVSCDEPPNVDHASPETAHRLFGDTAFYYCADGYSL-ADNSQLICNAQGN---WVPPAGQAVPRCIAHFCE--KPPSVSYSILESVSKAKFAA------GSVVSFKCMEGFVLNTSAKIECLRGGEWSPSPLSVQCIPVRC-GEPPSIANGYPSGTNYSFGAVVAYSCHKGFYIKGEKKSTCEAT---------GQWSK-PTPTCHPVSCNEPPKVENG--FLEHTTGRTFESE----------ARFQCNPGYKAAGSPVFVCQANRHW 2250          

HSP 2 Score: 126.716 bits (317), Expect = 2.521e-29
Identity = 154/573 (26.88%), Postives = 229/573 (39.97%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTD-------------LCFSAPYI-----PYTQVHDN-----------------SNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCL-LHC-KPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSW-----NFIPRCVEAACSARPPSMKYSTVRFLS---LKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGN-WTKMP-TEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCEFIMHDELP 1964
            ++C  P    NG  +      G  V Y C SGY L G  + +C  N   +G  P C D  +             L  +  Y+     PYT    N                 S+ + +  G  V   C  G+E    S I     G EW      CE  SCG    P+NG  +  + +TY S  +  C+ G+ +  + D+         C A G WS  + +C  + C +     NG+ +    T  SI ++ C+ GY L G  L +CT  G+WD +  +C + +CG PP +  A +     T G    Y CK   TL G  +      V   +G       +CL + C +P  VD      H + +T + +  D   +       C  GY L  +    C   G+W       +PRC+   C  +PPS+ YS +  +S       S+  + C  G+           L+T   I+C +G  W+  P +  C P +C +PP+  NG  Y  G       T+ S       VV Y CH  + +KG K + C   G WS P  PTC  +  +E P
Sbjct: 1687 IRCGLPPALENGFYSAEDFHAGSTVTYQCTSGYYLLGDSRMFCTDNGSWNGISPSCLDVDECAVGSDCSEHASCLNTNGSYVCSCNPPYTGDGKNCAEPVKCKAPENPENGHSSGEIYTVGTAVTFSCDEGHELVGVSTITCLETG-EWDRLRPSCEAISCGVPPVPENG-GVDGSAFTYGSKVVYRCDKGYTL--SGDE------ESACLASGSWSHSSPVCELVKCSQPEDINNGKYILSGLTYLSIASYSCENGYSLQGPSLLECTASGSWDRAPPSCQLVSCGEPPIVKDAVITGSNFTFGNTVAYTCKEGYTLAGPDTI-----VCQANGKWNSSNHQCLAVSCDEPPNVD------HASPETAHRLFGDTAFY------YCADGYSLADNSQLICNAQGNWVPPAGQAVPRCIAHFCE-KPPSVSYSILESVSKAKFAAGSVVSFKCMEGF----------VLNTSAKIECLRGGEWSPSPLSVQCIPVRCGEPPSIANG--YPSG-------TNYSF----GAVVAYSCHKGFYIKGEKKSTCEATGQWSKP-TPTCHPVSCNEPP 2207          

HSP 3 Score: 118.242 bits (295), Expect = 1.146e-26
Identity = 115/434 (26.50%), Postives = 170/434 (39.17%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPE--NGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFD 1676
            I ++C  PV P NG  + +   +G   +Y+CK G+ L+G   R C  N + SG+ P C  +   C      P    + +   DD+     +   C +GY           C  N +W      C    CG    P NGR +    YT+Q      C +GF ++            R C  +G WSG T  C  + CP  +PP+  NG   G+         F C EGY L G+    C   G WD     C    CGPP ++        +  HG   +Y+C +   L G  S   C    + SG  P         C P +  +  +     N T       ++  G  V+ +C  G++L       C  NG W+ +P C  A C    P++  + V   SL  D++  Y C  GY +    D + T   I+ 
Sbjct: 2710 ISIECDLPVAPENGFLHFTQTTMGSAAQYSCKPGHILEGSHLRLCLQNKQWSGTVPRC--EAISCSK----PNPLWNGSIKGDDYSYLGVLYYECDSGYI--LNGSKKRTCQENRDWDGHEPMCIPVDCGSPPVPTNGR-VKGEEYTFQKEITYSCREGFILEGARS--------RICLTNGSWSGATPSCMPVRCP--APPQVPNGVADGLDYGFKKEVAFHCLEGYVLQGAPRLTCQSNGTWDAEVPVCKPATCGPPADLPQGFPNGFSFYHGGHIQYQCFTGYKLHGNPS-RRCLPNGSWSGSSPS--------CLPCRCSTPIIQQGTINAT-------DLGCGKTVQIECFKGFKLLGLSEITCDANGQWSDVPLCEHAQCGPL-PTIPNAIVLEGSLSEDNVVTYSCRPGYTMQGSSDLICTEKAIWS 3107          

HSP 4 Score: 111.694 bits (278), Expect = 1.162e-24
Identity = 127/511 (24.85%), Postives = 197/511 (38.55%), Query Frame = 3
Query:  429 HANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTD-QTDLCFSAP--YIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWN-FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNK-GNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLN-GHWSPPQMPTCE 1940
            HA+H   L G  V Y+C+ GY L G     CQ +   +G+ P C   + DL  +    ++ +TQ            G   +  C+ G+     SH+       +W     +CE  SC K     NG ++  ++Y+Y  +    C+ G+ +        + + +R CQ +  W G   +C  + C     P NG V G   T     T+ C+EG+ L G+  R C   G+W G+  +C+   C  PP++              +  + C     L G    LTC         +P         CKP             +    F       HG H++ +C  GY+L+ +    C  NGSW+   P C+   CS   P ++  T+    L      +  C  G+           L  + +I C+  G W+ +P   C+  +C   PT  N  I L G                + VV Y C P Y ++G    +C     WS P  PTCE
Sbjct: 2668 HASH--FLYGTMVSYSCEPGYELLGIPVLICQEDGTWNGTAPSCISIECDLPVAPENGFLHFTQT---------TMGSAAQYSCKPGHIL-EGSHLRLCLQNKQWSGTVPRCEAISCSKPNPLWNG-SIKGDDYSYLGVLYYECDSGYIL--------NGSKKRTCQENRDWDGHEPMCIPVDCGSPPVPTNGRVKGEEYTFQKEITYSCREGFILEGARSRICLTNGSWSGATPSCMPVRCPAPPQVPNGVADGLDYGFKKEVAFHCLEGYVLQGAPR-LTCQSNGTWDAEVPV--------CKPATCGPPA------DLPQGFPNGFSFYHGGHIQYQCFTGYKLHGNPSRRCLPNGSWSGSSPSCLPCRCST--PIIQQGTINATDLGCGKTVQIECFKGF----------KLLGLSEITCDANGQWSDVPL--CEHAQCGPLPTIPNA-IVLEGSLSE------------DNVVTYSCRPGYTMQGSSDLICTEKAIWSQP-YPTCE 3114          

HSP 5 Score: 106.686 bits (265), Expect = 4.134e-23
Identity = 126/523 (24.09%), Postives = 204/523 (39.01%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYD-PIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGD-TAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTH-GAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDE-VTHGTHVRAKCNFGYELNSDILPAC-YNGSW-NFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTC 1937
            I ++C  P    NG+ + +    G  V Y+C  G+ +KG +K  C+A  + S   P C   +  C   P +    +   + R  F++  + +  C  GY+       + + N   W  D P+ C   +CGK    +NG  +   ++   S     CN+G+++          +    CQ  GKWS   +  C    C E    EN  V+    +   + T  CKEG+ L G  + KC   G W+GS   C +  C  PP I F   A     H G+  +Y C     L G  + L        S W   P P+C+            V   +  +  N I+H + + + +     C  G+EL  +    C  NG W    P C    C   P  +       +S ++     Y+C  G+    R +G ++L+ +       G+W   P   C    C+ P   +NG  ++ G   R           +  ++ Y C P +++ G  +  C    WS    PTC
Sbjct: 2141 IPVRCGEPPSIANGYPSGTNYSFGAVVAYSCHKGFYIKGEKKSTCEATGQWSKPTPTCHPVS--CNEPPKVENGFLEHTTGRT-FES--EARFQCNPGYKAAGSPVFVCQAN-RHWHSDAPLSCTPLNCGKPPPIQNG-FLKGESFEVGSKVQFVCNEGYELV--------GDNSWTCQKSGKWSKKPSPKCVPTKCAEPPLLENQLVLKELASEVGVMTISCKEGHALQGPSVLKCLPSGQWNGSFPICKMVLCPSPPLIPFGVPASSGALHFGSTVKYLCVDGFFLRGSPTIL----CQADSTW-SSPLPECV-----------PVECPQPEEILNGIIHVQGLAYLSTTLYTCKPGFELVGNATTLCGENGQWLGGKPMCKPIEC-PEPKEILNGQFSSVSFQYGQTITYFCDRGF----RLEGPKSLTCL-----ETGDWDMDPPS-CDAIHCSDPQPIENG--FVEGADYR-----------YGAMIIYSCFPGFQVLGHAMQTCEESGWS-SSSPTC 2607          

HSP 6 Score: 96.6709 bits (239), Expect = 6.131e-20
Identity = 107/422 (25.36%), Postives = 160/422 (37.91%), Query Frame = 3
Query:  474 TCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCL-LHCK-PFQVD--------------------------------SAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWN-FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYI 1631
            +CK G+AL+GP    C  + + +GS P C  +  LC S P IP+  V  +S    F  G  VK +C +G+       I+ + + + W     +C    C + E+  NG  ++     Y S  +  C  GF++          N    C  +G+W G   +C  I CPE     NG+   V        T+ C  G++L G     C   G+WD    +C   +C  P  I    V      +GA   Y C     ++G  +  TC E    SGW     P C+ + C  P  +D                                 A     EN K +         +GT V   C  GYEL    +  C  +G+WN   P C+   C   P + +   + F      S A+Y C  G+ +
Sbjct: 2347 SCKEGHALQGPSVLKCLPSGQWNGSFPIC--KMVLCPSPPLIPF-GVPASSGALHF--GSTVKYLCVDGFFLRGSPTILCQAD-STWSSPLPECVPVECPQPEEILNG-IIHVQGLAYLSTTLYTCKPGFELV--------GNATTLCGENGQWLGGKPMCKPIECPEPKEILNGQFSSVSFQYGQTITYFCDRGFRLEGPKSLTCLETGDWDMDPPSCDAIHCSDPQPIENGFVEGADYRYGAMIIYSCFPGFQVLGH-AMQTCEE----SGW-SSSSPTCVPIDCGLPPHIDFGDCTKVRDGQGHFDQEDDMMEVPYLAHPQHLEATAKALENTKESPASHASHFLYGTMVSYSCEPGYELLGIPVLICQEDGTWNGTAPSCISIECDL-PVAPENGFLHFTQTTMGSAAQYSCKPGHIL 2746          

HSP 7 Score: 91.6633 bits (226), Expect = 2.193e-18
Identity = 85/359 (23.68%), Postives = 135/359 (37.60%), Query Frame = 3
Query:  381 MEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYT-YQSIAIQF-CNDGFK-------------------------------IQCTTDQFEDKNCRRQ------------------CQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPK 1304
            M I + C  P  P NG           ++ Y+C+ G+ L+G R R C  N   SG+ P C      C + P +P    +  ++  D+   ++V   C  GY       +  + NG  W  +   C+  +CG   D   G   + N ++ Y    IQ+ C  G+K                               IQ  T    D  C +                   C A+G+WS D  +C    C  L    N  V+    + +++ T+ C+ GY + GS    CT +  W     TC   +CGPPP +  A    EA T+ ++ + +C     +  +T   TC        W+P+
Sbjct: 2824 MCIPVDCGSPPVPTNGRVKGEEYTFQKEITYSCREGFILEGARSRICLTNGSWSGATPSCMPVR--CPAPPQVP----NGVADGLDYGFKKEVAFHCLEGYVLQGAPRLTCQSNGT-WDAEVPVCKPATCGPPADLPQG---FPNGFSFYHGGHIQYQCFTGYKLHGNPSRRCLPNGSWSGSSPSCLPCRCSTPIIQQGTINATDLGCGKTVQIECFKGFKLLGLSEITCDANGQWS-DVPLCEHAQCGPLPTIPNAIVLEGSLSEDNVVTYSCRPGYTMQGSSDLICTEKAIWSQPYPTCEPLSCGPPPTVANAVATGEAHTYESKVKLRCLEGYVMDSDTDTFTC---QQDGHWVPE 3168          

HSP 8 Score: 87.0409 bits (214), Expect = 4.907e-17
Identity = 132/563 (23.45%), Postives = 207/563 (36.77%), Query Frame = 3
Query:  324 EYDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKII----CQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNW----DGSNSTCIVRNCGPPPEI---VFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF-IPRCVEAACSARPPSMKYSTVRFLSLK-HDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWSPPQMPTCEFIMHDELPI 1967
            E+DR +   C++  CG+          PPV P NG  + S    G +V Y C  GY L G  +  C A+   S S P C            +  +Q  D +N     +G     I    C+NGY     S +    +G+ W   P  C+  SCG+    K+   +  +N+T+ +     C +G+ +               CQA+GKW+     C A+ C E    ++               + C +GY L  +    C  +GNW      +   CI   C  PP +   +   V+      G+   +KC     L          E      W P P     + C P +        +     TN+      + G  V   C+ G+ +  +    C   G W+   P C   +C+  PP ++   +   + +  +S AR+ C+ GY  A         S +F  + N+ +W       C P  C KPP  +NG  +L G+S                 V++ C+  Y L G     C  +G WS    P C      E P+
Sbjct: 1833 EWDRLRP-SCEAISCGV----------PPV-PENGGVDGSAFTYGSKVVYRCDKGYTLSGDEESACLASGSWSHSSPVCE----------LVKCSQPEDINNGKYILSGLTYLSIASYSCENGYSLQGPSLLECTASGS-WDRAPPSCQLVSCGEPPIVKDA-VITGSNFTFGNTVAYTCKEGYTLAGPDTIV--------CQANGKWNSSNHQCLAVSCDEPPNVDHASPETAHRLFGDTAFYYCADGYSLADNSQLICNAQGNWVPPAGQAVPRCIAHFCEKPPSVSYSILESVSKAKFAAGSVVSFKCMEGFVLNTSAKI----ECLRGGEWSPSP---LSVQCIPVRCGEPPSIANGYPSGTNY------SFGAVVAYSCHKGFYIKGEKKSTCEATGQWSKPTPTCHPVSCN-EPPKVENGFLEHTTGRTFESEARFQCNPGYKAA--------GSPVFVCQANR-HWHSDAPLSCTPLNCGKPPPIQNG--FLKGESFEV-----------GSKVQFVCNEGYELVGDNSWTCQKSGKWSKKPSPKCVPTKCAEPPL 2327          

HSP 9 Score: 85.8853 bits (211), Expect = 1.205e-16
Identity = 108/472 (22.88%), Postives = 171/472 (36.23%), Query Frame = 3
Query:  240 HVKSLDNVKHLPNGCPSKACTANIDCWVEY---DRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICT-AILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIG--ETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIA 1634
            +V S   VK L + CP +    N+  W ++      ++ V  S +    C  ++    P ++P +G+        G +V   C  G+ + G   +YC    + +   P C  +   C     +P    +   + +DF  G  V   C +GY     S +    NG+     P   +   C    D     +  N N +Y                             C  +  ++GD   C   + C     PENG   G   TV +  TF C EG++L G     C   G WD    +C   +CG PP      V   A T+G++  Y+C    TL G  E++ L  G   + S       P C L          K    E+     +I+   +T+ +     C  GY L    L  C  +GSW+  P   +      PP +K + +   +    +   Y C  GY +A
Sbjct: 1581 YVLSPQQVKLLASSCPEELSRGNVLAWPDFLSGITGKVKVDSSSMFCSDCPSLEGSV-PHLRPASGNRKP-----GSKVSLFCDPGFQMVGNPVQYCLNQGQWTQPLPHC--ERIRCG----LPPALENGFYSAEDFHAGSTVTYQCTSGYYLLGDSRMFCTDNGSWNGISPSCLDVDECAVGSDCSEHASCLNTNGSY----------------------------VCSCNPPYTGDGKNCAEPVKCKAPENPENGHSSGEIYTVGTAVTFSCDEGHELVGVSTITCLETGEWDRLRPSCEAISCGVPPVPENGGVDGSAFTYGSKVVYRCDKGYTLSGDEESACLASGSWSHSS-------PVCEL---------VKCSQPEDINNGKYILSG-LTYLSIASYSCENGYSLQGPSLLECTASGSWDRAPPSCQLVSCGEPPIVKDAVITGSNFTFGNTVAYTCKEGYTLA 1995          

HSP 10 Score: 80.1073 bits (196), Expect = 7.462e-15
Identity = 104/448 (23.21%), Postives = 161/448 (35.94%), Query Frame = 3
Query:  396 QCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTA--ICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGE-TSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFI-PRCVEAACSARPPS-MKYSTVRFLSLKHDSLARYYCHFGYYI--ALRKDGMETLSTIFDIKCNKGNWTKMPT 1715
            QC P     N       L   + V Y+C+ GY ++G     C      S   P C   +  C   P +        ++  + K    VK+ C  GY     +          W  + I C  K C    +    R   ++    + +++  C +GF         E  N    CQ DG W    +   C  ++C     P +G V+G  ++  S   ++C  GY+L G+  R C     W G  + C    C  P E    K   E TT G    + C    TL G   +  T     N    L KP P C +   PF +    V           +   E     +V  KC  G+ L  + +  C  + +W     RC + +C   PPS ++ +  R +  ++  +  Y C+ GY +  +LR   +E            G WT  P 
Sbjct: 3059 QCGPLPTIPNAIVLEGSLSEDNVVTYSCRPGYTMQGSSDLICTEKAIWSQPYPTCEPLS--CGPPPTVANAVATGEAHTYESK----VKLRCLEGYVMDSDTDTFTCQQDGHWVPERITCSPKKCPVPSNMTRIRFHGDDFQVNRQVSVS-CAEGFT-------HEGVN-WSTCQPDGTWEPPFSDESCIPVVCGHPESPAHGSVVGNKHSFGSTIVYQCDPGYKLEGNRERICQENRQWSGEVAVCRENRCETPAEFPNGKAVLENTTSGPSLLFSCHRGYTLEGSPEAHCTANGTWNHLTPLCKPNP-CPV---PFVIPENAV-----------LSEKEFYVDQNVSIKCREGFLLKGNGVITCSPDETWTHTNARCEKISCG--PPSHVENAIARGVYYQYGDMITYSCYSGYMLEGSLRSVCLE-----------NGTWTPSPV 3463          

HSP 11 Score: 72.7886 bits (177), Expect = 1.413e-12
Identity = 91/388 (23.45%), Postives = 145/388 (37.37%), Query Frame = 3
Query:  441 SILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEW----KYDPIKCEKKSCGKLEDPKNG--RTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGD--TAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAY-EATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNF--IPRCVEAACSARPPSMKYSTV 1568
            S    G+ V YTCK GY L GP    CQAN + + S  +C   +  C   P +     H +        G+     C +GY     S +I    GN W         +C    C K          ++    +   S+    C +GF +        + + + +C   G+WS    +  C  + C E     NG   G   +  ++  + C +G+ + G     C   G W     TC   +C  PP++    + +    T  ++A ++C       G   F+      N+      P     L C P  ++  K    +N     F+  +    G+ V+  CN GYEL  D    C  +G W+    P+CV   C A PP ++   V
Sbjct: 1976 SNFTFGNTVAYTCKEGYTLAGPDTIVCQANGKWNSSNHQCLAVS--CDEPPNVD----HASPETAHRLFGDTAFYYCADGYSLADNSQLICNAQGN-WVPPAGQAVPRCIAHFCEKPPSVSYSILESVSKAKFAAGSVVSFKCMEGFVL--------NTSAKIECLRGGEWSPSPLSVQCIPVRCGEPPSIANGYPSGTNYSFGAVVAYSCHKGFYIKGEKKSTCEATGQWSKPTPTCHPVSCNEPPKVENGFLEHTTGRTFESEARFQCNPGYKAAGSPVFVC---QANRHWHSDAP-----LSCTP--LNCGKPPPIQN----GFLKGESFEVGSKVQFVCNEGYELVGDNSWTCQKSGKWSKKPSPKCVPTKC-AEPPLLENQLV 2333          

HSP 12 Score: 70.8626 bits (172), Expect = 4.696e-12
Identity = 66/247 (26.72%), Postives = 98/247 (39.68%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGY--EDPYKSHIIAKCNGNEWKYDPIKCEKKSCG-KLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGS 1118
            I + C  P  P +G    +    G  + Y C  GY L+G R+R CQ N + SG    C +  + C +    P    +  +  ++  +G  +   C  GY  E   ++H  A  NG  W +    C+   C      P+N        Y  Q+++I+ C +GF ++         N    C  D  W+   A C  I C   S  EN    GV+     + T+ C  GY L GS    C   G W  S
Sbjct: 3233 IPVVCGHPESPAHGSVVGNKHSFGSTIVYQCDPGYKLEGNRERICQENRQWSGEVAVCRE--NRCETPAEFP----NGKAVLENTTSGPSLLFSCHRGYTLEGSPEAHCTA--NGT-WNHLTPLCKPNPCPVPFVIPENAVLSEKEFYVDQNVSIK-CREGFLLK--------GNGVITCSPDETWTHTNARCEKISCGPPSHVENAIARGVYYQYGDMITYSCYSGYMLEGSLRSVCLENGTWTPS 3461          

HSP 13 Score: 60.4622 bits (145), Expect = 8.083e-9
Identity = 55/232 (23.71%), Postives = 88/232 (37.93%), Query Frame = 3
Query:  462 QVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQF-CNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVM--GVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCG 1148
            Q E  C+ GY  KG  +  C A    +            C   P + +T    +++ +D         +C+ GY+   ++                 CE   C  L+ P+NG  + N    + + A    C  GF +  ++           CQ +G WSG  + C    CP L  P++G +       + N++    C EGY+L GS    C     WDG    C+ R+C 
Sbjct:  303 QFECICEKGYYGKG-LQHECTACPSGTYKPEASPGGISTCIPCPDVSHTSPPGSTSPED--------CVCREGYQRSGQT-----------------CEVVHCPALKPPENGFFIQNTCKNHFNAACGVRCRPGFDLVGSSIHL--------CQPNGLWSGTESFCRVRTCPHLRQPKHGHISCSTAEMSYNTLCLVTCNEGYRLEGSTRLTCQGNAQWDGPEPRCVERHCA 500          

HSP 14 Score: 53.9138 bits (128), Expect = 7.926e-7
Identity = 53/218 (24.31%), Postives = 96/218 (44.04%), Query Frame = 3
Query:  321 VEYDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNE-WKYDPIKCEKKSCGKLEDPKN--GRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAI 965
            +E +R ++C  +    G V +  + +C+ P +  NG A       G  + ++C  GY L+G  + +C AN   +   P C  + + C     IP   V    +  +F   ++V I C+ G+    K + +  C+ +E W +   +CEK SCG     +N   R +Y   Y Y  +    C  G+ ++         + R  C  +G W+  + +C A+
Sbjct: 3269 LEGNRERICQENRQWSGEVAVCRENRCETPAEFPNGKAVLENTTSGPSLLFSCHRGYTLEGSPEAHCTANGTWNHLTPLC--KPNPCPVPFVIPENAVL---SEKEFYVDQNVSIKCREGFL--LKGNGVITCSPDETWTHTNARCEKISCGPPSHVENAIARGVY---YQYGDMITYSCYSGYMLE--------GSLRSVCLENGTWT-PSPVCRAV 3467          
BLAST of C4b binding protein beta chain vs. Ensembl Mouse
Match: Csmd1 (CUB and Sushi multiple domains 1 [Source:MGI Symbol;Acc:MGI:2137383])

HSP 1 Score: 115.546 bits (288), Expect = 6.751e-26
Identity = 114/472 (24.15%), Postives = 179/472 (37.92%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQT-DLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFK------------------------------------IQCTTDQFEDKNCRRQCQA----------------DGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFI-PRCVEAACSARPPSMKYSTVRFLSLKHDSLARYY-CHFGYYIA 1634
            + + C  P  P N      +   G  V+Y+CK G  L G   R CQ +   SGS P C+  +   C      P T  H +   D+FK    ++  C+ G++    +      NG+     P+ CE  SCG    P NG  + ++   + S  I  C +G+K                                    IQ  TD   +K    QC                  DG W+    +C A+LC +  P  NG+V G      +  ++ C +GYQL  S +  C   G W G    C+   CG P      +++ ++ T  ++   +CK    L+G +S  TC       G     +P C+        D    +    N +  +    EV  G+ V  +C  GY +       C  N +W+ I   C+  AC  +P +  ++ VR + L        Y CH G+++A
Sbjct: 2855 LAISCGHPGVPANAVLTGELFTYGATVQYSCKGGQILTGNSTRVCQEDSHWSGSLPHCSGNSPGFCGD----PGTPAHGSRLGDEFKTKSLLRFSCEMGHQLRGSAERTCLVNGSWSGVQPV-CEAVSCGNPGTPTNGMILSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTIISCGDPGTLPNGIQFGTDFTFNKTVSYQCNPGYLMEPPTSPTIRCTKDGTWNQSRPLCKAVLCNQPPPVPNGKVEGSDFRWGASISYSCVDGYQLSHSAILSCEGRGVWKGEVPQCLPVFCGDPGTPAEGRLSGKSFTFKSEVFIQCKPPFVLVG-SSRRTC----QADGIWSGIQPTCIDPAHTACPDPGTPHFGIQNSSKGY----EV--GSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACR-QPETPAHADVRAIDLPAFGYTLVYTCHPGFFLA 3309          

HSP 2 Score: 110.538 bits (275), Expect = 2.858e-24
Identity = 142/566 (25.09%), Postives = 215/566 (37.99%), Query Frame = 3
Query:  297 CTANIDCWVEYDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIK-----TFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFI-PRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLK---GPKIAVCLNGHWSPPQMPTCEFIMHDELP 1964
            C AN     E DR +   C    CG +             P NG+   ++ + G    +TC +GY L G   R C AN   SGSE  C      C S    P   V+ + + D F   + V   C  G+     S  I     ++W      C   +CG   +P +G T     +    +    C+ G+++Q  +        R QC+++G+WS    IC  + C +    EN    G  N   S +      + CK G+ L GS    C   G WD S   C+  +CG P     A +  E  T+GA  +Y CK    L G ++ + C E  + SG LP        HC     +S               + DE    + +R  C  G++L       C  NGSW+ + P C   +C           +    +   S   Y C  GY    +  G+ T     +     G WT    + C    C  P T  NG  +    +D T           N+ V Y+C+P Y ++    P I    +G W+  + P C+ ++ ++ P
Sbjct: 2602 CQANGTWSTEEDRPR---CKVISCGSLSF-----------PPNGNKIGTLTIYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRCL--AGHCGS----PDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRIC-LQDHKWSGQTPVCVPITCGHPGNPAHGLTN-GTEFNLNDLVNFTCHTGYRLQGAS--------RAQCRSNGQWSSPLPICRVVNCSDPGSVENAVRHGQQNFPESFEYGTSVMYHCKTGFYLLGSSALTCMASGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGATVQYSCKGGQILTGNSTRV-CQEDSHWSGSLP--------HCSG---NSPGFCGDPGTPAHGSRLGDEFKTKSLLRFSCEMGHQLRGSAERTCLVNGSWSGVQPVCEAVSCGNPGTPTNGMILSSDGILFSSSVIYACWEGY----KTSGLMTRHCTAN-----GTWTGTAPD-CTIISCGDPGTLPNGIQF---GTDFT----------FNKTVSYQCNPGYLMEPPTSPTIRCTKDGTWNQSR-PLCKAVLCNQPP 3101          

HSP 3 Score: 100.908 bits (250), Expect = 2.848e-21
Identity = 108/426 (25.35%), Postives = 157/426 (36.85%), Query Frame = 3
Query:  423 NGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQAN----LRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNE-W--KYDPIKCEKKSCGKLEDPKNGRTMYN------NNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSG--DTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF-IPRCVEAACSARPPSMKYSTVRF------LSLKHDSLARYYCHFGYYI 1631
             G  N +   VG +V Y CK GY + G     C+ N     +     P C  Q   C     IP    + +   ++F     V   C  G++          C  +  W  +  P  C+   C  +E   +   ++       N Y  Q +          + C+   F       QCQA+G WS   D   C  I C  LS P NG  +G      +   F C  GY L GSH+R+C   G W GS + C+  +CG P  IV   ++ +  ++     Y+C     L+G TS   C +    SG  P         C P          H     T F ++D V         C+ GY L       C  NG W+  +P C    CS   P    + VR        S ++ +   Y+C  G+Y+
Sbjct: 2441 GGILNKTAGAVGSKVHYFCKPGYRMIGHSNATCRRNPVGVYQWDSMAPLC--QAVSC----GIPEAPGNGSFTGNEFTLDSKVTYECNEGFKLDASQEATTVCQEDGLWSNRGKPPTCKPVPCPSIEGQLSEHVLWRLVSGSLNEYGAQVL----------LSCSPGYFLQGQRLLQCQANGTWSTEEDRPRCKVISCGSLSFPPNGNKIGTLTIYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRCLAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVG-TSVRICLQDHKWSGQTPV--------CVPITCGHPGNPAHGLTNGTEFNLNDLVNF------TCHTGYRLQGASRAQCRSNGQWSSPLPICRVVNCSD--PGSVENAVRHGQQNFPESFEYGTSVMYHCKTGFYL 2833          

HSP 4 Score: 87.8113 bits (216), Expect = 3.282e-17
Identity = 128/588 (21.77%), Postives = 189/588 (32.14%), Query Frame = 3
Query:  102 LIKNSLNELFPQNQNYKSRFHKIRHQRHLFLNLINPMKSAQYKPECHVKSLDNVKHLPNG-----CPSKACTANIDCWVEY----DRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSC---GKLEDP-KNGRTMYNNNYTYQSIAIQFCNDGFKI--------------------------------------------------QCTTDQFEDKNCRRQCQADGKWSGDTAICTA---ILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQV------DSAKVYIHENNKTTNFI-MHDEVTHGTHVRAKCNFGYELNSDILPACY---NGSWN-FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIA 1634
            L+  SLNE   Q     S  + ++ QR L         + + +P C V S  ++   PNG           TA   C   Y       + C+ +    G     +   C  P   VNGH +       D V Y C  G+ L G   R C  + + SG  P C   T  C      P    H  +N  +F   + V   C  GY     S    + NG +W      C   +C   G +E+  ++G+  +  ++ Y +  +  C  GF +                                                   C   Q    N  R CQ D  WSG    C+      C +   P +G  +G      S+  F C+ G+QL GS  R C   G+W G    C   +CG P       +                S   L   +    C E    SG + +       HC           D   +   +     N I    + T    V  +CN GY +     P      +G+WN   P C    C+ +PP +    V     +  +   Y C  GY ++
Sbjct: 2572 LVSGSLNEYGAQVLLSCSPGYFLQGQRLLQCQANGTWSTEEDRPRCKVISCGSLSFPPNGNKIGTLTIYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRCLAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPIT--CGH----PGNPAHGLTNGTEFNLNDLVNFTCHTGYRLQGASRAQCRSNG-QWSSPLPICRVVNCSDPGSVENAVRHGQQNFPESFEYGTSVMYHCKTGFYLLGSSALTCMASGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGATVQYSCKGGQILTGNSTRVCQEDSHWSGSLPHCSGNSPGFCGDPGTPAHGSRLGDEFKTKSLLRFSCEMGHQLRGSAERTCLVNGSWSGVQPVCEAVSCGNPGTPTNGMI--------------LSSDGILFSSSVIYACWEGYKTSGLMTR-------HCTANGTWTGTAPDCTIISCGDPGTLPNGIQFGTDFTFNKTVSYQCNPGYLMEPPTSPTIRCTKDGTWNQSRPLCKAVLCN-QPPPVPNGKVEGSDFRWGASISYSCVDGYQLS 3130          

HSP 5 Score: 58.9214 bits (141), Expect = 2.460e-8
Identity = 44/187 (23.53%), Postives = 73/187 (39.04%), Query Frame = 3
Query:  399 CQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAIC 956
            C  P  P  G  +        +V   CK  + L G  +R CQA+   SG +P C D        P  P+  + ++S    ++ G  V   C+ GY    +      C  N  W     +C   +C + E P +      +   +    +  C+ GF +   ++        R C+AD KW+G + +C
Sbjct: 3155 CGDPGTPAEGRLSGKSFTFKSEVFIQCKPPFVLVGSSRRTCQADGIWSGIQPTCIDPAHTACPDPGTPHFGIQNSSK--GYEVGSTVFFRCRKGYH--IQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPAFGYTLVYTCHPGFFLAGGSEH-------RTCKADMKWTGKSPVC 3330          

HSP 6 Score: 53.5286 bits (127), Expect = 4.686e-8
Identity = 120/518 (23.17%), Postives = 183/518 (35.33%), Query Frame = 3
Query:  453 VGDQVEYTCKSGYALKGPRKRYCQ--ANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSH------IIAKCNGNEWKY-DPIKCEKK-SCGKLEDPKNGRT----MYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMG-VWNTVNSIKTFKCKEGYQLHGSHLRKCTREG----NWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF---IPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTC 1937
            +GD V+Y C  GY L G     C+  + L   GS P C  Q          P  +V   S+           +I   GY   Y +       I  + N N   + D  + EK+    ++ D  +G++    + + N+T QS      N    ++ +TD    K   +   A            A  C   S   NG ++      V S   + CK GY++ G     C R       WD     C   +CG P             T  ++  Y+C     L       T  + D    W  + +P     CKP    S +  + E+      +      +G  V   C+ GY L    L  C  NG+W+     PRC   +C +       + +  L++ + + A + C+ GY + +     E L+         G W+   T  C    C  P    NG I   G S R               V Y+C+P +RL G  + +CL  H    Q P C
Sbjct: 2278 IGDFVKYQCHPGYTLLGSDTLTCKLSSQLLFQGSPPTCEAQ---------CPANEVRTESS----------GVILSPGYPGNYFNSQTCAWSIKVEPNFNITLFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRSNH-LYLRWSTDHATSKKGFKIRYA------------APYCSLTSTLRNGGILNKTAGAVGSKVHYFCKPGYRMIGHSNATCRRNPVGVYQWDSMAPLCQAVSCGIPEAPGNGSFTGNEFTLDSKVTYECNEGFKLDASQEATTVCQEDGL--WSNRGKPPT---CKPVPCPSIEGQLSEH-VLWRLVSGSLNEYGAQVLLSCSPGYFLQGQRLLQCQANGTWSTEEDRPRCKVISCGSLSFPPNGNKIGTLTI-YGATAIFTCNTGYTL-VGSHVRECLA--------NGLWSGSETR-CLAGHCGSPDPIVNGHISGDGFSYR-------------DTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVC 2733          

HSP 7 Score: 23.8682 bits (50), Expect = 4.686e-8
Identity = 10/23 (43.48%), Postives = 12/23 (52.17%), Query Frame = 1
Query: 1933 LVNLSCMTNYRFHGCIIARMTRN 2001
            LVN +C T YR  G   A+   N
Sbjct: 2759 LVNFTCHTGYRLQGASRAQCRSN 2781          
BLAST of C4b binding protein beta chain vs. Ensembl Mouse
Match: Csmd3 (CUB and Sushi multiple domains 3 [Source:MGI Symbol;Acc:MGI:2386403])

HSP 1 Score: 109.768 bits (273), Expect = 4.799e-24
Identity = 118/438 (26.94%), Postives = 166/438 (37.90%), Query Frame = 3
Query:  657 VKIICQNGYEDPYKSHIIAKCNG---NEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSG--DTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFIPRCVEAACSARPP----SMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXN----GEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQ 1925
            V+  C  G+    KS  + + +    + W      C+  SCG  + P NG  +   +Y   +    FCNDG+++         +     CQ+DG WS    T  C  I C EL  P NG  +G   +  S   F C  G+ L GS +R+C   G W GS + C+  +CG P  IV  +V  E   +     Y+C     LIG +S   C +  N SG LP         C P         I+       F  +D VT        CN GY +       C  N  W+  P   +    + P     S + S +   +  + ++  Y C+ GY++          S++   + N G W K P   C    C  P  P N    GE Y  G +                 V Y C     L G     C LNGHWS  Q
Sbjct: 2488 VRWACDRGFRLVGKSSAVCRKSSYGYHSWDAPVPACQAISCGIPKAPTNGGIL-TTDYLVGTRVTYFCNDGYRLS------SKELTTATCQSDGTWSNHNKTPRCVVISCGELPTPPNGNKIGTQTSYGSTAIFTCDLGFMLVGSAVRECLSSGLWSGSETRCLAGHCGIPELIVNGQVIGENYGYRDTVVYQCNPGFRLIG-SSVRICQQDHNWSGQLPS--------CVPVSCGHPGSPIYGRTSGNGFNFNDVVTF------SCNIGYLMQGPTKAQCQANRQWSHPPPVCKVVNCSDPGIPANSKRESKIEHGNFTYGTVVFYDCNPGYFLF--------GSSVLICQPN-GQWDK-PLPECIMIDCGHPGIPPNAVLSGEKYTFGST-----------------VHYSCTGKRSLLGQASRTCQLNGHWSGSQ 2876          

HSP 2 Score: 107.457 bits (267), Expect = 2.751e-23
Identity = 90/310 (29.03%), Postives = 123/310 (39.68%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYA--LKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAIC---TAILCPELSPPENGEVMGVWN-TVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKV-AYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLP 1301
            + C  P  P NG       +VG  V Y C+ GY   L G R R C  N   SG  P C   T  C + P I   ++       +F  G  +  IC  GYE  + + +    NG  W  +  +C  K CG    P  G+     ++ YQS     CN  F +  ++         R CQ DG WSG +  C   T   C     P +G     +   V S+  F CK+G+ L GS  R C  +  W G    CI  +C  P     A V   +  +HG    Y C+    L G T    C   +  +G +P
Sbjct: 3002 ISCGDPGIPANGLRYGDDFVVGQNVSYMCQPGYTIELNGSRVRTCTTNGTWSGVMPTCRAVT--CSTPPQISNGRLEGT----NFDWGFSISYICSAGYELSFPAVLTCVGNGT-WSGEVPQCLPKFCGDPGIPSQGKRE-GKSFIYQSEVSFSCNSPFILVGSS--------TRLCQTDGTWSGSSPHCIEPTRTSCENPGVPRHGSQNNTFGFQVGSVVQFHCKKGHLLQGSTTRTCLPDLTWSGIQPECIPHSCKQPESPAHANVVGMDLPSHGYTLIYTCQPGFFLAGGTEHRVCRSDNTWTGKVP 3295          

HSP 3 Score: 102.834 bits (255), Expect = 7.052e-22
Identity = 115/443 (25.96%), Postives = 159/443 (35.89%), Query Frame = 3
Query:  336 AQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNS-NRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAIC---TAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKV-AYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGY--ELNSDILPAC-YNGSWN-FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIAL 1637
             ++C  D    G +   + + C  P  P+ G  + +     D V ++C  GY ++GP K  CQAN + S   P C  +   C S P IP     ++     +F  G  V   C  GY     S +I + NG +W     +C    CG    P N   +    YT+ S             CT  +       R CQ +G WSG    C   T   C +   P +G          S   F C  GY L+GS  R C   G+W G    C    CG P      KV   + TT  +   Y C     L G  S   C      SG LP        +C         +              D+   G +V   C  GY  ELN   +  C  NG+W+  +P C    CS  PP +    +   +        Y C  GY ++ 
Sbjct: 2685 VRICQQDHNWSGQLPSCVPVSCGHPGSPIYGRTSGNGFNFNDVVTFSCNIGYLMQGPTKAQCQANRQWSHPPPVC--KVVNC-SDPGIPANSKRESKIEHGNFTYGTVVFYDCNPGYFLFGSSVLICQPNG-QWDKPLPECIMIDCGHPGIPPNA-VLSGEKYTFGSTV--------HYSCTGKRSLLGQASRTCQLNGHWSGSQPHCSGDTTGTCGDPGTPGHGSRQESDFRTKSTVRFACDTGYILYGSEERTCLSNGSWTGRQPECKAVQCGNPGTTANGKVFRIDGTTFSSSVIYSCLEGYILSGP-SVRQCTANGTWSGSLP--------NCTIISCGDPGI------PANGLRYGDDFVVGQNVSYMCQPGYTIELNGSRVRTCTTNGTWSGVMPTCRAVTCST-PPQISNGRLEGTNFDWGFSISYICSAGYELSF 3098          

HSP 4 Score: 95.9005 bits (237), Expect = 8.860e-20
Identity = 136/549 (24.77%), Postives = 198/549 (36.07%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYAL--KGPRKRYCQANLRLS--GSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKC-NGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIV----FAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFI-PRCV--EAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCEFIMHDE--LPISWLYYRSD 1991
            + C  P  P NG    +  LVG +V Y C  GY L  K      CQ++   S     P C   +  C   P  P    + N        G      C  G+        + +C +   W     +C    CG  E   NG+ +   NY Y+   +  CN GF++  ++         R CQ D  WSG    C  + C     P  G   G     N + TF C  GY + G    +C     W      C V NC  P         +K+ +   T+G    Y C     L G +S L C      +G   KP P+C++      +D     I  N      +  ++ T G+ V   C     L       C  NG W+   P C          P +  + + +    +  S  R+ C  GY +     G E  + +     + G+WT    E C+  +C  P T  NG+++ +   D T  +   I         Y C   Y L GP +  C  NG WS   +P C  I   +  +P + L Y  D
Sbjct: 2526 ISCGIPKAPTNGGILTTDYLVGTRVTYFCNDGYRLSSKELTTATCQSDGTWSNHNKTPRCVVIS--CGELPTPP----NGNKIGTQTSYGSTAIFTCDLGFM--LVGSAVRECLSSGLWSGSETRCLAGHCGIPELIVNGQVI-GENYGYRDTVVYQCNPGFRLIGSS--------VRICQQDHNWSGQLPSCVPVSCGHPGSPIYGRTSGNGFNFNDVVTFSCNIGYLMQGPTKAQCQANRQWSHPPPVCKVVNCSDPGIPANSKRESKIEHGNFTYGTVVFYDCNPGYFLFG-SSVLIC----QPNGQWDKPLPECIM------IDCGHPGIPPN----AVLSGEKYTFGSTVHYSCTGKRSLLGQASRTCQLNGHWSGSQPHCSGDTTGTCGDPGTPGHGSRQESDFRTKSTVRFACDTGYILY----GSEERTCL-----SNGSWTGRQPE-CKAVQCGNPGTTANGKVFRI---DGTTFSSSVI---------YSCLEGYILSGPSVRQCTANGTWS-GSLPNCTIISCGDPGIPANGLRYGDD 3019          

HSP 5 Score: 94.3597 bits (233), Expect = 2.896e-19
Identity = 146/599 (24.37%), Postives = 217/599 (36.23%), Query Frame = 3
Query:  231 PECHVKSLDNVKHLPNGC-----PSKACTANIDCWVEY----DRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGY--EDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGR---TMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTC---IVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTL--IGETSFLTCGE-----VDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWN-FIPRCVEAACSARPPSMKYSTVRFL-SLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTK-MPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWSPPQMPTC 1937
            P C V S   +   PNG       S   TA   C + +       + C+      G     +   C  P   VNG          D V Y C  G+ L G   R CQ +   SG  P C   +  C      P + ++  ++ + F   + V   C  GY  + P K    A+C  N +W + P  C+  +C     P N +    + + N+TY ++    CN G+        F   +    CQ +G+W      C  I C     P N  + G   T  S   + C     L G   R C   G+W GS   C       CG P              HG++ E   +++ST+    +T ++  G      + N S    +PE K +    P    + KV+             D  T  + V   C  GY L+   +  C  NG+W+  +P C   +C    P +  + +R+           Y C  GY I L    + T +T        G W+  MPT  C+   C+ PP   NG           RL   +        + Y C   Y L  P +  C+ NG WS  ++P C
Sbjct: 2583 PRCVVISCGELPTPPNGNKIGTQTSYGSTAIFTCDLGFMLVGSAVRECLSSGLWSGSETRCLAGHCGIPELIVNGQVIGENYGYRDTVVYQCNPGFRLIGSSVRICQQDHNWSGQLPSCVPVS--CGH----PGSPIYGRTSGNGFNFNDVVTFSCNIGYLMQGPTK----AQCQANRQWSHPPPVCKVVNCSDPGIPANSKRESKIEHGNFTYGTVVFYDCNPGY--------FLFGSSVLICQPNGQWDKPLPECIMIDCGHPGIPPNAVLSGEKYTFGSTVHYSCTGKRSLLGQASRTCQLNGHWSGSQPHCSGDTTGTCGDP----------GTPGHGSRQESDFRTKSTVRFACDTGYILYGSEERTCLSNGSWTGRQPECKAVQCGNPGTTANGKVF-----------RIDGTTFSSSVIYSCLEGYILSGPSVRQCTANGTWSGSLPNCTIISCGD--PGIPANGLRYGDDFVVGQNVSYMCQPGYTIELNGSRVRTCTT-------NGTWSGVMPT--CRAVTCSTPPQISNG-----------RLEGTNFD--WGFSISYICSAGYELSFPAVLTCVGNGTWS-GEVPQC 3117          

HSP 6 Score: 90.8929 bits (224), Expect = 3.480e-18
Identity = 117/461 (25.38%), Postives = 162/461 (35.14%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANH-SILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCI--VRNCGPPPEIVFAKVAYEATTHGAQ----AEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLH-CKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDI--------------LPACYNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYY-IALRKDGMETLSTIFDIKCNKGNWT 1703
            +QC  P    NG             V Y+C  GY L GP  R C AN   SGS P CT    +    P IP   +      DDF  G++V  +CQ GY        +  C  N  W      C   +C       NGR +   N+ +       C+ G+++               C  +G WSG+   C    C +   P  G+  G      S  +F C   + L GS  R C  +G W GS+  CI   R     P +   +   +  T G Q     ++ CK    L G T+  TC      SG     +P+C+ H CK            E+    N +  D  +HG  +   C  G+ L                  +P C  GS   +     A  +  P          LS+  D  A+ Y   G Y    RK  M    T F+    + N T
Sbjct: 2943 VQCGNPGTTANGKVFRIDGTTFSSSVIYSCLEGYILSGPSVRQCTANGTWSGSLPNCTI---ISCGDPGIPANGLRYG---DDFVVGQNVSYMCQPGYTIELNGSRVRTCTTNGTWSGVMPTCRAVTCSTPPQISNGR-LEGTNFDWGFSISYICSAGYELSFP--------AVLTCVGNGTWSGEVPQCLPKFCGDPGIPSQGKREGKSFIYQSEVSFSCNSPFILVGSSTRLCQTDGTWSGSSPHCIEPTRTSCENPGV--PRHGSQNNTFGFQVGSVVQFHCKKGHLLQGSTT-RTCLPDLTWSGI----QPECIPHSCKQ----------PESPAHANVVGMDLPSHGYTLIYTCQPGFFLAGGTEHRVCRSDNTWTGKVPVCEAGSKILVKDPRPALGTPSPK---------LSVPDDVFAQNYIWKGSYNFKGRKQPMTLTVTSFNASTGRVNAT 3362          

HSP 7 Score: 58.5362 bits (140), Expect = 3.226e-8
Identity = 52/226 (23.01%), Postives = 87/226 (38.50%), Query Frame = 3
Query:  288 SKACTANIDCWVEYDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTA 962
            S  C+A  +  + +     CV +    G V   +   C  P  P  G       +   +V ++C S + L G   R CQ +   SGS P C + T      P +P     +N+    F+ G  V+  C+ G+    +      C  +  W     +C   SC + E P +   +  +  ++    I  C  GF +   T+        R C++D  W+G   +C A
Sbjct: 3087 SYICSAGYE--LSFPAVLTCVGNGTWSGEVPQCLPKFCGDPGIPSQGKREGKSFIYQSEVSFSCNSPFILVGSSTRLCQTDGTWSGSSPHCIEPTRTSCENPGVPRHGSQNNTF--GFQVGSVVQFHCKKGHL--LQGSTTRTCLPDLTWSGIQPECIPHSCKQPESPAHANVVGMDLPSHGYTLIYTCQPGFFLAGGTEH-------RVCRSDNTWTGKVPVCEA 3299          

HSP 8 Score: 57.3806 bits (137), Expect = 8.005e-8
Identity = 65/272 (23.90%), Postives = 102/272 (37.50%), Query Frame = 3
Query:  333 RAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDP--IKCEKKSCGKLEDPKNGRTMYNNNYTYQ-SIAIQF-CNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGV-WNTVNSIKTFKCKEGYQLH-GSHLRKCTREGNWDGSNSTC 1130
            R + C  +    G++     + C  P Q  NG    +    G  + Y C +GY L  P    C  N   SG  P+C  +   C   P IP     +  +   F    +V   C + +     S  + + +G      P  I+  + SC     P++G    NN + +Q    +QF C  G  +Q +T         R C  D  WSG    C    C +   P +  V+G+   +      + C+ G+ L  G+  R C  +  W G    C
Sbjct: 3042 RVRTCTTNGTWSGVMPTCRAVTCSTPPQISNGRLEGTNFDWGFSISYICSAGYELSFPAVLTCVGNGTWSGEVPQCLPK--FC-GDPGIPSQGKREGKS---FIYQSEVSFSCNSPFILVGSSTRLCQTDGTWSGSSPHCIEPTRTSCENPGVPRHGSQ--NNTFGFQVGSVVQFHCKKGHLLQGST--------TRTCLPDLTWSGIQPECIPHSCKQPESPAHANVVGMDLPSHGYTLIYTCQPGFFLAGGTEHRVCRSDNTWTGKVPVC 3297          
BLAST of C4b binding protein beta chain vs. Ensembl Mouse
Match: Csmd2 (CUB and Sushi multiple domains 2 [Source:MGI Symbol;Acc:MGI:2386401])

HSP 1 Score: 109.383 bits (272), Expect = 7.417e-24
Identity = 138/532 (25.94%), Postives = 204/532 (38.35%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQF-CNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWN------TVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFI-PRCVEAACSARPPSMKYSTVRFL-SLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCN-KGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAV--CLNGHWSPPQMPTCEFIM 1949
            + C     P +GH   ++ + G    ++C SGY L G R R C AN   SGSE  C      C +    P   V+ + N ++F     V   C+ G+     S  I + + + W      C   +CG   +P NG T             QF  ND  K  C      +   R QC A G+WS     C  I C +    EN  V  V        +  +  +++C  G+ L G+    C  +G WD     C++ +CG P     A+++ ++   GA   Y C  + TL+G ++ + CG   + +G LP        HC      S  V            + D    G+ +R  C+ G+ L       C  NGSW+   P C   +C   P +   + V F   L   S   Y C  GYY           + +    C+  G WT    E C    C  P  P NG    LG   R           +N+ V Y+C P Y ++  +++V  C          P C+ IM
Sbjct: 2659 ISCGELPTPPSGHRIGTMSVYGATAIFSCNSGYTLVGSRVRECMANGLWSGSEVRCL--AGHCGT----PEPIVNGHINGENFNYRGSVVYQCRAGFRLIGMSVRICQQD-HHWSGKTPFCVPITCGHPGNPVNGLTQ----------GSQFNLNDVVKFICNPGYIAEGAARSQCLASGQWSDTLPTCRIINCTDPGHQEN-SVRQVHTSGPHRFSFGTTVSYQCNHGFYLLGTPALSCQGDGTWDRPRPQCLLVSCGHPGSPPHAQMSGDSYIVGAVVRYSCTGKRTLVGNSTRM-CGLDGHWTGSLP--------HCSG---TSTGVCGDPGIPAHGIRLGDSFAPGSVMRFSCDAGHVLRGSSERMCQANGSWSGSQPECGVISC-GNPGTPSNARVVFSDGLVFSSSVVYECREGYYA----------TGLLSRHCSVNGTWTGSDPE-CTVINCGDPGIPANG--IRLGNDFR-----------YNKTVTYQCVPGYVMESHRVSVLSCTKDRTWNGTKPVCKAIM 3135          

HSP 2 Score: 95.1301 bits (235), Expect = 1.606e-19
Identity = 113/450 (25.11%), Postives = 174/450 (38.67%), Query Frame = 3
Query:  399 CQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNG----EDVKIICQNGYEDPYKSHIIAK---CNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILC--PELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFI-PRCVEAACSARPPSMKYSTVRFLSLKHDSLARYY-CHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMP 1712
            C  P  P +G         G  + ++C +G+ L+G  +R CQAN   SGS+PEC     +    P  P      ++ R  F +G      V   C+ GY   Y + ++++    NG     DP +C   +CG    P NG  +  N++ Y       C  G+ ++        +     C  D  W+G   +C AI+C  P+L P  NG+V+G   T  S  ++ C EGYQL    +  C   G+W G    C    CG P      +      ++ +   + C +   L+G      C      SG  P      L  C     D         N +  + +      G+ V  +C  GY L       C  N +W+   P CV   C  +P +  ++ V  L L        Y C  G+ +   + G E  +   D     G+WT  P
Sbjct: 2959 CGDPGIPAHGIRLGDSFAPGSVMRFSCDAGHVLRGSSERMCQANGSWSGSQPECGV---ISCGNPGTP------SNARVVFSDGLVFSSSVVYECREGY---YATGLLSRHCSVNGTWTGSDP-ECTVINCGDPGIPANGIRL-GNDFRYNKTVTYQCVPGYVME------SHRVSVLSCTKDRTWNGTKPVCKAIMCKPPQLIP--NGKVVGSDFTWGSSVSYACLEGYQLSLPAVLTCEGNGSWTGELPQCFPVFCGDPGVPPRGRREDRGFSYRSSVSFSCHAPLVLVGSPRRF-CQSDGTWSGTQPSCIDPTLTTC----ADPGMPQFGIQNSSQGYQV------GSTVLFRCQKGYLLQGSTTRTCLPNLTWSGTPPDCVPHHCK-QPETPTHANVGALDLPSMGYTLIYSCQEGFSL---RGGSEHRTCKAD-----GSWTGKP 3366          

HSP 3 Score: 93.2041 bits (230), Expect = 7.785e-19
Identity = 126/542 (23.25%), Postives = 195/542 (35.98%), Query Frame = 3
Query:  399 CQPPVQPVNGHA-NHSILLVGDQVEYTCKSGYALKGPRKRYC----QANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKC-NGNEWKYD-------PIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAI--CTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSW-NFIPRCVEAACSARPPSMKYSTVRFL------SLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXX----XXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCE 1940
            C  P  P++G     +    G  + + C +GY L G     C    Q     S + P C     L    P  P   +       ++  G      C  GY     +   A+C +   W          P+ C   S   +E  +  R ++   Y +Q+  +  C+ G+        +  +   R CQA+G+WS   ++  C  I C EL  P +G  +G  +   +   F C  GY L GS +R+C   G W GS   C+  +CG P  IV   +  E   +     Y+C++   LIG  S   C +  + SG  P         C P          H  N         +      V+  CN GY         C  +G W + +P C    C+   P  + ++VR +           +   Y C+ G+Y+     G   LS   D     G W + P   C         + P    +G+ Y++G                  VV+Y C     L G    +C L+GHW+   +P C 
Sbjct: 2471 CSLPKAPLHGFILGQTTTQPGGSIHFGCNTGYRLVGHSMAICTRHPQGYHLWSEAIPLCQA---LSCGLPDAPKNGIVFG---KEYTVGTKAVYSCNEGYHLQAGAEATAECLDTGLWSNSNVPPQCVPVTCPDISSISVEHGR-WRLIFETQYQFQAQLMLICDPGYY-------YTGQRVIR-CQANGRWSLGESMPTCQIISCGELPTPPSGHRIGTMSVYGATAIFSCNSGYTLVGSRVRECMANGLWSGSEVRCLAGHCGTPEPIVNGHINGENFNYRGSVVYQCRAGFRLIG-MSVRICQQDHHWSGKTP--------FCVPITCG------HPGNPVNGLTQGSQFNLNDVVKFICNPGYIAEGAARSQCLASGQWSDTLPTCRIINCTD--PGHQENSVRQVHTSGPHRFSFGTTVSYQCNHGFYLL----GTPALSCQGD-----GTWDR-PRPQCLLVSCGHPGSPPHAQMSGDSYIVGA-----------------VVRYSCTGKRTLVGNSTRMCGLDGHWT-GSLPHCS 2952          

HSP 4 Score: 89.7373 bits (221), Expect = 8.144e-18
Identity = 77/303 (25.41%), Postives = 122/303 (40.26%), Query Frame = 3
Query:  336 AQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPEC--TDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAI---LCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAY-EATTHGAQAEYKCK 1226
             ++C  D +  G     + + C  P  PVNG    S   + D V++ C  GY  +G  +  C A+ + S + P C   + TD       +   QVH  S    F  G  V   C +G+       +  + +G  W     +C   SCG    P + + M  ++Y   ++         +  CT  +    N  R C  DG W+G    C+     +C +   P +G  +G      S+  F C  G+ L GS  R C   G+W GS   C V +CG P     A+V + +     +   Y+C+
Sbjct: 2756 VRICQQDHHWSGKTPFCVPITCGHPGNPVNGLTQGSQFNLNDVVKFICNPGYIAEGAARSQCLASGQWSDTLPTCRIINCTDPGHQENSV--RQVH-TSGPHRFSFGTTVSYQCNHGFYLLGTPALSCQGDGT-WDRPRPQCLLVSCGHPGSPPHAQ-MSGDSYIVGAVV--------RYSCTGKRTLVGNSTRMCGLDGHWTGSLPHCSGTSTGVCGDPGIPAHGIRLGDSFAPGSVMRFSCDAGHVLRGSSERMCQANGSWSGSQPECGVISCGNPGTPSNARVVFSDGLVFSSSVVYECR 3045          

HSP 5 Score: 85.8853 bits (211), Expect = 1.166e-16
Identity = 133/542 (24.54%), Postives = 202/542 (37.27%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQ----ANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKN----GEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPI--KCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNK---SGWLPKPEPKC-LLHCK-PFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFG-YELNSDILPACYNGSWNFI-PRCVEAACS--ARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCN-KGNWT-KMPT-EGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCEFI 1946
            L C  P  P NG        VG +  Y+C  GY L+   +   +         S   P+C   T      P I    V     R  F+        + +IC  GY   Y    + +C  N  W        C+  SCG+L  P +G  +      Y + AI  CN G+ +  +          R+C A+G WSG    C A  C    P  NG + G          ++C+ G++L G  +R C ++ +W G    C+   CG P   V         T G+Q  +        I    ++  G   ++   SG      P C +++C  P   +++   +H +            + GT V  +CN G Y L +  L    +G+W+   P+C+  +C     PP  + S   ++     ++ RY C           G  TL       C   G+WT  +P   G     C  P  P +G           RL D S  P    V+++ C   + L+G    +C  NG WS  Q P C  I
Sbjct: 2532 LSCGLPDAPKNGIVFGKEYTVGTKAVYSCNEGYHLQAGAEATAECLDTGLWSNSNVPPQCVPVT-----CPDISSISVEHGRWRLIFETQYQFQAQLMLICDPGYY--YTGQRVIRCQANGRWSLGESMPTCQIISCGELPTPPSGHRI-GTMSVYGATAIFSCNSGYTLVGSR--------VRECMANGLWSGSEVRCLAGHCGTPEPIVNGHINGENFNYRGSVVYQCRAGFRLIGMSVRICQQDHHWSGKTPFCVPITCGHPGNPV------NGLTQGSQ--FNLNDVVKFICNPGYIAEGAARSQCLASGQWSDTLPTCRIINCTDPGHQENSVRQVHTSGP-------HRFSFGTTVSYQCNHGFYLLGTPALSCQGDGTWDRPRPQCLLVSCGHPGSPPHAQMSGDSYIV---GAVVRYSC----------TGKRTLVGNSTRMCGLDGHWTGSLPHCSGTSTGVCGDPGIPAHG----------IRLGD-SFAP--GSVMRFSCDAGHVLRGSSERMCQANGSWSGSQ-PECGVI 3015          

HSP 6 Score: 78.5666 bits (192), Expect = 2.575e-14
Identity = 133/597 (22.28%), Postives = 210/597 (35.18%), Query Frame = 3
Query:  219 AQYKPECHVKSLDNVKHLPNG-----CPSKACTANIDCWVEY----DRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGY--EDPYKSHIIAKCNGNEWKYDPIKCEKKSC---GKLEDP-KNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRN---CGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKC-LLHC-KPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFI-PRCVEAACSARPPSMKYSTVRFLS-LKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWSPPQMPTC 1937
             +  P C + S   +   P+G           TA   C   Y     R + C+ +    G     +   C  P   VNGH N         V Y C++G+ L G   R CQ +   SG  P C   T  C      P   V+  +    F   + VK IC  GY  E   +S  +A     +W      C   +C   G  E+  +   T   + +++ +     CN GF +  T            CQ DG W      C  + C     P + ++ G    V ++  + C     L G+  R C  +G+W GS   C   +   CG P          ++   G+   + C +   L G +  + C    + SG     +P+C ++ C  P    +A+V           +  D +   + V  +C  GY     +   C  NG+W    P C    C    P +  + +R  +  +++    Y C  GY +   +        +  + C K          C+   C  P    NG++     SD T              V Y C   Y+L  P +  C  NG W+  ++P C
Sbjct: 2650 GESMPTCQIISCGELPTPPSGHRIGTMSVYGATAIFSCNSGYTLVGSRVRECMANGLWSGSEVRCLAGHCGTPEPIVNGHINGENFNYRGSVVYQCRAGFRLIGMSVRICQQDHHWSGKTPFCVPIT--CGH----PGNPVNGLTQGSQFNLNDVVKFICNPGYIAEGAARSQCLAS---GQWSDTLPTCRIINCTDPGHQENSVRQVHTSGPHRFSFGTTVSYQCNHGFYLLGTP--------ALSCQGDGTWDRPRPQCLLVSCGHPGSPPHAQMSGDSYIVGAVVRYSCTGKRTLVGNSTRMCGLDGHWTGSLPHCSGTSTGVCGDPGIPAHGIRLGDSFAPGSVMRFSCDAGHVLRGSSERM-CQANGSWSG----SQPECGVISCGNPGTPSNARV-----------VFSDGLVFSSSVVYECREGYYATGLLSRHCSVNGTWTGSDPECTVINCGD--PGIPANGIRLGNDFRYNKTVTYQCVPGYVMESHR--------VSVLSCTKDRTWNGTKPVCKAIMCKPPQLIPNGKVV---GSDFT----------WGSSVSYACLEGYQLSLPAVLTCEGNGSWT-GELPQC 3189          

HSP 7 Score: 65.4698 bits (158), Expect = 2.417e-10
Identity = 46/190 (24.21%), Postives = 76/190 (40.00%), Query Frame = 3
Query:  399 CQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAI 965
            C  P  P  G            V ++C +   L G  +R+CQ++   SG++P C D T    + P +P   + ++S    ++ G  V   CQ GY    +      C  N  W   P  C    C + E P +      +  +     I  C +GF ++  ++        R C+ADG W+G   +C  +
Sbjct: 3194 CGDPGVPPRGRREDRGFSYRSSVSFSCHAPLVLVGSPRRFCQSDGTWSGTQPSCIDPTLTTCADPGMPQFGIQNSSQ--GYQVGSTVLFRCQKGYL--LQGSTTRTCLPNLTWSGTPPDCVPHHCKQPETPTHANVGALDLPSMGYTLIYSCQEGFSLRGGSEH-------RTCKADGSWTGKPPVCLEV 3372          
BLAST of C4b binding protein beta chain vs. Ensembl Mouse
Match: Csmd3 (CUB and Sushi multiple domains 3 [Source:MGI Symbol;Acc:MGI:2386403])

HSP 1 Score: 107.457 bits (267), Expect = 2.474e-23
Identity = 90/310 (29.03%), Postives = 123/310 (39.68%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYA--LKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAIC---TAILCPELSPPENGEVMGVWN-TVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKV-AYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLP 1301
            + C  P  P NG       +VG  V Y C+ GY   L G R R C  N   SG  P C   T  C + P I   ++       +F  G  +  IC  GYE  + + +    NG  W  +  +C  K CG    P  G+     ++ YQS     CN  F +  ++         R CQ DG WSG +  C   T   C     P +G     +   V S+  F CK+G+ L GS  R C  +  W G    CI  +C  P     A V   +  +HG    Y C+    L G T    C   +  +G +P
Sbjct: 2261 ISCGDPGIPANGLRYGDDFVVGQNVSYMCQPGYTIELNGSRVRTCTTNGTWSGVMPTCRAVT--CSTPPQISNGRLEGT----NFDWGFSISYICSAGYELSFPAVLTCVGNGT-WSGEVPQCLPKFCGDPGIPSQGKRE-GKSFIYQSEVSFSCNSPFILVGSS--------TRLCQTDGTWSGSSPHCIEPTRTSCENPGVPRHGSQNNTFGFQVGSVVQFHCKKGHLLQGSTTRTCLPDLTWSGIQPECIPHSCKQPESPAHANVVGMDLPSHGYTLIYTCQPGFFLAGGTEHRVCRSDNTWTGKVP 2554          

HSP 2 Score: 102.834 bits (255), Expect = 6.031e-22
Identity = 115/443 (25.96%), Postives = 159/443 (35.89%), Query Frame = 3
Query:  336 AQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNS-NRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAIC---TAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKV-AYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGY--ELNSDILPAC-YNGSWN-FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIAL 1637
             ++C  D    G +   + + C  P  P+ G  + +     D V ++C  GY ++GP K  CQAN + S   P C  +   C S P IP     ++     +F  G  V   C  GY     S +I + NG +W     +C    CG    P N   +    YT+ S             CT  +       R CQ +G WSG    C   T   C +   P +G          S   F C  GY L+GS  R C   G+W G    C    CG P      KV   + TT  +   Y C     L G  S   C      SG LP        +C         +              D+   G +V   C  GY  ELN   +  C  NG+W+  +P C    CS  PP +    +   +        Y C  GY ++ 
Sbjct: 1944 VRICQQDHNWSGQLPSCVPVSCGHPGSPIYGRTSGNGFNFNDVVTFSCNIGYLMQGPTKAQCQANRQWSHPPPVC--KVVNC-SDPGIPANSKRESKIEHGNFTYGTVVFYDCNPGYFLFGSSVLICQPNG-QWDKPLPECIMIDCGHPGIPPNA-VLSGEKYTFGSTV--------HYSCTGKRSLLGQASRTCQLNGHWSGSQPHCSGDTTGTCGDPGTPGHGSRQESDFRTKSTVRFACDTGYILYGSEERTCLSNGSWTGRQPECKAVQCGNPGTTANGKVFRIDGTTFSSSVIYSCLEGYILSGP-SVRQCTANGTWSGSLP--------NCTIISCGDPGI------PANGLRYGDDFVVGQNVSYMCQPGYTIELNGSRVRTCTTNGTWSGVMPTCRAVTCST-PPQISNGRLEGTNFDWGFSISYICSAGYELSF 2357          

HSP 3 Score: 95.1301 bits (235), Expect = 1.485e-19
Identity = 145/600 (24.17%), Postives = 218/600 (36.33%), Query Frame = 3
Query:  228 KPECHVKSLDNVKHLPNGC-----PSKACTANIDCWVEY----DRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGY--EDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGR---TMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTC---IVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTL--IGETSFLTCGE-----VDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWN-FIPRCVEAACSARPPSMKYSTVRFLS-LKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTK-MPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWSPPQMPTC 1937
            +P C + S   +   PNG       S   TA   C + +       + C+      G     +   C  P   VNG          D V Y C  G+ L G   R CQ +   SG  P C   +  C      P + ++  ++ + F   + V   C  GY  + P K    A+C  N +W + P  C+  +C     P N +    + + N+TY ++    CN G+        F   +    CQ +G+W      C  I C     P N  + G   T  S   + C     L G   R C   G+W GS   C       CG P              HG++ E   +++ST+    +T ++  G      + N S    +PE K +    P    + KV+             D  T  + V   C  GY L+   +  C  NG+W+  +P C   +C    P +  + +R+           Y C  GY I L    + T +T        G W+  MPT  C+   C+ PP   NG           RL   +        + Y C   Y L  P +  C+ NG WS  ++P C
Sbjct: 1841 RPYCQIISCGELPTPPNGNKIGTQTSYGSTAIFTCDLGFMLVGSAVRECLSSGLWSGSETRCLAGHCGIPELIVNGQVIGENYGYRDTVVYQCNPGFRLIGSSVRICQQDHNWSGQLPSCVPVS--CGH----PGSPIYGRTSGNGFNFNDVVTFSCNIGYLMQGPTK----AQCQANRQWSHPPPVCKVVNCSDPGIPANSKRESKIEHGNFTYGTVVFYDCNPGY--------FLFGSSVLICQPNGQWDKPLPECIMIDCGHPGIPPNAVLSGEKYTFGSTVHYSCTGKRSLLGQASRTCQLNGHWSGSQPHCSGDTTGTCGDP----------GTPGHGSRQESDFRTKSTVRFACDTGYILYGSEERTCLSNGSWTGRQPECKAVQCGNPGTTANGKVF-----------RIDGTTFSSSVIYSCLEGYILSGPSVRQCTANGTWSGSLPNCTIISCGD--PGIPANGLRYGDDFVVGQNVSYMCQPGYTIELNGSRVRTCTT-------NGTWSGVMPT--CRAVTCSTPPQISNG-----------RLEGTNFD--WGFSISYICSAGYELSFPAVLTCVGNGTWS-GEVPQC 2376          

HSP 4 Score: 94.3597 bits (233), Expect = 3.108e-19
Identity = 136/546 (24.91%), Postives = 191/546 (34.98%), Query Frame = 3
Query:  369 GLVCMEIDLQCQPPVQPVNGHANHSILLVGDQ----VEYTCKSGYALKGPRKRYCQANL----RLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKY--DPIKCEKKSCGKLE----DPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDT--AICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFIPRCVEAACSARPP----SMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXN----GEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQ 1925
            G     I   C  P  P +G+    I   G Q    V + C  G+ L G     C+ +           P C  Q   C     IP    +      D+  G  V   C +GY    K    A C  +  W       +C   +C  +     D    R +  ++Y Y++  +  C+ G+                +C  +G WS  T    C  I C EL  P NG  +G   +  S   F C  G+ L GS +R+C   G W GS + C+  +CG P  IV  +V  E   +     Y+C     LIG +S   C +  N SG LP         C P         I+       F  +D VT        CN GY +       C  N  W+  P   +    + P     S + S +   +  + ++  Y C+ GY++          S++   + N G W K P   C    C  P  P N    GE Y  G +                 V Y C     L G     C LNGHWS  Q
Sbjct: 1649 GFRIRYIAFYCSTPESPPHGYI---ISQTGGQLNSVVRWACDRGFRLVGKSSAVCRKSSYGYHSWDAPVPAC--QAISC----GIPKAPTNGGILTTDYLVGTRVTYFCNDGYRLSSKELTTATCQSDGTWSNHNKTPRCVVVTCPSINSFTLDHGRWRIVNGSHYEYKTKVVFSCDPGYH--------GLGPASIECLPNGTWSWRTERPYCQIISCGELPTPPNGNKIGTQTSYGSTAIFTCDLGFMLVGSAVRECLSSGLWSGSETRCLAGHCGIPELIVNGQVIGENYGYRDTVVYQCNPGFRLIG-SSVRICQQDHNWSGQLPS--------CVPVSCGHPGSPIYGRTSGNGFNFNDVVTF------SCNIGYLMQGPTKAQCQANRQWSHPPPVCKVVNCSDPGIPANSKRESKIEHGNFTYGTVVFYDCNPGYFLF--------GSSVLICQPN-GQWDK-PLPECIMIDCGHPGIPPNAVLSGEKYTFGST-----------------VHYSCTGKRSLLGQASRTCQLNGHWSGSQ 2135          

HSP 5 Score: 90.8929 bits (224), Expect = 3.491e-18
Identity = 117/461 (25.38%), Postives = 162/461 (35.14%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANH-SILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCI--VRNCGPPPEIVFAKVAYEATTHGAQ----AEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLH-CKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDI--------------LPACYNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYY-IALRKDGMETLSTIFDIKCNKGNWT 1703
            +QC  P    NG             V Y+C  GY L GP  R C AN   SGS P CT    +    P IP   +      DDF  G++V  +CQ GY        +  C  N  W      C   +C       NGR +   N+ +       C+ G+++               C  +G WSG+   C    C +   P  G+  G      S  +F C   + L GS  R C  +G W GS+  CI   R     P +   +   +  T G Q     ++ CK    L G T+  TC      SG     +P+C+ H CK            E+    N +  D  +HG  +   C  G+ L                  +P C  GS   +     A  +  P          LS+  D  A+ Y   G Y    RK  M    T F+    + N T
Sbjct: 2202 VQCGNPGTTANGKVFRIDGTTFSSSVIYSCLEGYILSGPSVRQCTANGTWSGSLPNCTI---ISCGDPGIPANGLRYG---DDFVVGQNVSYMCQPGYTIELNGSRVRTCTTNGTWSGVMPTCRAVTCSTPPQISNGR-LEGTNFDWGFSISYICSAGYELSFPA--------VLTCVGNGTWSGEVPQCLPKFCGDPGIPSQGKREGKSFIYQSEVSFSCNSPFILVGSSTRLCQTDGTWSGSSPHCIEPTRTSCENPGV--PRHGSQNNTFGFQVGSVVQFHCKKGHLLQGSTT-RTCLPDLTWSGI----QPECIPHSCKQ----------PESPAHANVVGMDLPSHGYTLIYTCQPGFFLAGGTEHRVCRSDNTWTGKVPVCEAGSKILVKDPRPALGTPSPK---------LSVPDDVFAQNYIWKGSYNFKGRKQPMTLTVTSFNASTGRVNAT 2621          

HSP 6 Score: 88.5817 bits (218), Expect = 1.987e-17
Identity = 126/522 (24.14%), Postives = 185/522 (35.44%), Query Frame = 3
Query:  462 QVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKC-NGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIV----FAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFI-PRCV--EAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCEFIMHDE--LPISWLYYRSD 1991
            +V ++C  GY   GP    C  N   S        Q   C   P  P    + N        G      C  G+        + +C +   W     +C    CG  E   NG+ +   NY Y+   +  CN GF++  ++         R CQ D  WSG    C  + C     P  G   G     N + TF C  GY + G    +C     W      C V NC  P         +K+ +   T+G    Y C     L G +S L C      +G   KP P+C++      +D     I  N      +  ++ T G+ V   C     L       C  NG W+   P C          P +  + + +    +  S  R+ C  GY +     G E  + +     + G+WT    E C+  +C  P T  NG+++ +   D T  +   I         Y C   Y L GP +  C  NG WS   +P C  I   +  +P + L Y  D
Sbjct: 1810 KVVFSCDPGYHGLGPASIECLPNGTWSWRTERPYCQIISCGELPTPP----NGNKIGTQTSYGSTAIFTCDLGFM--LVGSAVRECLSSGLWSGSETRCLAGHCGIPELIVNGQVI-GENYGYRDTVVYQCNPGFRLIGSS--------VRICQQDHNWSGQLPSCVPVSCGHPGSPIYGRTSGNGFNFNDVVTFSCNIGYLMQGPTKAQCQANRQWSHPPPVCKVVNCSDPGIPANSKRESKIEHGNFTYGTVVFYDCNPGYFLFG-SSVLIC----QPNGQWDKPLPECIM------IDCGHPGIPPNA----VLSGEKYTFGSTVHYSCTGKRSLLGQASRTCQLNGHWSGSQPHCSGDTTGTCGDPGTPGHGSRQESDFRTKSTVRFACDTGYILY----GSEERTCL-----SNGSWTGRQPE-CKAVQCGNPGTTANGKVFRI---DGTTFSSSVI---------YSCLEGYILSGPSVRQCTANGTWS-GSLPNCTIISCGDPGIPANGLRYGDD 2278          

HSP 7 Score: 58.5362 bits (140), Expect = 2.765e-8
Identity = 52/226 (23.01%), Postives = 87/226 (38.50%), Query Frame = 3
Query:  288 SKACTANIDCWVEYDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTA 962
            S  C+A  +  + +     CV +    G V   +   C  P  P  G       +   +V ++C S + L G   R CQ +   SGS P C + T      P +P     +N+    F+ G  V+  C+ G+    +      C  +  W     +C   SC + E P +   +  +  ++    I  C  GF +   T+        R C++D  W+G   +C A
Sbjct: 2346 SYICSAGYE--LSFPAVLTCVGNGTWSGEVPQCLPKFCGDPGIPSQGKREGKSFIYQSEVSFSCNSPFILVGSSTRLCQTDGTWSGSSPHCIEPTRTSCENPGVPRHGSQNNTF--GFQVGSVVQFHCKKGHL--LQGSTTRTCLPDLTWSGIQPECIPHSCKQPESPAHANVVGMDLPSHGYTLIYTCQPGFFLAGGTEH-------RVCRSDNTWTGKVPVCEA 2558          

HSP 8 Score: 57.3806 bits (137), Expect = 7.930e-8
Identity = 65/272 (23.90%), Postives = 102/272 (37.50%), Query Frame = 3
Query:  333 RAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDP--IKCEKKSCGKLEDPKNGRTMYNNNYTYQ-SIAIQF-CNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGV-WNTVNSIKTFKCKEGYQLH-GSHLRKCTREGNWDGSNSTC 1130
            R + C  +    G++     + C  P Q  NG    +    G  + Y C +GY L  P    C  N   SG  P+C  +   C   P IP     +  +   F    +V   C + +     S  + + +G      P  I+  + SC     P++G    NN + +Q    +QF C  G  +Q +T         R C  D  WSG    C    C +   P +  V+G+   +      + C+ G+ L  G+  R C  +  W G    C
Sbjct: 2301 RVRTCTTNGTWSGVMPTCRAVTCSTPPQISNGRLEGTNFDWGFSISYICSAGYELSFPAVLTCVGNGTWSGEVPQCLPK--FC-GDPGIPSQGKREGKS---FIYQSEVSFSCNSPFILVGSSTRLCQTDGTWSGSSPHCIEPTRTSCENPGVPRHGSQ--NNTFGFQVGSVVQFHCKKGHLLQGST--------TRTCLPDLTWSGIQPECIPHSCKQPESPAHANVVGMDLPSHGYTLIYTCQPGFFLAGGTEHRVCRSDNTWTGKVPVC 2556          
BLAST of C4b binding protein beta chain vs. UniProt/SwissProt
Match: sp|Q22328|LEV9_CAEEL (Protein lev-9 OS=Caenorhabditis elegans OX=6239 GN=lev-9 PE=1 SV=3)

HSP 1 Score: 192.971 bits (489), Expect = 9.435e-52
Identity = 169/578 (29.24%), Postives = 241/578 (41.70%), Query Frame = 3
Query:  291 KACTANIDCWVEYDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHS-ILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSN-RDDFKNGEDVKIICQNGYED-PYKSHIIAKC-----NGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTK-MPTEGCQXX----XXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTCEFIMHDELPISWLYYR 1985
            K C A+ DC     R + C+CD   CGL C+     C P     NG    +  L  G   EY C  GY L G  +R CQAN   S S+P C  Q   C   P IP+  VHD S+   ++    +V   C  GY     K   I+KC     N  +W    ++C+ ++C    D +NG     + + Y       CN GF +  +T         RQC ++G+W+ + A C A  C   S P +G+V+G   T  S+ T+ C  GY+L G   R C  EG W G+   C    C   P +    +    T+ GA A ++C    T  G  S   C E     G    P P+CL  C+   + + K+      +         +  G+ V  +CN  +E N D    C N +W+ +P C   +C   PP + ++ + F    H S+A+Y C+ GY+   R + +        IKC  G WTK  P   C P           T   G+I L G            K    R + ++C     L GP  A C+NG W P   P C    H  +    L+ R
Sbjct:   33 KECIADEDC----KRNKRCMCDGE-CGLSCVNPIAMCHPLPNIENGFIRTAGDLRFGSNAEYGCNKGYILVGASQRRCQANKEWSSSQPVCRLQLK-CGPPPEIPFA-VHDGSSFSGEYDLDAEVAYNCIPGYHKFNAKGLSISKCLLNRKNVAQWFGPDLRCKARACPDPGDIENG-LREGDTFEYPHHVKYSCNPGFLLVGSTS--------RQCSSNGEWTNEPANCKATECSRPSSPLHGKVVGSSLTYQSVVTYSCDHGYRLVGQVQRICLAEGIWGGNEPRCEEIRCSVLPTLPNGYIEGSETSFGAVAVFRCLETMTHEG-ASKAKCME----DGQWSAPIPRCLASCRVPHIQNGKIRDKSEGQL--------IASGSKVIVECNKQHEANIDERLICSNSTWSHVPVCSPLSCHNWPPRVPHARILFSKSSHGSIAKYECNNGYH-PNRNNQI--------IKCLYGEWTKDGPPMKCLPSWCEHPSKTYGTLPGGQILLEGILGAYEFQSYIQKVEEGRAISFQCGKGNYLIGPPKATCVNGEWMPKVSPKCVSQTHPMIEGKILWDR 572          
BLAST of C4b binding protein beta chain vs. UniProt/SwissProt
Match: sp|P0C6B8|SVEP1_RAT (Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Svep1 PE=1 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 2.334e-31
Identity = 152/565 (26.90%), Postives = 226/565 (40.00%), Query Frame = 3
Query:  288 SKACTANIDCWVEYDRAQLCVC----DSYLC---------GLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPE----PKCLLH-CKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFIP---RCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHW 1913
            S +C    +C V  D ++   C     SY+C         G  C E  ++C+ P  P NGH+   I  VG +V ++C+ G+ L G RK  C  +       P C     +   AP +P     D S    F  G  V+  C  GY            +G+ W +    CE   C + E+  NG+ +  +  TY SIA   C DG+ +Q  +          +C A G W      C  + C E    ++    G   T  ++ T+ CKEGY L G     C   G W+ SN  C+  +C  PP +  A         G  A Y C    +L  + S L C    N   W+P PE    P+C+ H C+  +  S    I E+     F        G+ V  KC  G+ LN+     C   G W+  P   +C+   C   PPS+        +    ++  Y CH G+YI   K      +         G W++ P   C P  C +PP  +NG  +L   + RT  ++           +++C+P Y+  G  + VC  N HW
Sbjct: 1735 SPSCLDVDECAVGSDCSEHASCLNTNGSYICSCKPPYTGDGKNCAE-PVKCKAPENPENGHSLGKIYSVGAEVTFSCEEGHQLVGVRKITCLESGEWDHLRPSC---EAISCGAPPVPENGGVDGSA---FTYGSKVRYRCDKGYTLAGDEESACLASGS-WSHSSPVCELVKCSQPENINNGKYIL-SGLTYLSIASYSCEDGYSLQGPS--------LIECTASGSWDRAPPSCQLVSCGEPPMVKDALTTGSNFTFGNMVTYTCKEGYTLAGPDTIICQANGKWNSSNHQCLAVSCDEPPNVDHASPETAHRLFGDTAFYYCADGYSL-ADNSQLICNAQGN---WVP-PEGQAVPRCIAHFCE--KPPSVSYSILESVSKAKFAA------GSVVSFKCMEGFVLNTSAKIECLRGGQWSPSPLSVQCIPVRC-GEPPSITNGYPSGTNYSFGAVVAYSCHKGFYIKGEKKSTCEAT---------GQWSR-PLPTCHPVSCNEPPKVENG--FLEHTTGRTFESE----------ARFQCNPGYKAVGSPVFVCQANRHW 2246          

HSP 2 Score: 124.79 bits (312), Expect = 6.727e-28
Identity = 152/573 (26.53%), Postives = 229/573 (39.97%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTD-------------LCFSAPYI-----PYTQVHDN-----------------SNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCL-LHC-KPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSW-----NFIPRCVEAACSARPPSMKYSTVRFLS---LKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGN-WTKMP-TEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCEFIMHDELP 1964
            ++C  P    NG  +   L  G  V Y C SGY L G  + +C  N   +G  P C D  +             L  +  YI     PYT    N                 S    +  G +V   C+ G++      I    +G EW +    CE  SCG    P+NG  +  + +TY S     C+ G+ +    +          C A G WS  + +C  + C +     NG+ +    T  SI ++ C++GY L G  L +CT  G+WD +  +C + +CG PP +  A       T G    Y CK   TL G  + +        +G       +CL + C +P  VD      H + +T + +  D   +       C  GY L  +    C   G+W       +PRC+   C  +PPS+ YS +  +S       S+  + C  G+           L+T   I+C +G  W+  P +  C P +C +PP+  NG  Y  G       T+ S       VV Y CH  + +KG K + C   G WS P +PTC  +  +E P
Sbjct: 1683 IRCGLPPTLENGFYSAEDLHAGSTVTYQCTSGYYLLGDSRMFCTDNGSWNGISPSCLDVDECAVGSDCSEHASCLNTNGSYICSCKPPYTGDGKNCAEPVKCKAPENPENGHSLGKIYSVGAEVTFSCEEGHQLVGVRKITCLESG-EWDHLRPSCEAISCGAPPVPENG-GVDGSAFTYGSKVRYRCDKGYTLAGDEES--------ACLASGSWSHSSPVCELVKCSQPENINNGKYILSGLTYLSIASYSCEDGYSLQGPSLIECTASGSWDRAPPSCQLVSCGEPPMVKDALTTGSNFTFGNMVTYTCKEGYTLAGPDTIIC-----QANGKWNSSNHQCLAVSCDEPPNVD------HASPETAHRLFGDTAFY------YCADGYSLADNSQLICNAQGNWVPPEGQAVPRCIAHFCE-KPPSVSYSILESVSKAKFAAGSVVSFKCMEGF----------VLNTSAKIECLRGGQWSPSPLSVQCIPVRCGEPPSITNG--YPSG-------TNYSF----GAVVAYSCHKGFYIKGEKKSTCEATGQWSRP-LPTCHPVSCNEPP 2203          

HSP 3 Score: 117.472 bits (293), Expect = 1.196e-25
Identity = 131/511 (25.64%), Postives = 200/511 (39.14%), Query Frame = 3
Query:  441 SILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTD-QTDLCFSAP--YIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAE--YKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWN-FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNK-GNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLN-GHWSPPQMPTCEFI 1946
            S  L G  V Y C+ GY L G     CQ +   +G+ P C   + DL  +    ++ +TQ            G   +  C+ G+     SH+       +W     +CE  SC +     NG ++  N+Y+Y  +    C+ G+ +  T         +R CQ + +W G   +C  + C     P NG+V G   T      + C EG+ L G+  R C   G+W G+  +C+   C  PP++  A    +   +G + E  + C     L G T  LTC         +P         CKP                 +F       HG H++ +C  GY+L+ +    C  +GSW+   P C+   CS   P ++  TV    L      +  C  G+           L  + +I C+  G W+  P   C+   C   PT  NG I + G             P  + VV Y C P Y ++G    +C   G WS P  PTCE +
Sbjct: 2667 SQFLYGTTVSYRCEPGYELLGIPVLVCQEDGTWNGTAPSCISIECDLPVAPENGFLHFTQT---------TMGSAAQYSCKPGHVL-EGSHLRLCLQNKQWSGTVPRCEVISCSEPNPLGNG-SIKGNDYSYLGVLHYECDSGYVLNGTE--------KRTCQENKQWDGHEPVCLPVDCGSPPVPTNGQVTGEEYTFQKEIAYSCGEGFILEGARSRVCLTNGSWSGTTPSCVPVRCPAPPQV--ANGVTDGLDYGFKKEVTFHCLEGYVLQG-TPKLTCQSNGTWDAEVPI--------CKPATCGPPADLPQGFPNGFSFF------HGGHIQYQCFTGYKLHGNPSRRCLPDGSWSGSTPSCLPCTCST--PIIQQGTVNATDLGCGKTVQIECFKGF----------KLLGLPEITCDANGQWSDFPL--CEHADCGPLPTVPNG-IVIKG------------SPSEDNVVTYSCRPGYIIQGSSDLICTEKGIWSEP-YPTCEPV 3113          

HSP 4 Score: 113.62 bits (283), Expect = 2.120e-24
Identity = 111/431 (25.75%), Postives = 164/431 (38.05%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFD 1676
            I ++C  PV P NG  + +   +G   +Y+CK G+ L+G   R C  N + SG+ P C  +   C     +    +  N    D+     +   C +GY          + N     ++P+ C    CG    P NG+ +    YT+Q      C +GF ++            R C  +G WSG T  C  + CP      NG   G+        TF C EGY L G+    C   G WD     C    CGPP ++        +  HG   +Y+C +   L G  S   C    + SG  P         C P    +  +     N T       ++  G  V+ +C  G++L       C  NG W+  P C  A C    P++    V   S   D++  Y C  GY I    D + T   I+ 
Sbjct: 2707 ISIECDLPVAPENGFLHFTQTTMGSAAQYSCKPGHVLEGSHLRLCLQNKQWSGTVPRC--EVISCSEPNPLGNGSIKGN----DYSYLGVLHYECDSGYVLNGTEKRTCQENKQWDGHEPV-CLPVDCGSPPVPTNGQ-VTGEEYTFQKEIAYSCGEGFILEGARS--------RVCLTNGSWSGTTPSCVPVRCPAPPQVANGVTDGLDYGFKKEVTFHCLEGYVLQGTPKLTCQSNGTWDAEVPICKPATCGPPADLPQGFPNGFSFFHGGHIQYQCFTGYKLHGNPS-RRCLPDGSWSGSTPS--------CLPCTCSTPIIQQGTVNAT-------DLGCGKTVQIECFKGFKLLGLPEITCDANGQWSDFPLCEHADCGPL-PTVPNGIVIKGSPSEDNVVTYSCRPGYIIQGSSDLICTEKGIWS 3104          

HSP 5 Score: 105.531 bits (262), Expect = 6.622e-22
Identity = 128/523 (24.47%), Postives = 204/523 (39.01%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYD-PIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGD-TAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTH-GAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDE-VTHGTHVRAKCNFGYELNSDILPAC-YNGSW-NFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTC 1937
            I ++C  P    NG+ + +    G  V Y+C  G+ +KG +K  C+A  + S   P C   +  C   P +    +   + R  F++  + +  C  GY+       + + N   W  D P+ C   +CGK    +NG  +   ++   S     CN+G+++          +    CQ  GKWS   +  C    C E    EN  V+    +   + T  CKEG+ L G  + KC   G W+GS   C +  C  PP I F   A     H G+  +Y C     L G    L   +VD   G    P P+C+            V   +  +  N I+H + + + +     C  G+EL  +    C  NG W    P C    C   P  +       +S ++     Y C  G+    R +G ++L+ +       GNW  M    C    C+ P   +NG  ++ G   R           +  ++ Y C P +++ G  +  C    WS    PTC
Sbjct: 2137 IPVRCGEPPSITNGYPSGTNYSFGAVVAYSCHKGFYIKGEKKSTCEATGQWSRPLPTCHPVS--CNEPPKVENGFLEHTTGRT-FES--EARFQCNPGYKAVGSPVFVCQAN-RHWHSDAPLSCTPLNCGKPPPIQNG-FLRGESFEVGSKVQFVCNEGYELV--------GDNSWTCQKSGKWSKKPSPKCVPTKCAEPPLLENQLVLKELTSEVGVMTISCKEGHALQGPSVLKCLPSGQWNGSFPVCKLVLCQSPPLIPFGVPASSGALHFGSTVKYLCVDGFFLRGNPIILC--QVD---GTWSSPLPECV-----------PVECPQPEEILNGIIHVQGLAYLSTTLYTCKPGFELVGNTTTLCGENGQWLGGKPMCRPIEC-PEPKEILNGQFSSVSFQYGQTITYSCDRGF----RLEGPKSLTCL-----ETGNW-DMDAPSCNAIHCSDPQPIENG--FVEGADYR-----------YGAMIIYSCFPGFQVVGHAMQTCEETGWS-SSSPTC 2603          

HSP 6 Score: 100.523 bits (249), Expect = 2.811e-20
Identity = 130/571 (22.77%), Postives = 207/571 (36.25%), Query Frame = 3
Query:  375 VCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTY-QSIAIQF-CNDGFK-------------------------------IQCTTDQFEDKNCRRQ------------------CQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFIPRCVEAAC----SARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWS 1916
            VC+ +D  C  P  P NG           ++ Y+C  G+ L+G R R C  N   SG+ P C      C + P +     +  ++  D+   ++V   C  GY       +  + NG  W  +   C+  +CG   D   G   + N +++     IQ+ C  G+K                               IQ  T    D  C +                   C A+G+WS D  +C    C  L    NG V+    + +++ T+ C+ GY + GS    CT +G W     TC   +CGPPP +  A    EA T+ ++ + +C     +  +T   TC + D +  W P+      ++C P      K     +N+T   +  D+      V   C  G+  +      C  +G+W   P   E +C      +P S ++  V        S   Y C  GY +   ++ +          C +          C+  +C  P    NG+  L   +    L              + CH  Y L+GP  A C  NG WS
Sbjct: 2821 VCLPVD--CGSPPVPTNGQVTGEEYTFQKEIAYSCGEGFILEGARSRVCLTNGSWSGTTPSCVPVR--CPAPPQV----ANGVTDGLDYGFKKEVTFHCLEGYVLQGTPKLTCQSNGT-WDAEVPICKPATCGPPADLPQG---FPNGFSFFHGGHIQYQCFTGYKLHGNPSRRCLPDGSWSGSTPSCLPCTCSTPIIQQGTVNATDLGCGKTVQIECFKGFKLLGLPEITCDANGQWS-DFPLCEHADCGPLPTVPNGIVIKGSPSEDNVVTYSCRPGYIIQGSSDLICTEKGIWSEPYPTCEPVSCGPPPTVANAVATGEAHTYESKVKLRCLEGYVVDTDTDTFTC-QQDGR--WFPE-----RINCSP------KTCPVPSNRTRIRVHGDDFQVNRQVSVSCTEGFTYDGADRSTCQPDGTWE--PPLSEESCIPVVCGQPESPEHGFVVGSEYSFGSTVVYQCDPGYELEGNRERV----------CQENRQWSGRVAVCRESRCEAPAEFPNGKAVLENTTSGPSLL-------------FSCHRGYTLEGPPEAHCTANGTWS 3339          

HSP 7 Score: 100.138 bits (248), Expect = 3.670e-20
Identity = 103/421 (24.47%), Postives = 160/421 (38.00%), Query Frame = 3
Query:  474 TCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGET---------------------------SFLTCGEVDNKSGWLPKPE-----PKCLLHCKPFQVDSAKVYIHENNKTTNFIMH-DEVTHGTHVRAKCNFGYELNSDILPACY-NGSWN-FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYI 1631
            +CK G+AL+GP    C  + + +GS P C  +  LC S P IP+  V  +S    F  G  VK +C +G+       I+ + +G  W     +C    C + E+  NG  ++     Y S  +  C  GF++   T           C  +G+W G   +C  I CPE     NG+   V        T+ C  G++L G     C   GNWD    +C   +C  P  I    V      +GA   Y C     ++G                              F  C  V +  G+  + +     P    H +  +  +    I E     + + H  +  +GT V  +C  GYEL    +  C  +G+WN   P C+   C   P + +   + F      S A+Y C  G+ +
Sbjct: 2343 SCKEGHALQGPSVLKCLPSGQWNGSFPVC--KLVLCQSPPLIPF-GVPASSGALHF--GSTVKYLCVDGFFLRGNPIILCQVDGT-WSSPLPECVPVECPQPEEILNG-IIHVQGLAYLSTTLYTCKPGFELVGNTTTL--------CGENGQWLGGKPMCRPIECPEPKEILNGQFSSVSFQYGQTITYSCDRGFRLEGPKSLTCLETGNWDMDAPSCNAIHCSDPQPIENGFVEGADYRYGAMIIYSCFPGFQVVGHAMQTCEETGWSSSSPTCVPIDCGLPPHIDFGDCTRVSDGQGYFVQEDDMMEVPYLTPHPQHLEATAKASEITEE----SLVPHASQFLYGTTVSYRCEPGYELLGIPVLVCQEDGTWNGTAPSCISIECDL-PVAPENGFLHFTQTTMGSAAQYSCKPGHVL 2743          

HSP 8 Score: 97.4413 bits (241), Expect = 2.175e-19
Identity = 136/576 (23.61%), Postives = 215/576 (37.33%), Query Frame = 3
Query:  450 LVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQ--TDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDP--IKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEV-MGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNS-TCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSG-WLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWN-FIPRCVEAACSARPPSMKYST-VRFLSLKHDSLARYYCHFGYY------IALRKDGM-----------------ETLSTIFDIKCNKGNWTKMPT--EGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTD------------KSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWSPPQMPTCEFI-MHDELPISWLYYRSDDKK*EDYVFYLHF 2030
            L GD   Y C  GY+L    +  C A       E +   +     C   P + Y+ + ++ ++  F  G  V   C  G+     S  I    G +W   P  ++C    CG+     NG      NY++ ++    C+ GF I+           +  C+A G+WS     C  + C E    ENG +      T  S   F+C  GY+  GS +  C    +W      +C   NCG PP I    +  E+   G++ ++ C     L+G+ S+ TC     KSG W  KP PKC+          A+  + EN      ++ +  +    +   C  G+ L    +  C  +G WN   P C    C + PP + +       +L   S  +Y C  G++      I  + DG                  E L+ I  ++      T + T   G +    T     +NG+   LG     R  +             S+   + + + Y C   +RL+GPK   CL  G+W     P+C  I   D  PI   +    D +    + Y  F
Sbjct: 2033 LFGDTAFYYCADGYSLADNSQLICNAQGNWVPPEGQAVPRCIAHFCEKPPSVSYS-ILESVSKAKFAAGSVVSFKCMEGFVL-NTSAKIECLRGGQWSPSPLSVQCIPVRCGEPPSITNGYPS-GTNYSFGAVVAYSCHKGFYIK--------GEKKSTCEATGQWSRPLPTCHPVSCNEPPKVENGFLEHTTGRTFESEARFQCNPGYKAVGSPVFVCQANRHWHSDAPLSCTPLNCGKPPPIQNGFLRGESFEVGSKVQFVCNEGYELVGDNSW-TC----QKSGKWSKKPSPKCV------PTKCAEPPLLENQ----LVLKELTSEVGVMTISCKEGHALQGPSVLKCLPSGQWNGSFPVCKLVLCQS-PPLIPFGVPASSGALHFGSTVKYLCVDGFFLRGNPIILCQVDGTWSSPLPECVPVECPQPEEILNGIIHVQGLAYLSTTLYTCKPGFELVGNTTTLCGENGQ--WLGGKPMCRPIECPEPKEILNGQFSSVSFQYGQTITYSCDRGFRLEGPKSLTCLETGNWD-MDAPSCNAIHCSDPQPIENGFVEGADYRYGAMIIYSCF 2578          

HSP 9 Score: 90.8929 bits (224), Expect = 2.314e-17
Identity = 114/471 (24.20%), Postives = 175/471 (37.15%), Query Frame = 3
Query:  240 HVKSLDNVKHLPNGCPSKACTANIDCWVEYDRA---QLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIG--ETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIA 1634
            +V S   VK L + CP +    N+  W ++      ++ V  S +    C  ++    P ++P +G         G +V   C  G+ + G   +YC    + S   P C  +   C     +P T  +   + +D   G  V   C +GY     S +    NG+     P   +   C    D     +  N N +Y       C                +C+     DGK   +   C A   PE   PENG  +G   +V +  TF C+EG+QL G     C   G WD    +C   +CG PP      V   A T+G++  Y+C    TL G  E++ L  G   + S       P C L          K    EN     +I+   +T+ +     C  GY L    L  C  +GSW+  P   +      PP +K +     +    ++  Y C  GY +A
Sbjct: 1577 YVLSPQQVKSLASSCPEELSRGNVLAWPDFVSGITGKVKVDSSSIFCSDCPSLEGSV-PHLRPASGDRKP-----GSKVSLFCDPGFQMVGNPVQYCLNQGQWSQPLPHC--ERIRCG----LPPTLENGFYSAEDLHAGSTVTYQCTSGYYLLGDSRMFCTDNGSWNGISPSCLDVDECAVGSDCSEHASCLNTNGSY------IC----------------SCKPPYTGDGKNCAEPVKCKA---PEN--PENGHSLGKIYSVGAEVTFSCEEGHQLVGVRKITCLESGEWDHLRPSCEAISCGAPPVPENGGVDGSAFTYGSKVRYRCDKGYTLAGDEESACLASGSWSHSS-------PVCEL---------VKCSQPENINNGKYILSG-LTYLSIASYSCEDGYSLQGPSLIECTASGSWDRAPPSCQLVSCGEPPMVKDALTTGSNFTFGNMVTYTCKEGYTLA 1991          

HSP 10 Score: 82.8037 bits (203), Expect = 8.324e-15
Identity = 98/423 (23.17%), Postives = 156/423 (36.88%), Query Frame = 3
Query:  465 VEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTA--ICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIG-ETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFI-PRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYI--ALRKDGMETLSTIFDIKCNKGNWTKMP 1712
            V Y+C+ GY ++G     C      S   P C   +  C   P +        ++  + K    VK+ C  GY     +          W  + I C  K+C    +    R   ++    + +++  C +GF          D   R  CQ DG W    +   C  ++C +   PE+G V+G   +  S   ++C  GY+L G+  R C     W G  + C    C  P E    K   E TT G    + C    TL G   +  T     +    L KP P C +   PF        I EN      +   E     +V  KC  G+ L  + +  C  + +W     RC + +C   P  ++ +  R +  ++  +  + C+ GY +  +LR   +E            G WT  P
Sbjct: 3079 VTYSCRPGYIIQGSSDLICTEKGIWSEPYPTCEPVS--CGPPPTVANAVATGEAHTYESK----VKLRCLEGYVVDTDTDTFTCQQDGRWFPERINCSPKTCPVPSNRTRIRVHGDDFQVNRQVSVS-CTEGFTY--------DGADRSTCQPDGTWEPPLSEESCIPVVCGQPESPEHGFVVGSEYSFGSTVVYQCDPGYELEGNRERVCQENRQWSGRVAVCRESRCEAPAEFPNGKAVLENTTSGPSLLFSCHRGYTLEGPPEAHCTANGTWSHLAPLCKPNP-CPV---PF-------VIPEN----ALLSEREFYVNQNVSIKCREGFLLKGNGIITCNPDETWTQTNARCEKISCGP-PTHVENAIARGVHYQYGDMVTFSCYSGYMLEGSLRSVCLE-----------NGTWTPPP 3459          

HSP 11 Score: 74.7146 bits (182), Expect = 2.342e-12
Identity = 68/244 (27.87%), Postives = 96/244 (39.34%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGY--EDPYKSHIIAKCNGNEWKYDPIKCEKKSCG-KLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNW 1109
            I + C  P  P +G    S    G  V Y C  GY L+G R+R CQ N + SG    C +    C +    P    +  +  ++  +G  +   C  GY  E P ++H  A  NG  W +    C+   C      P+N        Y  Q+++I+ C +GF ++         N    C  D  W+   A C  I C   +  EN    GV      + TF C  GY L GS    C   G W
Sbjct: 3230 IPVVCGQPESPEHGFVVGSEYSFGSTVVYQCDPGYELEGNRERVCQENRQWSGRVAVCRESR--CEAPAEFP----NGKAVLENTTSGPSLLFSCHRGYTLEGPPEAHCTA--NGT-WSHLAPLCKPNPCPVPFVIPENALLSEREFYVNQNVSIK-CREGFLLK--------GNGIITCNPDETWTQTNARCEKISCGPPTHVENAIARGVHYQYGDMVTFSCYSGYMLEGSLRSVCLENGTW 3455          

HSP 12 Score: 58.5362 bits (140), Expect = 2.164e-7
Identity = 57/216 (26.39%), Postives = 95/216 (43.98%), Query Frame = 3
Query:  321 VEYDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNE-WKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAI 965
            +E +R ++C  +    G V +  + +C+ P +  NG A       G  + ++C  GY L+GP + +C AN   S   P C  + + C     IP   +   S R+ + N ++V I C+ G+    K + I  CN +E W     +CEK SCG     +N       +Y Y  +    C  G+ ++         + R  C  +G W+    IC A+
Sbjct: 3266 LEGNRERVCQENRQWSGRVAVCRESRCEAPAEFPNGKAVLENTTSGPSLLFSCHRGYTLEGPPEAHCTANGTWSHLAPLC--KPNPCPVPFVIPENALL--SEREFYVN-QNVSIKCREGFL--LKGNGIITCNPDETWTQTNARCEKISCGPPTHVENA-IARGVHYQYGDMVTFSCYSGYMLE--------GSLRSVCLENGTWT-PPPICRAV 3464          
BLAST of C4b binding protein beta chain vs. UniProt/SwissProt
Match: sp|A2AVA0|SVEP1_MOUSE (Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Svep1 PE=1 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 4.872e-30
Identity = 136/516 (26.36%), Postives = 202/516 (39.15%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLP---KPEPKCLLH-CKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFIP---RCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHW 1913
            ++C+ P  P NGH++  I  VG  V ++C  G+ L G     C          P C     +    P +P     D S    F  G  V   C  GY            +G+ W +    CE   C + ED  NG+ +  +  TY SIA   C +G+ +Q  +          +C A G W      C  + C E    ++  + G   T  +   + CKEGY L G     C   G W+ SN  C+  +C  PP +  A         G  A Y C    +L  + S L C    N   W+P   +  P+C+ H C+  +  S    I E+     F        G+ V  KC  G+ LN+     C   G W+  P   +C+   C   PPS+        +    ++  Y CH G+YI   K      +         G W+K PT  C P  C +PP  +NG  +L   + RT  ++           +++C+P Y+  G  + VC  N HW
Sbjct: 1786 VKCKAPENPENGHSSGEIYTVGTAVTFSCDEGHELVGVSTITCLETGEWDRLRPSC---EAISCGVPPVPENGGVDGSA---FTYGSKVVYRCDKGYTLSGDEESACLASGS-WSHSSPVCELVKCSQPEDINNGKYIL-SGLTYLSIASYSCENGYSLQGPS--------LLECTASGSWDRAPPSCQLVSCGEPPIVKDAVITGSNFTFGNTVAYTCKEGYTLAGPDTIVCQANGKWNSSNHQCLAVSCDEPPNVDHASPETAHRLFGDTAFYYCADGYSL-ADNSQLICNAQGN---WVPPAGQAVPRCIAHFCE--KPPSVSYSILESVSKAKFAA------GSVVSFKCMEGFVLNTSAKIECLRGGEWSPSPLSVQCIPVRC-GEPPSIANGYPSGTNYSFGAVVAYSCHKGFYIKGEKKSTCEAT---------GQWSK-PTPTCHPVSCNEPPKVENG--FLEHTTGRTFESE----------ARFQCNPGYKAAGSPVFVCQANRHW 2250          

HSP 2 Score: 126.716 bits (317), Expect = 1.763e-28
Identity = 154/573 (26.88%), Postives = 229/573 (39.97%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTD-------------LCFSAPYI-----PYTQVHDN-----------------SNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCL-LHC-KPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSW-----NFIPRCVEAACSARPPSMKYSTVRFLS---LKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGN-WTKMP-TEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCEFIMHDELP 1964
            ++C  P    NG  +      G  V Y C SGY L G  + +C  N   +G  P C D  +             L  +  Y+     PYT    N                 S+ + +  G  V   C  G+E    S I     G EW      CE  SCG    P+NG  +  + +TY S  +  C+ G+ +  + D+         C A G WS  + +C  + C +     NG+ +    T  SI ++ C+ GY L G  L +CT  G+WD +  +C + +CG PP +  A +     T G    Y CK   TL G  +      V   +G       +CL + C +P  VD      H + +T + +  D   +       C  GY L  +    C   G+W       +PRC+   C  +PPS+ YS +  +S       S+  + C  G+           L+T   I+C +G  W+  P +  C P +C +PP+  NG  Y  G       T+ S       VV Y CH  + +KG K + C   G WS P  PTC  +  +E P
Sbjct: 1687 IRCGLPPALENGFYSAEDFHAGSTVTYQCTSGYYLLGDSRMFCTDNGSWNGISPSCLDVDECAVGSDCSEHASCLNTNGSYVCSCNPPYTGDGKNCAEPVKCKAPENPENGHSSGEIYTVGTAVTFSCDEGHELVGVSTITCLETG-EWDRLRPSCEAISCGVPPVPENG-GVDGSAFTYGSKVVYRCDKGYTL--SGDE------ESACLASGSWSHSSPVCELVKCSQPEDINNGKYILSGLTYLSIASYSCENGYSLQGPSLLECTASGSWDRAPPSCQLVSCGEPPIVKDAVITGSNFTFGNTVAYTCKEGYTLAGPDTI-----VCQANGKWNSSNHQCLAVSCDEPPNVD------HASPETAHRLFGDTAFY------YCADGYSLADNSQLICNAQGNWVPPAGQAVPRCIAHFCE-KPPSVSYSILESVSKAKFAAGSVVSFKCMEGF----------VLNTSAKIECLRGGEWSPSPLSVQCIPVRCGEPPSIANG--YPSG-------TNYSF----GAVVAYSCHKGFYIKGEKKSTCEATGQWSKP-TPTCHPVSCNEPP 2207          

HSP 3 Score: 118.242 bits (295), Expect = 8.015e-26
Identity = 115/434 (26.50%), Postives = 170/434 (39.17%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPE--NGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFD 1676
            I ++C  PV P NG  + +   +G   +Y+CK G+ L+G   R C  N + SG+ P C  +   C      P    + +   DD+     +   C +GY           C  N +W      C    CG    P NGR +    YT+Q      C +GF ++            R C  +G WSG T  C  + CP  +PP+  NG   G+         F C EGY L G+    C   G WD     C    CGPP ++        +  HG   +Y+C +   L G  S   C    + SG  P         C P +  +  +     N T       ++  G  V+ +C  G++L       C  NG W+ +P C  A C    P++  + V   SL  D++  Y C  GY +    D + T   I+ 
Sbjct: 2710 ISIECDLPVAPENGFLHFTQTTMGSAAQYSCKPGHILEGSHLRLCLQNKQWSGTVPRC--EAISCSK----PNPLWNGSIKGDDYSYLGVLYYECDSGYI--LNGSKKRTCQENRDWDGHEPMCIPVDCGSPPVPTNGR-VKGEEYTFQKEITYSCREGFILEGARS--------RICLTNGSWSGATPSCMPVRCP--APPQVPNGVADGLDYGFKKEVAFHCLEGYVLQGAPRLTCQSNGTWDAEVPVCKPATCGPPADLPQGFPNGFSFYHGGHIQYQCFTGYKLHGNPS-RRCLPNGSWSGSSPS--------CLPCRCSTPIIQQGTINAT-------DLGCGKTVQIECFKGFKLLGLSEITCDANGQWSDVPLCEHAQCGPL-PTIPNAIVLEGSLSEDNVVTYSCRPGYTMQGSSDLICTEKAIWS 3107          

HSP 4 Score: 111.694 bits (278), Expect = 8.125e-24
Identity = 127/511 (24.85%), Postives = 197/511 (38.55%), Query Frame = 3
Query:  429 HANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTD-QTDLCFSAP--YIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWN-FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNK-GNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLN-GHWSPPQMPTCE 1940
            HA+H   L G  V Y+C+ GY L G     CQ +   +G+ P C   + DL  +    ++ +TQ            G   +  C+ G+     SH+       +W     +CE  SC K     NG ++  ++Y+Y  +    C+ G+ +        + + +R CQ +  W G   +C  + C     P NG V G   T     T+ C+EG+ L G+  R C   G+W G+  +C+   C  PP++              +  + C     L G    LTC         +P         CKP             +    F       HG H++ +C  GY+L+ +    C  NGSW+   P C+   CS   P ++  T+    L      +  C  G+           L  + +I C+  G W+ +P   C+  +C   PT  N  I L G                + VV Y C P Y ++G    +C     WS P  PTCE
Sbjct: 2668 HASH--FLYGTMVSYSCEPGYELLGIPVLICQEDGTWNGTAPSCISIECDLPVAPENGFLHFTQT---------TMGSAAQYSCKPGHIL-EGSHLRLCLQNKQWSGTVPRCEAISCSKPNPLWNG-SIKGDDYSYLGVLYYECDSGYIL--------NGSKKRTCQENRDWDGHEPMCIPVDCGSPPVPTNGRVKGEEYTFQKEITYSCREGFILEGARSRICLTNGSWSGATPSCMPVRCPAPPQVPNGVADGLDYGFKKEVAFHCLEGYVLQGAPR-LTCQSNGTWDAEVPV--------CKPATCGPPA------DLPQGFPNGFSFYHGGHIQYQCFTGYKLHGNPSRRCLPNGSWSGSSPSCLPCRCST--PIIQQGTINATDLGCGKTVQIECFKGF----------KLLGLSEITCDANGQWSDVPL--CEHAQCGPLPTIPNA-IVLEGSLSE------------DNVVTYSCRPGYTMQGSSDLICTEKAIWSQP-YPTCE 3114          

HSP 5 Score: 106.686 bits (265), Expect = 2.892e-22
Identity = 126/523 (24.09%), Postives = 204/523 (39.01%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYD-PIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGD-TAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTH-GAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDE-VTHGTHVRAKCNFGYELNSDILPAC-YNGSW-NFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTC 1937
            I ++C  P    NG+ + +    G  V Y+C  G+ +KG +K  C+A  + S   P C   +  C   P +    +   + R  F++  + +  C  GY+       + + N   W  D P+ C   +CGK    +NG  +   ++   S     CN+G+++          +    CQ  GKWS   +  C    C E    EN  V+    +   + T  CKEG+ L G  + KC   G W+GS   C +  C  PP I F   A     H G+  +Y C     L G  + L        S W   P P+C+            V   +  +  N I+H + + + +     C  G+EL  +    C  NG W    P C    C   P  +       +S ++     Y+C  G+    R +G ++L+ +       G+W   P   C    C+ P   +NG  ++ G   R           +  ++ Y C P +++ G  +  C    WS    PTC
Sbjct: 2141 IPVRCGEPPSIANGYPSGTNYSFGAVVAYSCHKGFYIKGEKKSTCEATGQWSKPTPTCHPVS--CNEPPKVENGFLEHTTGRT-FES--EARFQCNPGYKAAGSPVFVCQAN-RHWHSDAPLSCTPLNCGKPPPIQNG-FLKGESFEVGSKVQFVCNEGYELV--------GDNSWTCQKSGKWSKKPSPKCVPTKCAEPPLLENQLVLKELASEVGVMTISCKEGHALQGPSVLKCLPSGQWNGSFPICKMVLCPSPPLIPFGVPASSGALHFGSTVKYLCVDGFFLRGSPTIL----CQADSTW-SSPLPECV-----------PVECPQPEEILNGIIHVQGLAYLSTTLYTCKPGFELVGNATTLCGENGQWLGGKPMCKPIEC-PEPKEILNGQFSSVSFQYGQTITYFCDRGF----RLEGPKSLTCL-----ETGDWDMDPPS-CDAIHCSDPQPIENG--FVEGADYR-----------YGAMIIYSCFPGFQVLGHAMQTCEESGWS-SSSPTC 2607          

HSP 6 Score: 96.6709 bits (239), Expect = 4.288e-19
Identity = 107/422 (25.36%), Postives = 160/422 (37.91%), Query Frame = 3
Query:  474 TCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCL-LHCK-PFQVD--------------------------------SAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWN-FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYI 1631
            +CK G+AL+GP    C  + + +GS P C  +  LC S P IP+  V  +S    F  G  VK +C +G+       I+ + + + W     +C    C + E+  NG  ++     Y S  +  C  GF++          N    C  +G+W G   +C  I CPE     NG+   V        T+ C  G++L G     C   G+WD    +C   +C  P  I    V      +GA   Y C     ++G  +  TC E    SGW     P C+ + C  P  +D                                 A     EN K +         +GT V   C  GYEL    +  C  +G+WN   P C+   C   P + +   + F      S A+Y C  G+ +
Sbjct: 2347 SCKEGHALQGPSVLKCLPSGQWNGSFPIC--KMVLCPSPPLIPF-GVPASSGALHF--GSTVKYLCVDGFFLRGSPTILCQAD-STWSSPLPECVPVECPQPEEILNG-IIHVQGLAYLSTTLYTCKPGFELV--------GNATTLCGENGQWLGGKPMCKPIECPEPKEILNGQFSSVSFQYGQTITYFCDRGFRLEGPKSLTCLETGDWDMDPPSCDAIHCSDPQPIENGFVEGADYRYGAMIIYSCFPGFQVLGH-AMQTCEE----SGW-SSSSPTCVPIDCGLPPHIDFGDCTKVRDGQGHFDQEDDMMEVPYLAHPQHLEATAKALENTKESPASHASHFLYGTMVSYSCEPGYELLGIPVLICQEDGTWNGTAPSCISIECDL-PVAPENGFLHFTQTTMGSAAQYSCKPGHIL 2746          

HSP 7 Score: 91.6633 bits (226), Expect = 1.534e-17
Identity = 85/359 (23.68%), Postives = 135/359 (37.60%), Query Frame = 3
Query:  381 MEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYT-YQSIAIQF-CNDGFK-------------------------------IQCTTDQFEDKNCRRQ------------------CQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPK 1304
            M I + C  P  P NG           ++ Y+C+ G+ L+G R R C  N   SG+ P C      C + P +P    +  ++  D+   ++V   C  GY       +  + NG  W  +   C+  +CG   D   G   + N ++ Y    IQ+ C  G+K                               IQ  T    D  C +                   C A+G+WS D  +C    C  L    N  V+    + +++ T+ C+ GY + GS    CT +  W     TC   +CGPPP +  A    EA T+ ++ + +C     +  +T   TC        W+P+
Sbjct: 2824 MCIPVDCGSPPVPTNGRVKGEEYTFQKEITYSCREGFILEGARSRICLTNGSWSGATPSCMPVR--CPAPPQVP----NGVADGLDYGFKKEVAFHCLEGYVLQGAPRLTCQSNGT-WDAEVPVCKPATCGPPADLPQG---FPNGFSFYHGGHIQYQCFTGYKLHGNPSRRCLPNGSWSGSSPSCLPCRCSTPIIQQGTINATDLGCGKTVQIECFKGFKLLGLSEITCDANGQWS-DVPLCEHAQCGPLPTIPNAIVLEGSLSEDNVVTYSCRPGYTMQGSSDLICTEKAIWSQPYPTCEPLSCGPPPTVANAVATGEAHTYESKVKLRCLEGYVMDSDTDTFTC---QQDGHWVPE 3168          

HSP 8 Score: 87.0409 bits (214), Expect = 3.433e-16
Identity = 132/563 (23.45%), Postives = 207/563 (36.77%), Query Frame = 3
Query:  324 EYDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKII----CQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNW----DGSNSTCIVRNCGPPPEI---VFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF-IPRCVEAACSARPPSMKYSTVRFLSLK-HDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWSPPQMPTCEFIMHDELPI 1967
            E+DR +   C++  CG+          PPV P NG  + S    G +V Y C  GY L G  +  C A+   S S P C            +  +Q  D +N     +G     I    C+NGY     S +    +G+ W   P  C+  SCG+    K+   +  +N+T+ +     C +G+ +               CQA+GKW+     C A+ C E    ++               + C +GY L  +    C  +GNW      +   CI   C  PP +   +   V+      G+   +KC     L          E      W P P     + C P +        +     TN+      + G  V   C+ G+ +  +    C   G W+   P C   +C+  PP ++   +   + +  +S AR+ C+ GY  A         S +F  + N+ +W       C P  C KPP  +NG  +L G+S                 V++ C+  Y L G     C  +G WS    P C      E P+
Sbjct: 1833 EWDRLRP-SCEAISCGV----------PPV-PENGGVDGSAFTYGSKVVYRCDKGYTLSGDEESACLASGSWSHSSPVCE----------LVKCSQPEDINNGKYILSGLTYLSIASYSCENGYSLQGPSLLECTASGS-WDRAPPSCQLVSCGEPPIVKDA-VITGSNFTFGNTVAYTCKEGYTLAGPDTIV--------CQANGKWNSSNHQCLAVSCDEPPNVDHASPETAHRLFGDTAFYYCADGYSLADNSQLICNAQGNWVPPAGQAVPRCIAHFCEKPPSVSYSILESVSKAKFAAGSVVSFKCMEGFVLNTSAKI----ECLRGGEWSPSP---LSVQCIPVRCGEPPSIANGYPSGTNY------SFGAVVAYSCHKGFYIKGEKKSTCEATGQWSKPTPTCHPVSCN-EPPKVENGFLEHTTGRTFESEARFQCNPGYKAA--------GSPVFVCQANR-HWHSDAPLSCTPLNCGKPPPIQNG--FLKGESFEV-----------GSKVQFVCNEGYELVGDNSWTCQKSGKWSKKPSPKCVPTKCAEPPL 2327          

HSP 9 Score: 85.8853 bits (211), Expect = 8.427e-16
Identity = 108/472 (22.88%), Postives = 171/472 (36.23%), Query Frame = 3
Query:  240 HVKSLDNVKHLPNGCPSKACTANIDCWVEY---DRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICT-AILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIG--ETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIA 1634
            +V S   VK L + CP +    N+  W ++      ++ V  S +    C  ++    P ++P +G+        G +V   C  G+ + G   +YC    + +   P C  +   C     +P    +   + +DF  G  V   C +GY     S +    NG+     P   +   C    D     +  N N +Y                             C  +  ++GD   C   + C     PENG   G   TV +  TF C EG++L G     C   G WD    +C   +CG PP      V   A T+G++  Y+C    TL G  E++ L  G   + S       P C L          K    E+     +I+   +T+ +     C  GY L    L  C  +GSW+  P   +      PP +K + +   +    +   Y C  GY +A
Sbjct: 1581 YVLSPQQVKLLASSCPEELSRGNVLAWPDFLSGITGKVKVDSSSMFCSDCPSLEGSV-PHLRPASGNRKP-----GSKVSLFCDPGFQMVGNPVQYCLNQGQWTQPLPHC--ERIRCG----LPPALENGFYSAEDFHAGSTVTYQCTSGYYLLGDSRMFCTDNGSWNGISPSCLDVDECAVGSDCSEHASCLNTNGSY----------------------------VCSCNPPYTGDGKNCAEPVKCKAPENPENGHSSGEIYTVGTAVTFSCDEGHELVGVSTITCLETGEWDRLRPSCEAISCGVPPVPENGGVDGSAFTYGSKVVYRCDKGYTLSGDEESACLASGSWSHSS-------PVCEL---------VKCSQPEDINNGKYILSG-LTYLSIASYSCENGYSLQGPSLLECTASGSWDRAPPSCQLVSCGEPPIVKDAVITGSNFTFGNTVAYTCKEGYTLA 1995          

HSP 10 Score: 80.1073 bits (196), Expect = 5.220e-14
Identity = 104/448 (23.21%), Postives = 161/448 (35.94%), Query Frame = 3
Query:  396 QCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTA--ICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGE-TSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFI-PRCVEAACSARPPS-MKYSTVRFLSLKHDSLARYYCHFGYYI--ALRKDGMETLSTIFDIKCNKGNWTKMPT 1715
            QC P     N       L   + V Y+C+ GY ++G     C      S   P C   +  C   P +        ++  + K    VK+ C  GY     +          W  + I C  K C    +    R   ++    + +++  C +GF         E  N    CQ DG W    +   C  ++C     P +G V+G  ++  S   ++C  GY+L G+  R C     W G  + C    C  P E    K   E TT G    + C    TL G   +  T     N    L KP P C +   PF +    V           +   E     +V  KC  G+ L  + +  C  + +W     RC + +C   PPS ++ +  R +  ++  +  Y C+ GY +  +LR   +E            G WT  P 
Sbjct: 3059 QCGPLPTIPNAIVLEGSLSEDNVVTYSCRPGYTMQGSSDLICTEKAIWSQPYPTCEPLS--CGPPPTVANAVATGEAHTYESK----VKLRCLEGYVMDSDTDTFTCQQDGHWVPERITCSPKKCPVPSNMTRIRFHGDDFQVNRQVSVS-CAEGFT-------HEGVN-WSTCQPDGTWEPPFSDESCIPVVCGHPESPAHGSVVGNKHSFGSTIVYQCDPGYKLEGNRERICQENRQWSGEVAVCRENRCETPAEFPNGKAVLENTTSGPSLLFSCHRGYTLEGSPEAHCTANGTWNHLTPLCKPNP-CPV---PFVIPENAV-----------LSEKEFYVDQNVSIKCREGFLLKGNGVITCSPDETWTHTNARCEKISCG--PPSHVENAIARGVYYQYGDMITYSCYSGYMLEGSLRSVCLE-----------NGTWTPSPV 3463          

HSP 11 Score: 72.7886 bits (177), Expect = 9.886e-12
Identity = 91/388 (23.45%), Postives = 145/388 (37.37%), Query Frame = 3
Query:  441 SILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEW----KYDPIKCEKKSCGKLEDPKNG--RTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGD--TAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAY-EATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNF--IPRCVEAACSARPPSMKYSTV 1568
            S    G+ V YTCK GY L GP    CQAN + + S  +C   +  C   P +     H +        G+     C +GY     S +I    GN W         +C    C K          ++    +   S+    C +GF +        + + + +C   G+WS    +  C  + C E     NG   G   +  ++  + C +G+ + G     C   G W     TC   +C  PP++    + +    T  ++A ++C       G   F+      N+      P     L C P  ++  K    +N     F+  +    G+ V+  CN GYEL  D    C  +G W+    P+CV   C A PP ++   V
Sbjct: 1976 SNFTFGNTVAYTCKEGYTLAGPDTIVCQANGKWNSSNHQCLAVS--CDEPPNVD----HASPETAHRLFGDTAFYYCADGYSLADNSQLICNAQGN-WVPPAGQAVPRCIAHFCEKPPSVSYSILESVSKAKFAAGSVVSFKCMEGFVL--------NTSAKIECLRGGEWSPSPLSVQCIPVRCGEPPSIANGYPSGTNYSFGAVVAYSCHKGFYIKGEKKSTCEATGQWSKPTPTCHPVSCNEPPKVENGFLEHTTGRTFESEARFQCNPGYKAAGSPVFVC---QANRHWHSDAP-----LSCTP--LNCGKPPPIQN----GFLKGESFEVGSKVQFVCNEGYELVGDNSWTCQKSGKWSKKPSPKCVPTKC-AEPPLLENQLV 2333          

HSP 12 Score: 70.8626 bits (172), Expect = 3.285e-11
Identity = 66/247 (26.72%), Postives = 98/247 (39.68%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGY--EDPYKSHIIAKCNGNEWKYDPIKCEKKSCG-KLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGS 1118
            I + C  P  P +G    +    G  + Y C  GY L+G R+R CQ N + SG    C +  + C +    P    +  +  ++  +G  +   C  GY  E   ++H  A  NG  W +    C+   C      P+N        Y  Q+++I+ C +GF ++         N    C  D  W+   A C  I C   S  EN    GV+     + T+ C  GY L GS    C   G W  S
Sbjct: 3233 IPVVCGHPESPAHGSVVGNKHSFGSTIVYQCDPGYKLEGNRERICQENRQWSGEVAVCRE--NRCETPAEFP----NGKAVLENTTSGPSLLFSCHRGYTLEGSPEAHCTA--NGT-WNHLTPLCKPNPCPVPFVIPENAVLSEKEFYVDQNVSIK-CREGFLLK--------GNGVITCSPDETWTHTNARCEKISCGPPSHVENAIARGVYYQYGDMITYSCYSGYMLEGSLRSVCLENGTWTPS 3461          

HSP 13 Score: 60.4622 bits (145), Expect = 5.654e-8
Identity = 55/232 (23.71%), Postives = 88/232 (37.93%), Query Frame = 3
Query:  462 QVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQF-CNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVM--GVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCG 1148
            Q E  C+ GY  KG  +  C A    +            C   P + +T    +++ +D         +C+ GY+   ++                 CE   C  L+ P+NG  + N    + + A    C  GF +  ++           CQ +G WSG  + C    CP L  P++G +       + N++    C EGY+L GS    C     WDG    C+ R+C 
Sbjct:  303 QFECICEKGYYGKG-LQHECTACPSGTYKPEASPGGISTCIPCPDVSHTSPPGSTSPED--------CVCREGYQRSGQT-----------------CEVVHCPALKPPENGFFIQNTCKNHFNAACGVRCRPGFDLVGSSIHL--------CQPNGLWSGTESFCRVRTCPHLRQPKHGHISCSTAEMSYNTLCLVTCNEGYRLEGSTRLTCQGNAQWDGPEPRCVERHCA 500          

HSP 14 Score: 53.9138 bits (128), Expect = 5.544e-6
Identity = 53/218 (24.31%), Postives = 96/218 (44.04%), Query Frame = 3
Query:  321 VEYDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNE-WKYDPIKCEKKSCGKLEDPKN--GRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAI 965
            +E +R ++C  +    G V +  + +C+ P +  NG A       G  + ++C  GY L+G  + +C AN   +   P C  + + C     IP   V    +  +F   ++V I C+ G+    K + +  C+ +E W +   +CEK SCG     +N   R +Y   Y Y  +    C  G+ ++         + R  C  +G W+  + +C A+
Sbjct: 3269 LEGNRERICQENRQWSGEVAVCRENRCETPAEFPNGKAVLENTTSGPSLLFSCHRGYTLEGSPEAHCTANGTWNHLTPLC--KPNPCPVPFVIPENAVL---SEKEFYVDQNVSIKCREGFL--LKGNGVITCSPDETWTHTNARCEKISCGPPSHVENAIARGVY---YQYGDMITYSCYSGYMLE--------GSLRSVCLENGTWT-PSPVCRAV 3467          
BLAST of C4b binding protein beta chain vs. UniProt/SwissProt
Match: sp|Q96PZ7|CSMD1_HUMAN (CUB and sushi domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CSMD1 PE=1 SV=3)

HSP 1 Score: 120.168 bits (300), Expect = 1.761e-26
Identity = 114/472 (24.15%), Postives = 180/472 (38.14%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECT-DQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFK------------------------------------IQCTTDQFEDKNCRRQCQA----------------DGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFI-PRCVEAACSARPPSMKYSTVRFLSLKHDSLARYY-CHFGYYIA 1634
            + + C  P  P N      +   G  V Y+C+   +L G   R CQ +   SG+ P CT +    C      P T  H +   DDFK    ++  C+ G++           NG+     P+ CE  SCG    P NG  + ++   + S  I  C +G+K                                    IQ  TD   +K    QC                  DG+W+    +C A+LCP+  P +NG V G      S  ++ C +GYQL  S +  C   G W G    C+   CG P      +++ ++ T+ ++  ++CKS   L+G +       V    G     +P C+        D    +    N +  +    EV  G+ V  +C  GY +       C  N +W+ I   C+  AC  +P +  ++ VR + L        Y CH G+++A
Sbjct: 2855 LAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGD----PGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPV-CEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTIISCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMDGYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSR-----RVCQADGTWSGIQPTCIDPAHNTCPDPGTPHFGIQNSSRGY----EV--GSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACR-QPETPAHADVRAIDLPTFGYTLVYTCHPGFFLA 3309          

HSP 2 Score: 107.457 bits (267), Expect = 1.960e-22
Identity = 134/532 (25.19%), Postives = 204/532 (38.35%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIK-----TFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHC---KPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFI-PRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL---NGHWSPPQMPTCEFIM 1949
            + C     P NG+   ++ + G    +TC +GY L G   R C AN   SGSE  C      C S    P   V+ + + D F   + V   C  G+     S  I     ++W      C   +CG   +P +G T   + +    +    CN G+ +Q  +        R QC+++G+WS     C  + C +    EN    G  N   S +      + CK+G+ L GS    C   G WD S   C+  +CG P     A +  E  T+GA   Y C+   +LIG  + + C E  + SG LP        HC    P          H +       + D+    + +R  C  G++L       C  NGSW+ + P C   +C           V    +   S   Y C  GY    +  G+ T     +     G WT    + C    C  P T  NG  +    +D T           N+ V Y+C+P Y ++    A      +G W+P + P C+ ++
Sbjct: 2620 ISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRCL--AGHCGS----PDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRIC-LQDHKWSGQTPVCVPITCGHPGNPAHGFTN-GSEFNLNDVVNFTCNTGYLLQGVS--------RAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRV-CQEDSHWSGALP--------HCTGNNPGFCGDPGTPAHGSR------LGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGY----KTSGLMTRHCTAN-----GTWTGTAPD-CTIISCGDPGTLANGIQF---GTDFT----------FNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSK-PVCKAVL 3096          

HSP 3 Score: 99.3673 bits (246), Expect = 5.992e-20
Identity = 105/447 (23.49%), Postives = 160/447 (35.79%), Query Frame = 3
Query:  336 AQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNR-DDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTA---ILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQV------DSAKVYIHENNKTTNFI-MHDEVTHGTHVRAKCNFGY---ELNSDILPACYNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIA 1634
             ++C+ D    G   + + + C  P  P +G  N S   + D V +TC +GY L+G  +  C++N + S   P C  +   C    ++     H   N  + F+ G  +   C+ G+     S +    NG  W     KC   SCG    P N   +    +TY ++            C   +    N  R CQ D  WSG    CT      C +   P +G  +G      S+  F C+ G+QL GS  R C   G+W G    C   +CG P       +                S   L   +    C E    SG + +       HC           D   +   +     N I    + T    V  +CN GY    + S  +    +G WN      +A    +PP ++  TV     +  S   Y C  GY ++
Sbjct: 2717 VRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTC--RVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANG-LWDRSLPKCLAISCGHPGVPANA-VLTGELFTYGAVV--------HYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIV--------------SSDGILFSSSVIYACWEGYKTSGLMTR-------HCTANGTWTGTAPDCTIISCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMDGYQLS 3130          

HSP 4 Score: 98.5969 bits (244), Expect = 9.132e-20
Identity = 108/424 (25.47%), Postives = 161/424 (37.97%), Query Frame = 3
Query:  423 NGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQAN-LRLSGSEPECTDQTDLCFSAP-YIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNE-W--KYDPIKCEKKSCGKLEDPKNGRTMYN------NNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWS-GDT-AICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF-IPRCVEAACSARPPSMKYSTVRF------LSLKHDSLARYYCHFGYYI 1631
             G  N +   VG +V Y CK GY + G     C+ N L +     +    T LC +    IP +  + +   ++F     V   C  G++        A C  +  W  K  P  C+  +C  +E   +   ++       N Y  Q +          + C+   + +     +CQA+G W+ GD    C  I C  LS P NG  +G      +   F C  GY L GSH+R+C   G W GS + C+  +CG P  IV   ++ +  ++     Y+C     L+G TS   C +    SG  P         C P          H  N    F    E      V   CN GY L       C  NG W+  +P C    CS   P    + +R        S ++     Y+C  G+Y+
Sbjct: 2441 GGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMY----QWDSLTPLCQAVSCGIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL----------LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRCLAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVG-TSVRICLQDHKWSGQTPV--------CVPITCG------HPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSD--PGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYL 2833          

HSP 5 Score: 62.3882 bits (150), Expect = 1.502e-8
Identity = 46/187 (24.60%), Postives = 76/187 (40.64%), Query Frame = 3
Query:  399 CQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAIC 956
            C  P  P  G  +        +V + CKS + L G  +R CQA+   SG +P C D        P  P+  + ++S    ++ G  V   C+ GY    +      C  N  W     +C   +C + E P +      +  T+    +  C+ GF +   ++        R C+AD KW+G + +C
Sbjct: 3155 CGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNTCPDPGTPHFGIQNSSR--GYEVGSTVFFRCRKGYH--IQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAGGSEH-------RTCKADMKWTGKSPVC 3330          

HSP 6 Score: 58.5362 bits (140), Expect = 2.458e-7
Identity = 125/543 (23.02%), Postives = 185/543 (34.07%), Query Frame = 3
Query:  396 QCQPP--VQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQ--ANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGY----------------EDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMG-VWNTVNSIKTFKCKEGYQLHGSHLRKCTREG----NWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF---IPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTC 1937
            +CQPP  V             +GD V+Y C  GY L G     C+  + L+  GS P C  Q          P  +V   S+           +I   GY                E  Y   I      +E ++D ++    S G  + P     + + N+T QS      N    ++ +TD    K   +   A            A  C    P +NG ++      V S   + CK GY++ G     C R       WD     C   +CG P             T  ++  Y+C     L  E+S            W  K +P     CKP    S +  + E+      +      +G  V   C+ GY L    L  C  NG+WN     P C   +C +       + +  L++ + + A + C+ GY + +     E L+         G W+   T  C    C  P    NG I   G S R               V Y+C+P +RL G  + +CL  H    Q P C
Sbjct: 2257 KCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTCEAQ---------CPANEVRTGSS----------GVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSG--QSPL--LVVLSGNHTEQSNFTSRSNQ-LYLRWSTDHATSKKGFKIRYA------------APYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSCGIPESPGNGSFTGNEFTLDSKVVYECHEGFKL--ESSQQATAVCQEDGLWSNKGKPPT---CKPVACPSIEAQLSEH-VIWRLVSGSLNEYGAQVLLSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTV-YGATAIFTCNTGYTL-VGSHVRECLA--------NGLWSGSETR-CLAGHCGSPDPIVNGHISGDGFSYR-------------DTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVC 2733          
BLAST of C4b binding protein beta chain vs. UniProt/SwissProt
Match: sp|Q4LDE5|SVEP1_HUMAN (Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SVEP1 PE=1 SV=3)

HSP 1 Score: 116.316 bits (290), Expect = 3.223e-25
Identity = 146/576 (25.35%), Postives = 217/576 (37.67%), Query Frame = 3
Query:  378 CMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTD-------------LCFSAPYI-----PYTQVHDN-----------------SNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSW-----NFIPRCVEAACSARPPSMKYSTVRFLS---LKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGN-WTKMPTE-GCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCEFIMHDELP 1964
            C  I     PP++  NG  +      G  V Y C +GY L G  + +C  N   +G  P C D  +             L     YI     PYT    N                 S+ + +  G +V   CQ GY+    + I    +G EW +    C+  SCGK   P+NG  +    +T+ S     CN G+ +        DK     C A+  WS    +C  + C       NG+ +    T  S  ++ C  GY L G  + +CT  G WD +   C +  CG PP I  A +     T      Y CK   TL G  +     +     G   + + +CL        D   +  H + +T + +  D   +       C+ GY L  +    C   G W       +PRC+   C  +PPS+ YS +  +S       S+  + C  G+           L+T   I+C +G  W   P    C P +C +PP+  NG  Y  G +                +V Y C+  + +KG K + C   G WS P +PTC  +   E P
Sbjct: 1685 CERISCGVPPPLE--NGFHSADDFYAGSTVTYQCNNGYYLLGDSRMFCTDNGSWNGVSPSCLDVDECAVGSDCSEHASCLNVDGSYICSCVPPYTGDGKNCAEPIKCKAPGNPENGHSSGEIYTVGAEVTFSCQEGYQLMGVTKITCLESG-EWNHLIPYCKAVSCGKPAIPENG-CIEELAFTFGSKVTYRCNKGYTLA------GDK--ESSCLANSSWSHSPPVCEPVKCSSPENINNGKYILSGLTYLSTASYSCDTGYSLQGPSIIECTASGIWDRAPPACHLVFCGEPPAIKDAVITGNNFTFRNTVTYTCKEGYTLAGLDTIECLAD-----GKWSRSDQQCLA----VSCDEPPIVDHASPETAHRLFGDIAFY------YCSDGYSLADNSQLLCNAQGKWVPPEGQDMPRCIAHFCE-KPPSVSYSILESVSKAKFAAGSVVSFKCMEGF----------VLNTSAKIECMRGGQWNPSPMSIQCIPVRCGEPPSIMNG--YASGSNYS-----------FGAMVAYSCNKGFYIKGEKKSTCEATGQWSSP-IPTCHPVSCGEPP 2208          

HSP 2 Score: 115.161 bits (287), Expect = 8.022e-25
Identity = 125/523 (23.90%), Postives = 204/523 (39.01%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDT-AICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFA-KVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCL-LHC-KPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSW-NFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTC 1937
            I ++C  P   +NG+A+ S    G  V Y+C  G+ +KG +K  C+A  + S   P C   +  C   P +    +   + R  F++  +V+  C  GY+       + + N +     P+ C    CGK    +NG  M   N+   S    FCN+G+++          +    CQ  GKW+  +   C    CPE    EN  V+    T   + TF CKEG+ L G  + KC     W+ S   C +  C PPP I F   +   A   G+  +Y C     L G ++ L         G    P P+C+ + C +P ++ +  + +              + + +     C  G+EL  +    C  NG W    P C    C  +P  +      +  L +     Y C+ G+    R +G   L+ +       G+W  +    C    C  P   +NG +     S             +  ++ Y C P +++ G  +  C    WS   +PTC
Sbjct: 2142 IPVRCGEPPSIMNGYASGSNYSFGAMVAYSCNKGFYIKGEKKSTCEATGQWSSPIPTCHPVS--CGEPPKVENGFLEHTTGRI-FES--EVRYQCNPGYKSVGSPVFVCQANRHWHSESPLMCVPLDCGKPPPIQNG-FMKGENFEVGSKVQFFCNEGYELV--------GDSSWTCQKSGKWNKKSNPKCMPAKCPEPPLLENQLVLKELTTEVGVVTFSCKEGHVLQGPSVLKCLPSQQWNDSFPVCKIVLCTPPPLISFGVPIPSSALHFGSTVKYSCVGGFFLRGNSTTLC-----QPDGTWSSPLPECVPVECPQPEEIPNGIIDVQ------------GLAYLSTALYTCKPGFELVGNTTTLCGENGHWLGGKPTCKAIEC-LKPKEILNGKFSYTDLHYGQTVTYSCNRGF----RLEGPSALTCL-----ETGDW-DVDAPSCNAIHCDSPQPIENGFVEGADYS-------------YGAIIIYSCFPGFQVAGHAMQTCEESGWS-SSIPTC 2608          

HSP 3 Score: 109.768 bits (273), Expect = 3.510e-23
Identity = 109/424 (25.71%), Postives = 165/424 (38.92%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPE--NGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF-IPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKD 1646
            I ++C  P  P NG    +   +G  V+Y+CK G+ L G   R C  N + SG+ P C  +   C      P   ++ +    ++     +   C  GY          + + N W  D   C    C       NG+ +  + YT+Q      CN+GF ++            R C A+G WSG T  C  + C   +PP+  NG   G+        TF C EGY LHG+    C  +GNWD     C   NCGPP ++        +  HG   +Y+C     L G +S   C    + SG  P         C P +  +  +     N T       +   G   R +C  G++L       C  +G W+   P C   +C +  P +  + +   S   +++  Y C  GY I    D
Sbjct: 2713 ISIECDLPTAPENGFLRFTETSMGSAVQYSCKPGHILAGSDLRLCLENRKWSGASPRC--EAISCKK----PNPVMNGSIKGSNYTYLSTLYYECDPGYVLNGTERRTCQDDKN-WDEDEPICIPVDCSSPPVSANGQ-VRGDEYTFQKEIEYTCNEGFLLEGARS--------RVCLANGSWSGATPDCVPVRC--ATPPQLANGVTEGLDYGFMKEVTFHCHEGYILHGAPKLTCQSDGNWDAEIPLCKPVNCGPPEDLAHGFPNGFSFIHGGHIQYQCFPGYKLHGNSS-RRCLSNGSWSGSSPS--------CLPCRCSTPVIEYGTVNGT-------DFDCGKAARIQCFKGFKLLGLSEITCEADGQWSSGFPHCEHTSCGSL-PMIPNAFISETSSWKENVITYSCRSGYVIQGSSD 3101          

HSP 4 Score: 101.293 bits (251), Expect = 1.412e-20
Identity = 135/580 (23.28%), Postives = 221/580 (38.10%), Query Frame = 3
Query:  375 VCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTY-QSIAIQF-CNDGFKI------------------------QCTTDQFE-------DKNCRRQ------------------CQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMH-DEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFIPRCVEAACS----ARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWSPPQMPTCE 1940
            +C+ +D  C  P    NG           ++EYTC  G+ L+G R R C AN   SG+ P+C      C + P +     +  +   D+   ++V   C  GY       +  + +GN W  +   C+  +CG  ED  +G   + N +++     IQ+ C  G+K+                        +C+T   E       D +C +                   C+ADG+WS     C    C  L    N  +    +   ++ T+ C+ GY + GS    CT +G W      C   +CG PP +  A    EA T+ ++ + +C    T+  +T   TC + D +  W P+      + C P      K  + EN   T+ ++H D+ +    V   C  GY      +  C  +G+W   P   + +CS     +P S ++  V       +S   Y C  GY +                   +GN  ++  E  Q             E  L   + +  + +++  P     V Y C+  Y L+GP  A C  NG WS P +P C+
Sbjct: 2827 ICIPVD--CSSPPVSANGQVRGDEYTFQKEIEYTCNEGFLLEGARSRVCLANGSWSGATPDCVPVR--CATPPQL----ANGVTEGLDYGFMKEVTFHCHEGYILHGAPKLTCQSDGN-WDAEIPLCKPVNCGPPEDLAHG---FPNGFSFIHGGHIQYQCFPGYKLHGNSSRRCLSNGSWSGSSPSCLPCRCSTPVIEYGTVNGTDFDCGKAARIQCFKGFKLLGLSEITCEADGQWSSGFPHCEHTSCGSLPMIPNAFISETSSWKENVITYSCRSGYVIQGSSDLICTEKGVWSQPYPVCEPLSCGSPPSVANAVATGEAHTYESEVKLRCLEGYTMDTDTDTFTC-QKDGR--WFPE-----RISCSP-----KKCPLPEN--ITHILVHGDDFSVNRQVSVSCAEGYTFEGVNISVCQLDGTWE--PPFSDESCSPVSCGKPESPEHGFVVGSKYTFESTIIYQCEPGYEL-------------------EGNRERVCQENRQWSGGVAICKETRCETPLEFLNGKADIENRTTGP----NVVYSCNRGYSLEGPSEAHCTENGTWSHP-VPLCK 3353          

HSP 5 Score: 93.5893 bits (231), Expect = 4.133e-18
Identity = 145/613 (23.65%), Postives = 223/613 (36.38%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSIL--LVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSE----PECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDP--IKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTV-NSIKTFKCKEGYQLHGSHLRKCTREGNWDG-SNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSG-WLPKPEPKCL-----------------------------------------LHCKPFQ-----VDSAKVYIHENNKTTNF---IMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNF-IPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTK-MPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWSPPQMPTCEFIMHDE-LPISWLYYRSDDKK*EDYVFYLHF 2030
            + + C  P  P+  HA+      L GD   Y C  GY+L    +  C A  +    E    P C      C   P + Y+ + ++ ++  F  G  V   C  G+     + I     G +W   P  I+C    CG+     NG     +NY++ ++    CN GF I+           +  C+A G+WS     C  + C E    ENG +      +  S   ++C  GY+  GS +  C    +W   S   C+  +CG PP I    +  E    G++ ++ C     L+G++S+ TC     KSG W  K  PKC+                                         L C P Q         K+ +       +F   I    +  G+ V+  C  G+ L  +    C  +G+W+  +P CV   C  +P  +    +    L + S A Y C         K G E +     +    G+W    PT  C+  +C KP    NG+            TD      + + V Y C+  +RL+GP    CL  G W     P+C  I  D   PI   +    D      + Y  F
Sbjct: 2017 LAVSCDEP--PIVDHASPETAHRLFGDIAFYYCSDGYSLADNSQLLCNAQGKWVPPEGQDMPRCIAH--FCEKPPSVSYS-ILESVSKAKFAAGSVVSFKCMEGFVLNTSAKIECM-RGGQWNPSPMSIQCIPVRCGEPPSIMNGYAS-GSNYSFGAMVAYSCNKGFYIKGEK--------KSTCEATGQWSSPIPTCHPVSCGEPPKVENGFLEHTTGRIFESEVRYQCNPGYKSVGSPVFVCQANRHWHSESPLMCVPLDCGKPPPIQNGFMKGENFEVGSKVQFFCNEGYELVGDSSW-TC----QKSGKWNKKSNPKCMPAKCPEPPLLENQLVLKELTTEVGVVTFSCKEGHVLQGPSVLKCLPSQQWNDSFPVCKIVLCTPPPLISFGVPIPSSALHFGSTVKYSCVGGFFLRGNSTTLCQPDGTWSSPLPECVPVEC-PQPEEIPNGIIDVQGLAYLSTALYTC---------KPGFELVGNTTTLCGENGHWLGGKPT--CKAIECLKPKEILNGKF---------SYTDLH----YGQTVTYSCNRGFRLEGPSALTCLETGDWD-VDAPSCNAIHCDSPQPIENGFVEGADYSYGAIIIYSCF 2583          

HSP 6 Score: 92.8189 bits (229), Expect = 7.034e-18
Identity = 136/541 (25.14%), Postives = 207/541 (38.26%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGK--LEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKW----SGDTAICTAILC---PELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNST--CIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHC-KPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYE-LNSDILPACYNGSWNFIP--RCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNK-GNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTCEFIMHDELPI 1967
            ++C  P    NG    S L       Y+C +GY+L+GP    C A+     + P C      C   P I    +  N    +F     V   C+ GY       I    +G +W     +C   SC +  + D  +  T +     +  IA  +C+DG+ +          N +  C A GKW      D   C A  C   P +S      V        S+ +FKC EG+ L+ S   +C R G W+ S  +  CI   CG PP I+    +    + GA   Y C     + GE    TC      S  +P   P   + C +P +V++  +       TT  I   EV      R +CN GY+ + S +     N  W+      CV   C  +PP ++   ++  + +  S  +++C+ GY   L  D   T        C K G W K     C P KC +PP  +N            +L  K +      VV + C   + L+GP +  CL         P C+ ++    P+
Sbjct: 1903 VKCSSPENINNGKYILSGLTYLSTASYSCDTGYSLQGPSIIECTASGIWDRAPPAC--HLVFCGEPPAIKDAVITGN----NFTFRNTVTYTCKEGYTLAGLDTIECLADG-KWSRSDQQCLAVSCDEPPIVDHASPETAHR---LFGDIAFYYCSDGYSLA--------DNSQLLCNAQGKWVPPEGQDMPRCIAHFCEKPPSVSYSILESVSKAKFAAGSVVSFKCMEGFVLNTSAKIECMRGGQWNPSPMSIQCIPVRCGEPPSIMNGYASGSNYSFGAMVAYSCNKGFYIKGEKK-STCEATGQWSSPIPTCHP---VSCGEPPKVENGFL-----EHTTGRIFESEV------RYQCNPGYKSVGSPVFVCQANRHWHSESPLMCVPLDC-GKPPPIQNGFMKGENFEVGSKVQFFCNEGY--ELVGDSSWT--------CQKSGKWNKKSNPKCMPAKCPEPPLLEN------------QLVLKELT-TEVGVVTFSCKEGHVLQGPSVLKCLPSQQWNDSFPVCKIVLCTPPPL 2386          

HSP 7 Score: 87.8113 bits (216), Expect = 2.296e-16
Identity = 140/610 (22.95%), Postives = 202/610 (33.11%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECT-------------------------DQTDLCFSAPYI----PY-----------TQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEP-KC------------------------------LLH-------------------CKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWN-FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNK-GNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLN-GHWSPPQMPTCE 1940
            + C  P    NG    +    G  + Y+C  G+ + G   + C+ +   S S P C                          +Q D     PY+    PY           T+    ++  +F  G  V   C  GYE      +I + +G  W      C    C     P+NG   +    T    A+Q+        C        +  R C  + KWSG +  C AI C + +P  NG + G   T  S   ++C  GY L+G+  R C  + NWD     CI  +C  PP     +V  +  T   + EY C     L G  S + C    + SG  P   P +C                              +LH                   CKP      +   H      +FI      HG H++ +C  GY+L+ +    C  NGSW+   P C+   CS   P ++Y TV          AR  C  G+           L  + +I C   G W+      C+   C   P   N  I                      V+ Y C   Y ++G    +C   G WS P  P CE
Sbjct: 2554 IHCDSPQPIENGFVEGADYSYGAIIIYSCFPGFQVAGHAMQTCEES-GWSSSIPTCMPIDCGLPPHIDFGDCTKLKDDQGYFEQEDDMMEVPYVTPHPPYHLGAVAKTWENTKESPATHSSNFLYGTMVSYTCNPGYELLGNPVLICQEDGT-WNGSAPSCISIECDLPTAPENGFLRFTE--TSMGSAVQY-------SCKPGHILAGSDLRLCLENRKWSGASPRCEAISCKKPNPVMNGSIKGSNYTYLSTLYYECDPGYVLNGTERRTCQDDKNWDEDEPICIPVDCSSPPVSANGQVRGDEYTFQKEIEYTCNEGFLLEGARSRV-CLANGSWSGATPDCVPVRCATPPQLANGVTEGLDYGFMKEVTFHCHEGYILHGAPKLTCQSDGNWDAEIPLCKPVNCGPPEDLAHGFPNGFSFI------HGGHIQYQCFPGYKLHGNSSRRCLSNGSWSGSSPSCLPCRCST--PVIEYGTVNGTDFDCGKAARIQCFKGF----------KLLGLSEITCEADGQWSSGFPH-CEHTSCGSLPMIPNAFI-------------SETSSWKENVITYSCRSGYVIQGSSDLICTEKGVWSQP-YPVCE 3118          

HSP 8 Score: 84.3445 bits (207), Expect = 2.719e-15
Identity = 133/585 (22.74%), Postives = 201/585 (34.36%), Query Frame = 3
Query:  240 HVKSLDNVKHLPNGCPSKACTANIDCWVEYDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANH-----SILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQ-SIAIQFCNDGFKIQCTTDQFEDKNCRR--QCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIG--ETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNS-DILPACYNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNR----VVKYECHPLYRLKGPKIAVC-LNGHWSPPQ---MPTC 1937
            +V S   VK L   CP +    N+  W ++         S + G V ++           + G   H       L  G +V   C  G+ L G   +YC    + +   P C   +        +P    +   + DDF  G  V   C NGY     S +    NG+     P   +   C    D     +  N + +Y  S    +  DG            KNC    +C+A G                   PENG   G   TV +  TF C+EGYQL G     C   G W+     C   +CG P       +   A T G++  Y+C    TL G  E+S L        S W   P       C+P +  S      EN     +I+   +T+ +     C+ GY L    I+    +G W+  P          PP++K + +   +    +   Y C  GY +A    G++T+  + D     G W++                  + +  L    D   + D +     +R    +  Y C   Y L      +C   G W PP+   MP C
Sbjct: 1582 YVLSPQQVKSLATSCPEELSKGNVLAWPDFL--------SGIVGKVKIDSKSIFCSDCPRLGGSVPHLRTASEDLKPGSKVNLFCDPGFQLVGNPVQYCLNQGQWTQPLPHCERISC------GVPPPLENGFHSADDFYAGSTVTYQCNNGYYLLGDSRMFCTDNGSWNGVSPSCLDVDECAVGSDCSEHASCLNVDGSYICSCVPPYTGDG------------KNCAEPIKCKAPGN------------------PENGHSSGEIYTVGAEVTFSCQEGYQLMGVTKITCLESGEWNHLIPYCKAVSCGKPAIPENGCIEELAFTFGSKVTYRCNKGYTLAGDKESSCLA------NSSWSHSPP-----VCEPVKCSSP-----ENINNGKYILSG-LTYLSTASYSCDTGYSLQGPSIIECTASGIWDRAPPACHLVFCGEPPAIKDAVITGNNFTFRNTVTYTCKEGYTLA----GLDTIECLAD-----GKWSR------------------SDQQCLAVSCDEPPIVDHASPETAHRLFGDIAFYYCSDGYSLADNSQLLCNAQGKWVPPEGQDMPRC 2078          

HSP 9 Score: 79.7221 bits (195), Expect = 6.353e-14
Identity = 96/421 (22.80%), Postives = 152/421 (36.10%), Query Frame = 3
Query:  465 VEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTA--ICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIA--LRKDGMETLSTIFDIKCNKGNWTKMP 1712
            + Y+C+SGY ++G     C      S   P C   +  C S P +        ++  +     +VK+ C  GY     +          W  + I C  K C  L +      ++ ++++        C +G+        FE  N    CQ DG W    +   C+ + C +   PE+G V+G   T  S   ++C+ GY+L G+  R C     W G  + C    C  P E +  K   E  T G    Y C    +L G +    C E    +G    P P C  +  P         I EN      +   E     +V  KC  G+ L    +  C  + +W       E      P  ++ +  R +  ++  +  Y C+ GY +   LR   +E            G WT  P
Sbjct: 3086 ITYSCRSGYVIQGSSDLICTEKGVWSQPYPVCEPLS--CGSPPSVANAVATGEAHTYE----SEVKLRCLEGYTMDTDTDTFTCQKDGRWFPERISCSPKKC-PLPENITHILVHGDDFSVNRQVSVSCAEGYT-------FEGVNISV-CQLDGTWEPPFSDESCSPVSCGKPESPEHGFVVGSKYTFESTIIYQCEPGYELEGNRERVCQENRQWSGGVAICKETRCETPLEFLNGKADIENRTTGPNVVYSCNRGYSLEGPSE-AHCTE----NGTWSHPVPLCKPNPCP-----VPFVIPEN----ALLSEKEFYVDQNVSIKCREGFLLQGHGIITCNPDETWTQTSAKCEKISCGPPAHVENAIARGVHYQYGDMITYSCYSGYMLEGFLRSVCLE-----------NGTWTSPP 3466          

HSP 10 Score: 68.5514 bits (166), Expect = 1.803e-10
Identity = 62/242 (25.62%), Postives = 95/242 (39.26%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGY--EDPYKSHIIAKCNGNEWKYDPIKCEKKSCG-KLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNW 1109
            + C  P  P +G    S       + Y C+ GY L+G R+R CQ N + SG    C +      +    P   ++  ++ ++   G +V   C  GY  E P ++H     NG  W +    C+   C      P+N        Y  Q+++I+ C +GF +Q         +    C  D  W+  +A C  I C   +  EN    GV      + T+ C  GY L G     C   G W
Sbjct: 3239 VSCGKPESPEHGFVVGSKYTFESTIIYQCEPGYELEGNRERVCQENRQWSGGVAICKE------TRCETPLEFLNGKADIENRTTGPNVVYSCNRGYSLEGPSEAHCTE--NGT-WSHPVPLCKPNPCPVPFVIPENALLSEKEFYVDQNVSIK-CREGFLLQ--------GHGIITCNPDETWTQTSAKCEKISCGPPAHVENAIARGVHYQYGDMITYSCYSGYMLEGFLRSVCLENGTW 3462          

HSP 11 Score: 65.0846 bits (157), Expect = 2.218e-9
Identity = 57/216 (26.39%), Postives = 95/216 (43.98%), Query Frame = 3
Query:  321 VEYDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNE-WKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAI 965
            +E +R ++C  +    G V +  + +C+ P++ +NG A+      G  V Y+C  GY+L+GP + +C  N   S   P C  + + C     IP   +    +  +F   ++V I C+ G+    + H I  CN +E W     KCEK SCG     +N       +Y Y  +    C  G+ ++           R  C  +G W+    IC A+
Sbjct: 3273 LEGNRERVCQENRQWSGGVAICKETRCETPLEFLNGKADIENRTTGPNVVYSCNRGYSLEGPSEAHCTENGTWSHPVPLC--KPNPCPVPFVIPENALL---SEKEFYVDQNVSIKCREGFL--LQGHGIITCNPDETWTQTSAKCEKISCGPPAHVENA-IARGVHYQYGDMITYSCYSGYMLE--------GFLRSVCLENGTWT-SPPICRAV 3471          

HSP 12 Score: 55.4546 bits (132), Expect = 2.019e-6
Identity = 46/181 (25.41%), Postives = 72/181 (39.78%), Query Frame = 3
Query:  753 CEKKSCGKLEDPKNGRTMYN--NNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKT--FKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGP---PPEIVFA--KVAYEATTHGAQAEYKCKSRSTLIGETSFLTC 1268
            CE   C  L+ P+NG  + N  NN+   +  ++ C+ GF +  ++           C  +G WSG  + C    CP L  P++G +      +    T    C EGY+L GS    C     WDG    C+ R+C     P +++ +      +    G      C+    L G    L C
Sbjct:  373 CELVHCPALKPPENGYFIQNTCNNHFNAACGVR-CHPGFDLVGSSIIL--------CLPNGLWSGSESYCRVRTCPHLRQPKHGHISCSTREMLYKTTCLVACDEGYRLEGSDKLTCQGNSQWDGPEPRCVERHCSTFQMPKDVIISPHNCGKQPAKFGTICYVSCRQGFILSGVKEMLRC 544          
BLAST of C4b binding protein beta chain vs. TrEMBL
Match: A0A0X3NX16 (Protein lev-9 OS=Schistocephalus solidus OX=70667 GN=LEV9 PE=4 SV=1)

HSP 1 Score: 453.751 bits (1166), Expect = 6.891e-147
Identity = 239/638 (37.46%), Postives = 350/638 (54.86%), Query Frame = 3
Query:  282 CPSKACTANIDCWVEYDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYI------PYTQVHDNSN--RDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTD-----QFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCK-------------PFQV--------DSAKVYIHENNKTTNFIMH--DEVTHGTHVRAKCNFGYELNSD---ILP--------ACYNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGM----------------------ETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYEC-HPLYRLKGPKIAVCLNGHWSPPQMPTCEFIMHDELPISWLYYR 1985
            CP K C AN+DCWV Y + Q CVCD   CGLVC+ +  +C PP  P NG  +     VGD  EYTC  G+ + GPRKR+C   L+ SG EP CT+QTD CFS PYI       +T+  ++S+  R+D++ G+ + + C++G+EDP + +    C GN+WKY+ + C++ SC +++ P NGRT+Y ++  Y++ A+QFCNDG  I+C +D     Q ++++C R CQADG+WSG  A CT I CP+L  P++G + G W  VNS+  F+C+ GY+L GS  R+C  +G WDG    C +R+CGPPP I FA V Y +T  G++A +KC+S +     +S L C   +NK+ WLP P P C  +C              P  V        D+ ++     +++ + ++H   +  HGT +R  C  G+ L  D   I+P         C +GSWN   +C+ A C  RPP++  + VRF S+ H S+ RY C  G+ +   K                          T   ++ ++C  G W     E C P  C +P   +  +I+L+G   R      SI P H  VV Y C    YR+ GP+ A C+ G W+PP +PTCE I HD +P +WL++R
Sbjct:   74 CPQKTCRANVDCWVAYGKPQQCVCDPQFCGLVCLPVGARCPPPYLPSNGFVSFRDSKVGDMAEYTCAPGFTVMGPRKRHCLGTLQWSGPEPICTNQTDYCFSPPYIQNAIVLEHTKFGEDSSQERNDYRTGDSITMTCRSGFEDPARKYTTVLCVGNQWKYEKLDCQRISCPEIDGPVNGRTIYTSDLRYRATAVQFCNDGHAIKCPSDAEGVVQRDEESCMRVCQADGRWSGGNAECTPIQCPQLEKPDHGSLSGFWTKVNSVVAFECEIGYELIGSPFRRCQLDGKWDGDPVICKIRDCGPPPNIRFAAVKYSSTIFGSRAYFKCESGTVPSVSSSELVCKTHNNKTMWLPFPYPACYRYCSLPVVAQSSISIVAPGGVKVEGESPLDNGEILPASTSQSADEVVHLDSQTEHGTVIRIACKSGFNLVLDQQKIIPTSETEGQAVCNDGSWNSSYKCIPARCKQRPPTVANAIVRFYSMSHGSVVRYQCLPGFILEASKMHTGSEDLLSSSESEEEKVNRDLVWGTQHDLYSVRCEFGEWRGRRPE-CVPIHCKRPIVVEGVQIHLIGARGRWPFESDSIYPTHGAVVVYSCAQEGYRINGPRYAFCIEGAWNPPTIPTCELITHDIIPSNWLFHR 710          
BLAST of C4b binding protein beta chain vs. TrEMBL
Match: A0A068WN99 (C4b binding protein beta chain OS=Echinococcus granulosus OX=6210 GN=EgrG_000439500 PE=4 SV=1)

HSP 1 Score: 441.81 bits (1135), Expect = 1.186e-142
Identity = 235/609 (38.59%), Postives = 339/609 (55.67%), Query Frame = 3
Query:  282 CPSKACTANIDCWVEYDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHD--------NSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQC-----TTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKV-YIHENNKTTNFIMHDE--VTHGTHVRAKCNFGYELNSDIL---------PACYNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYI-------ALRK----DGMETLSTI----FDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYEC-HPLYRLKGPKIAVCLNGHWSPPQMPTCEFIMHDELPISWLYYR 1985
            CP + C AN+DCWV Y + Q CVCD + CGLVC+ +  +C PP +P NG+       VG  V+YTC +G+ + GPRKR+C A    SG EP CT+QTD CFS PYI    V +        + +R D+++GE + + C+ G+ D  + +    C GN+WKY  + C + SC +++ P+NGRT+Y ++  YQ  A+QFCNDG+ I C      T+    K+C R CQADG WSG +A C A+ CP+L  PENG + G    VNS+  F+C EG++L GS  RKC   G W+G  + C VR+CG PPEI  A V + +T++G++A + C++ +     TS L CG + NK+ WLP P P C  HC    + SA +  ++ N K    I+ +E  + HG  +   C+ G+ L+   +           C NG W+    C  A C+ RPP++  +  RF  L H S+ RY C  GY +       ALR+     G+     +    + ++C  G W K     C   +C +PP P+  EIYL+G   R     K I P H  VV+Y C    +R++GPK   C++G WSP + P C  I HD +P+SWL+Y+
Sbjct:   74 CPKRTCRANVDCWVAYGKPQQCVCDPHFCGLVCLPVGSRCSPPNKPENGNILLRDTRVGATVDYTCDAGFTVMGPRKRHCLATRSWSGPEPVCTNQTDHCFSPPYIQNAMVIEGHWLEAKISRDRADYRSGESITMTCRPGFVDAKRKYSTIVCVGNQWKYKKLDCHRVSCPEIDGPENGRTLYTSDMRYQGTAVQFCNDGYTIHCPGETVKTEPTSSKSCSRVCQADGTWSGKSAKCIAVTCPKLQQPENGFISGYQTKVNSVVAFECAEGFKLKGSSFRKCQLNGEWNGEPAQCQVRDCGSPPEISNAVVKFSSTSYGSKAYFSCEAGTKSSVSTSELICGRIGNKTSWLPFPYPACYKHCSVPDIVSANISLLNMNGKPDGDIVAEETLLEHGVTIAVYCHSGFSLSKGKIRLDQGAFTTTTCENGKWSHKVECQPAQCTTRPPNIPNALARFYGLHHGSVVRYQCFPGYELDTNRTEAALREAASTGGLANTWPLAHDRYSVRCEYGVW-KGELPACVQVRCNRPPVPEGMEIYLVGARGRWPFDSKQILPTHGAVVEYSCLKDGHRIEGPKYTFCIDGSWSPDETPICTKITHDIIPLSWLFYK 681          
BLAST of C4b binding protein beta chain vs. TrEMBL
Match: A0A0R3S8B5 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS374 PE=4 SV=1)

HSP 1 Score: 438.343 bits (1126), Expect = 1.047e-141
Identity = 226/609 (37.11%), Postives = 336/609 (55.17%), Query Frame = 3
Query:  282 CPSKACTANIDCWVEYDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHD--------NSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQ-----FEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTN---FIMHDEVTHGTHVRAKCNFGYEL---------NSDILPACYNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYI-----------ALRKDGMETLSTI----FDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYEC-HPLYRLKGPKIAVCLNGHWSPPQMPTCEFIMHDELPISWLYYR 1985
            CP + C AN+DCWV Y + Q CVCD + CGLVC+ +  QC  P +P NG+       +G   +Y C +G+ + GPR+R+C A L+ SG EP CT+QTD CFS PY+P   V +        +S+R D++NGE + + C+ G+ D  + +    C GN+WKY+ + C++ SC +++ PKNGRT+Y ++  +Q+ AIQFC+DG+ I+C+ +         K+CRR CQ DG WSG +A C A+ CP+L  PENG + G    VNS+  F+C EGY+L GS  RKC   G W+G  + CIVR+CG PPEI  A + + +TT  ++A + C + +    ++S L C +V NK+ WLP P P C  HC+   + +A + +   + T N     +   + H T +   C  GY L          S     C NG+W+    C  A C+ RPP++  +  RF  L H S+ RY C  G+ +            +R  G+     +    + +KC  G W   P   C    C +PP P   E+YL+G   R     +   P H  V++Y C    +R++GP+ + C++GHWSP + P C  I HD +P SWL+Y+
Sbjct:   49 CPKRTCRANVDCWVAYGKPQQCVCDPHFCGLVCLPVGSQCPMPNKPENGNVLLRDSGIGGAADYICDAGFTVMGPRQRHCLATLKWSGPEPVCTNQTDYCFSPPYMPNAVVIEGHWLEDKTSSDRADYRNGEIITMTCRPGFADAKRKYSTVVCLGNQWKYEKLDCQRISCPEIKGPKNGRTLYTSDMRFQATAIQFCDDGYNIRCSEETENKEPSSAKSCRRVCQEDGTWSGKSAECIAVTCPKLQQPENGFISGYQTNVNSVVAFECAEGYELTGSKFRKCQANGEWNGEQAKCIVRDCGKPPEIKNAAIKFSSTTFNSKAYFSCDAETKSSIKSSELICSQVGNKTTWLPYPYPSCYKHCRVPDITNASITLTNLSGTPNKEVVKVGTLLEHDTSISISCQSGYNLAEGLTKPLQRSSATTLCKNGNWDHKYECQPARCTTRPPNIPNALARFYGLHHGSVVRYQCFPGFELDTNRTEVLLRKVVRNGGLTNTWPLTHDRYSVKCEYGVWKGEPPT-CVHVHCNQPPVPVGTEVYLVGSRGRWPFDARQGLPTHGAVIEYACLKDDHRIEGPRFSFCIDGHWSPDETPNCTKITHDVIPPSWLFYK 656          
BLAST of C4b binding protein beta chain vs. TrEMBL
Match: A0A068Y4F2 (C4b binding protein beta chain OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000439500 PE=4 SV=1)

HSP 1 Score: 434.106 bits (1115), Expect = 1.080e-139
Identity = 231/609 (37.93%), Postives = 335/609 (55.01%), Query Frame = 3
Query:  282 CPSKACTANIDCWVEYDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHD--------NSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQC-----TTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVT---HGTHVRAKCNFGYELNSDIL---------PACYNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYI-------ALRK----DGMETLSTI----FDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYEC-HPLYRLKGPKIAVCLNGHWSPPQMPTCEFIMHDELPISWLYYR 1985
            CP + C AN+DCWV Y + Q CVCD + CGLVC+ +  +C PP +P NG+       VG  V+YTC +G+ + GPRKR+C A    SG EP CT+QTD CFS PYI    V +        + +R D+++GE + + C+ G+ D  +++    C GN+WKY  + C + SC +++ P+NGRT+Y ++  YQ  A+QFCNDG+ I C      T+    K+C R CQADG WSG +A C A+ CP+L  PENG + G    VN +  F+C EG++L GS  RKC   G W+G  + C VR+CG PPEI  A V + +T++G++A + C++ +     T  L CG + NK+ WLP P P C  HC    + SA + +   N   +  +  E T   HG  +   C+ G+ L+   +           C NG W+    C  A C+ RPP++  +  RF  L H S+ RY C  GY +       ALR+     G+     +    + ++C  G W K     C   +C++PP P+  EIYL+G   R     K I P H  +V+Y C    +R++GPK   C++G WSP + P C  I HD +P SWL+Y+
Sbjct:   74 CPKRTCRANVDCWVAYGKPQQCVCDPHFCGLVCLPVGSRCSPPNKPKNGYILLRDTRVGATVDYTCDAGFTVMGPRKRHCLATRSWSGPEPVCTNQTDHCFSPPYIQNAMVIEGHWLEAKISRDRADYRSGESITMTCRPGFVDAKRNYSTIVCVGNQWKYKKLDCHRVSCPEIDGPENGRTLYTSDMRYQGTAVQFCNDGYTIHCPGETVKTEPTSSKSCSRVCQADGTWSGKSAKCIAVTCPKLQQPENGFISGYQTKVNGVVAFECAEGFELKGSSFRKCQLNGEWNGEPAQCQVRDCGSPPEISNAVVKFSSTSYGSKAYFSCEAGTKSSVSTLELICGRIGNKTSWLPFPYPACYKHCSVPDIVSANISLLNMNGKPDGNIVAEATLLEHGVTIAVCCHSGFSLSKGKIRLDQGAFTTTTCENGKWSHEVECQPAQCTTRPPNIPNALARFYGLHHGSVVRYQCFPGYELDTNRTEAALREAASTGGLANTWPLAHDRYSVRCEYGVW-KGELPACVQVRCSRPPVPEGVEIYLVGARGRWPFDSKQILPTHGAIVEYSCLKDDHRIEGPKYTFCIDGSWSPDETPICTKITHDIIPPSWLFYK 681          
BLAST of C4b binding protein beta chain vs. TrEMBL
Match: A0A4S2LP64 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007135 PE=4 SV=1)

HSP 1 Score: 400.593 bits (1028), Expect = 8.057e-127
Identity = 224/656 (34.15%), Postives = 330/656 (50.30%), Query Frame = 3
Query:  186 LFLNLINPMKSAQYKPECHVKSLDNVKHLPNGCPSKACTANIDCWVEYDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHD------------NSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQC---TTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHE--NNKTTNFI-------------------------MHDEVTHGTHVRAKCNFGYELNSDILP--ACYNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIAL--RKDGMETLSTIFD-------IKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSI----KPIHNRVVKYECHPLYRLKGPKIAVCLNGHWS-PPQMPTCEFIMHDELPISWLY 1979
            L+++      SAQY P    +S          CP+K+C  +IDCWV +   Q CVCD +LCG VC+  + +C+PP+ P+NG    +   +GD  EYTC+ G+ ++GPR R+C A L  SG +P C++QT+ CFS PY+P T+               + +RDD+K+GE ++I+CQ GY+D  + ++ A C G+EW+   + CE+ +CG + DP +G  ++ ++  Y++ A+  C +GF   C   +  Q     C R CQADG WSG   IC  I CP L  PENG +      VNSI    C  GY+L G   ++C   G WDG  + C  R+CGP P +V  +V  E TT G++A + C   +T   +T  L CG +DNK+ WLP+P P C  HC  F VD   V +    N  +  FI                             V HG  +   C+ GY+L +   P   C +G W+   +CV A+C  RPP    + VRF SLKH++  RY C  G+ + +   K  ++ L+ +         I+C  G W  +P   C+P  C+K    K  E+ L   + R  L   +      P    V  + C P + + G   +VC NG W+ PP    CE   HD++P  W +
Sbjct:   18 LWMSAFVYPDSAQYTPGNVCESSAQTHPDFMKCPTKSCRQHIDCWVSFGPPQFCVCDRHLCGAVCLPENSRCKPPIAPLNGTVRFNGTEIGDSAEYTCEVGFVVRGPRNRHCLATLSWSGEDPSCSNQTNTCFSPPYMPNTRTRSRPRPEQVSMFSLDIDRDDYKSGEVIEIVCQPGYKDLERDYVEAACVGSEWRVTKLNCERVNCGPIRDPPHGHLVFKSDKRYKAEALAVCAEGFIADCGPSSGTQDSTIGCLRVCQADGTWSGHDTICRPITCPRLDAPENGGISTYSTEVNSIVKVHCNHGYELIGPEQKQCLATGKWDGERTICKERDCGPVPTVVNGRVTAEKTTFGSRAAFTCDPDTTASSDTDSLHCGLIDNKTSWLPQPIPTCNRHCYLFTVDHGDVLLMHKPNTPSQRFIPITSENYPQLESIGNALTSSDGIILPGSRVRHGAQLNVTCHRGYQLVNTAQPITMCMDGVWSVRSKCVPASCRTRPPPAPGARVRFYSLKHEAKGRYECFVGHTLRVDETKQIVQPLNAVGSNDDPLGVIRCLHGEWVGIPVF-CEPVICSKLILHKMVEVELKHPTSRNILMGGTATLEETPRQGTVAHFRCSPGFHVVGTTFSVCHNGTWTPPPNTAHCEKSTHDQIPTEWFF 672          
BLAST of C4b binding protein beta chain vs. Ensembl Cavefish
Match: svep1 (sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1 [Source:NCBI gene;Acc:103042618])

HSP 1 Score: 140.584 bits (353), Expect = 7.503e-34
Identity = 139/525 (26.48%), Postives = 215/525 (40.95%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYN-NNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFIP---RCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWSPPQMPTCEFI 1946
            ++C+ P  P  GH   ++ +VG +V ++C+ GY L G  +  C       G  P C     L  + P +P   +   +N   F     V   C+ GY    +  +  +C  N +W  +P  C+  +CG  E P      +  NN  Y S     C +G+++Q + +         QC++ G+W+    +CT + C E SP ++  + G   T+ S   + C+EG+ L G+  ++C   G W  +++ C+ R CG PP +  A         G  A Y C    T IG  S L C    N  G    P+   + HC            H      + I   +    T V  KC  G+ LN+     C   G W+  P    C+   CS +P S++   V   +    ++  Y C  GYYI  R +   T           G W  +    CQP  C+ PP   NG I      D  R T+     +++  V Y C+  YRL G    +C+ N  WS    P C  +
Sbjct: 1789 VKCKDPGHPDFGHREGTVFIVGSEVVFSCEEGYELIGSSRLSCSETGTWEGLFPFCKA---LSCNPPTVPEHGILKGTN---FTYRSKVTFSCEKGYI--LEGTMEIQCESNLKWSSEPPICQPVTCG--EPPAVDHAEFTLNNTVYLSTLAYTCVEGYRLQGSGE--------LQCESTGEWTSPVPVCTRVECGEPSPLKDAVIKGDNFTLGSQVQYICREGFTLLGTETQECLPSGEWSRNSAQCVPRQCGSPPHVDHALSDAGHQLFGDTAIYFCDDGYT-IGNNSKLFC----NAEGVWAPPDGYGMPHCIANFCQRPPELPH---AILDSINKPKYASNTEVSYKCEEGFVLNTTATLKCLLGGDWSPSPLDIGCMPVRCS-KPESIERGYVSGNNYSFGAVVAYSCDKGYYI--RGEKRRTCKA-------NGEWGGV-LPACQPIACSSPPRLINGFI-----QDTIRRTNY----VYSSKVTYACNAGYRLTGKAERICMANKQWSNSDPPACVLL 2267          

HSP 2 Score: 125.561 bits (314), Expect = 4.467e-29
Identity = 129/527 (24.48%), Postives = 207/527 (39.28%), Query Frame = 3
Query:  372 LVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWS-GDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCL-LHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYEL--NSDILPACYNGSW-NFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTC 1937
            + CM +  +C  P     G+ + +    G  V Y+C  GY ++G ++R C+AN    G  P C  Q   C S P +    + D   R ++     V   C  GY    K+  I   N      DP  C   +C    D K+G    +  +   S     C++G+++        + +    C   GKW      +C+ + C E    +N  V+   ++ +      C++GY LHG+   +CT    W+ S   C   +CGPPP++ F   +  +   G+   Y C +  TL  E S ++C       G   KP P+C+ + C            H        +    + + +     C  GY+L  NS +L    +G W   +P C    C   P  +   + ++  L+      Y C  GY    R +G ETL+ +       GNW K     CQ   C+ P    NG  ++ G+  +  +T           + Y C P + L G     C    WS   +PTC
Sbjct: 2141 IGCMPV--RCSKPESIERGYVSGNNYSFGAVVAYSCDKGYYIRGEKRRTCKANGEWGGVLPAC--QPIACSSPPRLINGFIQDTIRRTNYVYSSKVTYACNAGYRLTGKAERICMANKQWSNSDPPACVLLTCPTPPDIKHGLYSGSTTFEVGSKVEYMCDEGYEL--------NGDAVWTCLKYGKWDKSKIPLCSPVQCQEPPLEDNHLVLRSLDSDSGTVELSCEDGYVLHGARTLRCTPSQEWNDSFPVCKQVSCGPPPDVSFGDPSSASFYFGSVITYSCMAGFTLRKEAS-VSC----QADGSWSKPYPECIPVECP-----------HPEEIPNGIVDVQGLMYLSTALYSCKPGYDLVGNSTVLCG-QSGLWIGGVPACHPIECPP-PKDIPNGSAKYSRLQFSRSVTYSCQRGY----RLEGPETLTCL-----ESGNWDKE-VPSCQQIYCSPPKPIDNG--FVEGRDHKFGVT-----------IFYSCFPGFLLMGQNHLTCEEHGWS-SSVPTC 2613          

HSP 3 Score: 105.916 bits (263), Expect = 5.991e-23
Identity = 126/518 (24.32%), Postives = 193/518 (37.26%), Query Frame = 3
Query:  231 PECHVKSLDNVKHLPNGCPSKA-----CTANIDCWVEYDRAQLCVCDSYLCGLVCMEID-------LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRD--DFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCG-----------KLEDPK-----------NGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWN-FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYY------IALRKDGM 1652
            PEC      + + +PNG           TA   C   YD   L    + LCG   + I        ++C PP    NG A +S L     V Y+C+ GY L+GP    C  +       P C       + +P  P     DN   +  D K G  +   C  G+    ++H+   C  + W      C    CG           K+ DP              R+  + ++ + ++    C+ G+ +        +      CQ DG W+G   +C    C     PE+G  +     + S+  + C+EGY+L G  +R+C     W+     CI  NCG P  I   +V   +        Y+C +   L G  S  TC ++D K  W  K  P C        V S  V ++           D  T G  +   CN G+ L+      C  N +W+   P+C+ A C  RPP ++    R  +  ++    Y C  GY       +  R DG+
Sbjct: 2438 PECIPVECPHPEEIPNGIVDVQGLMYLSTALYSCKPGYD---LVGNSTVLCGQSGLWIGGVPACHPIECPPPKDIPNGSAKYSRLQFSRSVTYSCQRGYRLEGPETLTCLESGNWDKEVPSCQQ----IYCSPPKPI----DNGFVEGRDHKFGVTIFYSCFPGFLLMGQNHLT--CEEHGWSSSVPTCSPADCGLPPHIDFGDYFKIRDPSAELSGGDNKLAGQRSPTDTSFLHGTMVQYRCHSGYDM--------NGGVVLGCQEDGIWNGTAPVCVPAECEAPPNPEHGLAILTDTVLGSLVEYSCEEGYELEGQTVRQCVSGRQWNDEAPRCIPINCGDPGGISNGEVVGRSFYFKEVIHYECHAGFILQGSES-RTC-QMDGK--WDGK-APSCRAVSCGHPVISNDVQVN----------GDSYTFGKRLVFSCNPGFILHGAATSVCLANSTWSESTPKCLPADC-GRPPIIRNGHARGTNYGYNGKVTYECDVGYTLIGNPSLVCRGDGL 2918          

HSP 4 Score: 95.1301 bits (235), Expect = 1.292e-19
Identity = 138/614 (22.48%), Postives = 215/614 (35.02%), Query Frame = 3
Query:  231 PECHVKSLDNVKHLPNGCPSKACTANIDCWVEYDRAQLCVCDSYLC----------GLVCMEI-----------DLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYI----------PYTQVHDNSNR---------DDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNE-WKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFIP-RCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWT-KMPT-EGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTC 1937
            P CH       K +PNG              +Y R Q     +Y C           L C+E             + C PP    NG         G  + Y+C  G+ L G     C+ +   S S P C+     C   P+I          P  ++    N+           F +G  V+  C +GY+      ++  C  +  W      C    C    +P++G  +  +     S+    C +G++++  T         RQC +  +W+ +   C  I C +     NGEV+G       +  ++C  G+ L GS  R C  +G WDG   +C   +CG P      +V  ++ T G +  + C     L G  + +        S W  +  PKCL    P       +  + + + TN+  + +VT+      +C+ GY L  +    C  +G W+  P RC    C   P  + +  +   S   D L  Y C  GY IA    G   L    D     G W  ++P    C             G  +  G S                 + + C   Y+  GP  AVC  G    P +P C
Sbjct: 2496 PACHPIECPPPKDIPNGS------------AKYSRLQFSRSVTYSCQRGYRLEGPETLTCLESGNWDKEVPSCQQIYCSPPKPIDNGFVEGRDHKFGVTIFYSCFPGFLLMGQNHLTCEEH-GWSSSVPTCSPAD--CGLPPHIDFGDYFKIRDPSAELSGGDNKLAGQRSPTDTSFLHGTMVQYRCHSGYD--MNGGVVLGCQEDGIWNGTAPVCVPAECEAPPNPEHGLAILTDT-VLGSLVEYSCEEGYELEGQT--------VRQCVSGRQWNDEAPRCIPINCGDPGGISNGEVVGRSFYFKEVIHYECHAGFILQGSESRTCQMDGKWDGKAPSCRAVSCGHPVISNDVQVNGDSYTFGKRLVFSCNPGFILHGAATSVCLA----NSTW-SESTPKCL----PADCGRPPIIRNGHARGTNYGYNGKVTY------ECDVGYTLIGNPSLVCRGDGLWDDPPPRCDIVTCDP-PEDISHGFLNGSSFNFDDLVEYICFPGYEIA----GSPILRCTAD-----GTWIGEVPQCRPCMCNPPVLKFGAVLGRDHTCGAS-----------------IWFRCDEGYKTLGPTEAVCDKGGVWSPGVPIC 3041          

HSP 5 Score: 92.4337 bits (228), Expect = 8.749e-19
Identity = 97/409 (23.72%), Postives = 150/409 (36.67%), Query Frame = 3
Query:  375 VCMEIDLQCQPPVQP---VNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGD--TAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHC-KPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNF-IPRCVEAACSARPPSMKYSTVRFL 1577
            +C        PP  P   V G A       G+ V Y C+ GY+L+G     C    R       C   +  C   P +P   +  ++    F  G   +  C  G+E   ++  +   +   W    ++C  K C     P N       N       +        I C    + +     +C   G+WS    +  C  + C +  P  +G + G   +     T+ C  G++L G  ++ C  +  W G+   C+V +CGPPP +  A       ++ ++  Y C S   LIG  + LTC    N S  LP P  +    C +P  +   KV             H +   G  +   C+ GY L  D    C  NGSW+   P C   +C   P     STV  +
Sbjct: 3040 ICSRGRCSTPPPAVPNAVVTGGAT-----TGETVTYGCRPGYSLRGHPNLSCGRLGRWGVPSLHCDPVS--CGEPPPVPNAMIVGSA----FTYGSKAQYKCSEGFEPVTQTDSVHCQSDGTWSKHSVRCRPKPCSL---PSN-----LTNVVVAGDQLTPVGGTITISCKPGFYLEGPGLSECGLFGRWSPSFSSNSCVLVFCDKPHPLLHGIIKGESYSYGDTVTYTCLPGFELQGDAVQICQGDKKWSGAQPLCVVVSCGPPPSVENAVSLMTGESYESKVTYVCDSGLELIGPQN-LTCQA--NGSWSLPTPTCEAPEDCPRPESILHGKVQ-----------EHSQANGGKALEIFCDKGYALQGDSHIVCMENGSWSSPFPICSPKSCPPLPGWPANSTVFLV 3415          

HSP 6 Score: 88.9669 bits (219), Expect = 1.040e-17
Identity = 111/501 (22.16%), Postives = 182/501 (36.33%), Query Frame = 3
Query:  240 HVKSLDNVKHLPNGCPSKACTANIDCWVEYDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKC-------------EKKSCGKLE-------------------DPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKS-GWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMH-DEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNF-IPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIA 1634
            +V S   ++ L + CPS     N+  W ++ R       S    + C +  L  +  V   N  ++   +  G QV+++C  GY L G   ++CQ     S + P+C      C + P + + Q H     +DF  G  V+  C+ G+    +S +    N  +W  +P  C             E  SC   +                   +P   +   + ++ ++   +          C        + R  C   G W G    C A+ C   + PE+G + G   T  S  TF C++GY L G+   +C     W      C    CG PP +  A+     T + +   Y C     L G       GE+  +S G    P P C            +V   E +   + ++  D  T G+ V+  C  G+ L       C  +G W+    +CV   C + PP + ++            A Y+C  GY I 
Sbjct: 1584 YVLSPQQIRSLASSCPSDLQRGNVFAWPDFLRGVTGRVKSSSNSMFCADCPLL-ENAVS--NLRSSSPAVSPGSQVKFSCNPGYYLVGEPVQHCQNRGAWSHAAPQCERVN--CGAPPPLEHGQYHG----EDFYAGSSVEYQCRPGFYLLGESKMHCA-NSGKWAGNPPACLDVDECALGSDCDEHASCQNTDGSHICTCIYPYTGDGRNCTEPVKCKDPGHPDFGHREGTVFIVGSEVVFSCEEGYELIGSSRLSCSETGTWEGLFPFCKALSCNPPTVPEHGILKGTNFTYRSKVTFSCEKGYILEGTMEIQCESNLKWSSEPPICQPVTCGEPPAVDHAEFTLNNTVYLSTLAYTCVEGYRLQGS------GELQCESTGEWTSPVPVC-----------TRVECGEPSPLKDAVIKGDNFTLGSQVQYICREGFTLLGTETQECLPSGEWSRNSAQCVPRQCGS-PPHVDHALSDAGHQLFGDTAIYFCDDGYTIG 2056          

HSP 7 Score: 88.1965 bits (217), Expect = 2.099e-17
Identity = 128/520 (24.62%), Postives = 192/520 (36.92%), Query Frame = 3
Query:  402 QPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTH-GTHVRAKCNFGYELNSDILPAC-YNGSWN---FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCE 1940
            +PP+   NGHA  +      +V Y C  GY L G     C+ +       P C    D+    P  P    H   N   F   + V+ IC  GYE       I +C  +  W  +  +C    C      K G  +  ++    SI  + C++G+K    T+   DK         G WS    IC+   C    P     V+    T     T+ C+ GY L G     C R G W   +  C   +CG PP +  A +   A T+G++A+YKC      + +T  + C    +   W      K  + C+P      K     +N T   +  D++T  G  +   C  G+ L    L  C   G W+       CV   C  +P  + +  ++  S  +     Y C  G+   L+ D ++         C            C    C  PP+ +N    + G+S  +++T             Y C     L GP+   C  NG WS P  PTCE
Sbjct: 2875 RPPII-RNGHARGTNYGYNGKVTYECDVGYTLIGNPSLVCRGDGLWDDPPPRC----DIVTCDP--PEDISHGFLNGSSFNFDDLVEYICFPGYE--IAGSPILRCTADGTWIGEVPQCRPCMCNP-PVLKFGAVLGRDHTCGASIWFR-CDEGYKTLGPTEAVCDKG--------GVWSPGVPICSRGRCSTPPPAVPNAVVTGGATTGETVTYGCRPGYSLRGHPNLSCGRLGRWGVPSLHCDPVSCGEPPPVPNAMIVGSAFTYGSKAQYKCSEGFEPVTQTDSVHC---QSDGTW-----SKHSVRCRP------KPCSLPSNLTNVVVAGDQLTPVGGTITISCKPGFYLEGPGLSECGLFGRWSPSFSSNSCVLVFCD-KPHPLLHGIIKGESYSYGDTVTYTCLPGF--ELQGDAVQI--------CQGDKKWSGAQPLCVVVSCGPPPSVENAVSLMTGESYESKVT-------------YVCDSGLELIGPQNLTCQANGSWSLP-TPTCE 3336          

HSP 8 Score: 86.2705 bits (212), Expect = 7.318e-17
Identity = 125/551 (22.69%), Postives = 191/551 (34.66%), Query Frame = 3
Query:  375 VCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKII------CQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFA-----------------KVAYEAT------THGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNG-SWN-FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNW-TKMPTEGCQXXX----XXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWS 1916
            VC ++   C PP     G  + +    G  + Y+C +G+ L+      CQA+   S   PEC            IP    H     +   + + +  +      C+ GY+    S ++   +G  W      C    C   +D  NG   Y+     +S+    C  G++++              C   G W  +   C  I C    P +NG V G  +       + C  G+ L G +   C   G W  S  TC   +CG PP I F                  K+A + +       HG   +Y+C S   + G    L C E    +G  P         C P + ++        N      +  +   G+ V   C  GYEL    +  C +G  WN   PRC+   C   P  +    V   S     +  Y CH G+ +     G E+ +   D     G W  K P+  C+               NG+ Y  G+                R+V + C+P + L G   +VCL N  WS
Sbjct: 2381 VCKQV--SCGPPPDVSFGDPSSASFYFGSVITYSCMAGFTLRKEASVSCQADGSWSKPYPEC------------IPVECPHPEEIPNGIVDVQGLMYLSTALYSCKPGYDLVGNSTVLCGQSG-LWIGGVPACHPIECPPPKDIPNGSAKYSRLQFSRSVTYS-CQRGYRLEGPE--------TLTCLESGNWDKEVPSCQQIYCSPPKPIDNGFVEGRDHKFGVTIFYSCFPGFLLMGQNHLTCEEHG-WSSSVPTCSPADCGLPPHIDFGDYFKIRDPSAELSGGDNKLAGQRSPTDTSFLHGTMVQYRCHSGYDMNGGV-VLGCQEDGIWNGTAPV--------CVPAECEAPP------NPEHGLAILTDTVLGSLVEYSCEEGYELEGQTVRQCVSGRQWNDEAPRCIPINC-GDPGGISNGEVVGRSFYFKEVIHYECHAGFIL----QGSESRTCQMD-----GKWDGKAPS--CRAVSCGHPVISNDVQVNGDSYTFGK----------------RLV-FSCNPGFILHGAATSVCLANSTWS 2862          

HSP 9 Score: 84.3445 bits (207), Expect = 2.707e-16
Identity = 97/417 (23.26%), Postives = 153/417 (36.69%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGS-WN-FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYI 1631
            +  +C+ P  P +G A  +  ++G  VEY+C+ GY L+G   R C +  + +   P C      C     I   +V   S    F   E +   C  G+          + +G +W      C   SCG      N   +  ++YT+    +  CN GF +               C A+  WS  T  C    C       NG   G     N   T++C  GY L G+    C  +G WD     C +  C PP +I    +   +       EY C     + G +  L C       G +P+  P C+  C P  +    V   ++            T G  +  +C+ GY+        C  G  W+  +P C    CS  PP++  + V   +   +++  Y C  GY +
Sbjct: 2695 VPAECEAPPNPEHGLAILTDTVLGSLVEYSCEEGYELEGQTVRQCVSGRQWNDEAPRCIPIN--CGDPGGISNGEVVGRS----FYFKEVIHYECHAGFILQGSESRTCQMDG-KWDGKAPSCRAVSCGHPVI-SNDVQVNGDSYTFGKRLVFSCNPGFILHGAATSV--------CLANSTWSESTPKCLPADCGRPPIIRNGHARGTNYGYNGKVTYECDVGYTLIGNPSLVCRGDGLWDDPPPRCDIVTCDPPEDISHGFLNGSSFNFDDLVEYICFPGYEIAG-SPILRCTADGTWIGEVPQCRP-CM--CNPPVLKFGAVLGRDH------------TCGASIWFRCDEGYKTLGPTEAVCDKGGVWSPGVPICSRGRCSTPPPAVPNAVVTGGATTGETVT-YGCRPGYSL 3078          

HSP 10 Score: 71.633 bits (174), Expect = 2.308e-12
Identity = 63/198 (31.82%), Postives = 85/198 (42.93%), Query Frame = 3
Query:  750 KCEKKSCGKLEDPKNGRTMYNN-NYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEV----MGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGW--LPKPEPKCL 1322
             C+   C  L  P+NG  + N  N  Y S     C  GF++Q ++         R CQADG WSG   ICT   CP LSPP++GE+     G    +  +   +C +GY+L G     C     W G    C+   C   P IV +K       H   +   C  R+   G T  LTC     + G+  L  PE +CL
Sbjct:  368 SCQAVVCAVLYPPENGFFIQNVCNNQYNSACGVRCMPGFELQGSS--------IRLCQADGTWSGAPPICTVRSCPVLSPPQHGELNCSEGGSPYRLECV--VRCLQGYRLEGRAKLTCLSSSQWSGPPPRCVEVRC---PSIVPSK-------HMRVSPPVCGERALRSGATCRLTC-----RRGYSLLGNPEVRCL 540          

HSP 11 Score: 57.3806 bits (137), Expect = 6.397e-8
Identity = 52/191 (27.23%), Postives = 78/191 (40.84%), Query Frame = 3
Query:  945 TAICTAILCPELSPPENGEVMG--VWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCG--PPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWN 1502
            T+ C A++C  L PPENG  +     N  NS    +C  G++L GS +R C  +G W G+   C VR+C    PP+      +   + +  +   +C     L G    LTC      SG    P P+C+    P  V S  + +     +        +  G   R  C  GY L  +    C  +G W+
Sbjct:  366 TSSCQAVVCAVLYPPENGFFIQNVCNNQYNSACGVRCMPGFELQGSSIRLCQADGTWSGAPPICTVRSCPVLSPPQHGELNCSEGGSPYRLECVVRCLQGYRLEGRAK-LTCLSSSQWSG----PPPRCVEVRCPSIVPSKHMRV-----SPPVCGERALRSGATCRLTCRRGYSLLGNPEVRCLPSGDWS 546          

HSP 12 Score: 55.8398 bits (133), Expect = 1.573e-7
Identity = 80/338 (23.67%), Postives = 121/338 (35.80%), Query Frame = 3
Query: 1041 FKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCL------------LHCKPFQVDSAKV------YIHENNKTTNFIM-----HDEVTH--------GTHVRAKCNFGYEL-NSDILPACYNGSW-NFIPRCVEAACSARPPSM-KYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKG-NWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLN-GHWSPPQMPTCEFI 1946
            F C  GY L G  ++ C   G W  +   C   NCG PP +   +   E    G+  EY+C+    L+GE+         N   W   P P CL             H      D + +      Y  +    T  +      H +  H        G+ V   C  GYEL  S  L     G+W    P C   +C+  PP++ ++  ++  +  + S   + C  GY           L    +I+C     W+  P   CQP  C +PP   + E  L                ++   + Y C   YRL+G     C + G W+ P +P C  +
Sbjct: 1658 FSCNPGYYLVGEPVQHCQNRGAWSHAAPQCERVNCGAPPPLEHGQYHGEDFYAGSSVEYQCRPGFYLLGESKM----HCANSGKWAGNP-PACLDVDECALGSDCDEHASCQNTDGSHICTCIYPYTGDGRNCTEPVKCKDPGHPDFGHREGTVFIVGSEVVFSCEEGYELIGSSRLSCSETGTWEGLFPFCKALSCN--PPTVPEHGILKGTNFTYRSKVTFSCEKGY----------ILEGTMEIQCESNLKWSSEPPI-CQPVTCGEPPAVDHAEFTLNNT-------------VYLSTLAYTCVEGYRLQGSGELQCESTGEWTSP-VPVCTRV 1963          
BLAST of C4b binding protein beta chain vs. Ensembl Cavefish
Match: csmd3a (CUB and Sushi multiple domains 3a [Source:ZFIN;Acc:ZDB-GENE-050419-118])

HSP 1 Score: 124.02 bits (310), Expect = 1.376e-28
Identity = 114/425 (26.82%), Postives = 159/425 (37.41%), Query Frame = 3
Query:  378 CMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHL--RKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWN-FIPRCVEAACSA--RPPSMKYSTV-RFLSLKHDSLARYYCHFGYYI 1631
            C+ +D  C  P  P NG  +      G  V Y+C  G  LKG   R CQ N   S   P C+  +      P +P    H +    DF+    V   C  GY     S  +   NG  W      C+   CG    P NGR    +  T+    I  C +G+ +  +T         RQCQA+G WSG    CT I C +   P NG   G   T+    TF C+ GY +         CT  G W      C    C  PP I    +       G    Y C S    +   + LTC      SG +P+        C P       V  H   +  +FI   EV+        C+  Y         C  +G+W+ F PRC+E   +    P + +Y ++ R    K  S+  ++C  G+ +
Sbjct: 2778 CIVVD--CGHPGSPPNGVLSGEKFTFGSTVRYSCTGGRQLKGESSRTCQLNGHWSAPMPFCSGDSSGTCGDPGVP---SHGSREESDFRIRSKVHFTCATGYVLFGSSERMCFPNGT-WSGTQPSCKPVQCGNPGTPSNGRVYRLDGTTFSHSVIYSCMEGYLLTGST--------TRQCQANGTWSGTAPNCTMINCGDPGVPANGVRYGEDFTIVQNITFACQPGYTMEADSFPTLTCTGNGTWSAPVPFCKAVTCTAPPPISNGLLEGSDFEWGTSVSYSC-SPGYELSFPAILTCVGNGTWSGEVPQ--------CLPKFCGDPGVPGHGFREGRSFIYQSEVSF------SCSPPYIPVGSATRFCQADGTWSGFQPRCIEPTRTTCENPGTPRYGSMNRTFGFKVGSMVAFHCQPGHLL 3173          

HSP 2 Score: 118.627 bits (296), Expect = 7.344e-27
Identity = 127/442 (28.73%), Postives = 179/442 (40.50%), Query Frame = 3
Query:  657 VKIICQNGYEDPYKSHIIAK---CNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAI--CTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF-IPRCVEAACSARPPSMKYSTVRFLSLKH-----DSLARYYCHFGYYIALRKDGMETLSTIFDIKCN-KGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCE 1940
            V+  C  GY    KS  + K       +W      C+  SCG  + P NG  +   +Y+  +    FCNDG+++         +     CQ DG WS    I  C+ I C EL  P +G+ +G   T  +   F C  GY L GS +R+C   G W G+ + C+  +CG P +IV  +V  E   +     Y+C     LIG +S   C +  N SG LP         C P         I+       F ++D V+        CN GY +   +   C  N  W+   P C    CS   P +  +++R   ++H      ++  Y C+ GYY+     G   L+      C   G W K P   C    C  P +P NG   L G+           K      V+Y C    +LKG     C LNGHWS P MP C 
Sbjct: 2445 VRWACDRGYRLIGKSTAVCKKTPYGYYDWDAPVPACQAVSCGVPKAPVNGGVL-AVDYSVGTRVTYFCNDGYRLS------SKELTSAVCQPDGTWSNHNKIPRCSVISCGELPTPASGKKIGTQTTFGATAIFTCDIGYMLVGSTVRECLSSGLWSGTETRCLGGHCGLPEQIVNGQVIGENFGYRDTVVYQCAPGFRLIG-SSVRICQQDHNWSGQLPI--------CVPISCGHPGSPIYGRTIGNGFNLNDVVSF------SCNTGYVMEGPVRAQCQANRQWSQPPPTCKVVNCSD--PGIPANSIRQSKIEHGNFTFGTVVFYDCNPGYYLF----GSPVLT------CQPTGQWDK-PLPECIVVDCGHPGSPPNG--VLSGE-----------KFTFGSTVRYSCTGGRQLKGESSRTCQLNGHWSAP-MPFCS 2837          

HSP 3 Score: 102.449 bits (254), Expect = 8.146e-22
Identity = 108/444 (24.32%), Postives = 169/444 (38.06%), Query Frame = 3
Query:  336 AQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNS-NRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAIC---TAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKV-AYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKC-LLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY---NGSWNF-IPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIAL 1637
             ++C  D    G + + + + C  P  P+ G    +   + D V ++C +GY ++GP +  CQAN + S   P C  +   C S P IP   +  +     +F  G  V   C  GY   + S ++      +W     +C    CG    P NG  +    +T+ S     C  G +++            R CQ +G WS     C   ++  C +   P +G        + S   F C  GY L GS  R C   G W G+  +C    CG P      +V   + TT      Y C     L G T+   C      SG      P C +++C    V +  V   E     +F +   +T        C  GY + +D  P      NG+W+  +P C    C+A PP +    +     +  +   Y C  GY ++ 
Sbjct: 2642 VRICQQDHNWSGQLPICVPISCGHPGSPIYGRTIGNGFNLNDVVSFSCNTGYVMEGPVRAQCQANRQWSQPPPTC--KVVNC-SDPGIPANSIRQSKIEHGNFTFGTVVFYDCNPGYYL-FGSPVLTCQPTGQWDKPLPECIVVDCGHPGSPPNG-VLSGEKFTFGSTVRYSCTGGRQLK--------GESSRTCQLNGHWSAPMPFCSGDSSGTCGDPGVPSHGSREESDFRIRSKVHFTCATGYVLFGSSERMCFPNGTWSGTQPSCKPVQCGNPGTPSNGRVYRLDGTTFSHSVIYSCMEGYLLTGSTT-RQCQANGTWSG----TAPNCTMINCGDPGVPANGVRYGE-----DFTIVQNITF------ACQPGYTMEADSFPTLTCTGNGTWSAPVPFCKAVTCTA-PPPISNGLLEGSDFEWGTSVSYSCSPGYELSF 3055          

HSP 4 Score: 94.7449 bits (234), Expect = 1.711e-19
Identity = 135/533 (25.33%), Postives = 188/533 (35.27%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYAL--KGPRKRYCQANLRLSGSE--PECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKC-NGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCG----PPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF-IPRCV--EAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKC-NKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCEFI 1946
            + C  P  PVNG        VG +V Y C  GY L  K      CQ +   S     P C+  +  C   P    T             G      C  GY        + +C +   W     +C    CG  E   NG+ +   N+ Y+   +  C  GF++  ++         R CQ D  WSG   IC  I C     P  G  +G    +N + +F C  GY + G    +C     W     TC V NC     P   I  +K+ +   T G    Y C     L G +  LTC      +G   KP P+C++      VD      H  +     +  ++ T G+ VR  C  G +L  +    C  NG W+  +P C    +     P    + +      +  S   + C  GY +    + M          C   G W+      C+P +C  P TP NG +Y L   D T  +   I         Y C   Y L G     C  NG WS    P C  I
Sbjct: 2483 VSCGVPKAPVNGGVLAVDYSVGTRVTYFCNDGYRLSSKELTSAVCQPDGTWSNHNKIPRCSVIS--CGELP----TPASGKKIGTQTTFGATAIFTCDIGYM--LVGSTVRECLSSGLWSGTETRCLGGHCGLPEQIVNGQVI-GENFGYRDTVVYQCAPGFRLIGSS--------VRICQQDHNWSGQLPICVPISCGHPGSPIYGRTIGNGFNLNDVVSFSCNTGYVMEGPVRAQCQANRQWSQPPPTCKVVNCSDPGIPANSIRQSKIEHGNFTFGTVVFYDCNPGYYLFG-SPVLTC----QPTGQWDKPLPECIV------VDCG----HPGSPPNGVLSGEKFTFGSTVRYSCTGGRQLKGESSRTCQLNGHWSAPMPFCSGDSSGTCGDPGVPSHGSREESDFRIRSKVHFTCATGYVLFGSSERM----------CFPNGTWSGT-QPSCKPVQCGNPGTPSNGRVYRL---DGTTFSHSVI---------YSCMEGYLLTGSTTRQCQANGTWS-GTAPNCTMI 2959          

HSP 5 Score: 93.9745 bits (232), Expect = 3.487e-19
Identity = 142/573 (24.78%), Postives = 203/573 (35.43%), Query Frame = 3
Query:  294 ACTANIDCWVEY----DRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGY--EDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNG---RTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTC---IVRNCGPPPEIVFAKVAYEATTHGAQAE--YKCKSRSTLIGETSFLTCGEVDNK---SGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWN-FIPRCVEAACSARPPSMKYSTVR----FLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWSPPQMPTC 1937
              TA   C + Y       + C+      G     +   C  P Q VNG          D V Y C  G+ L G   R CQ +   SG  P C   +  C      P + ++  +  + F   + V   C  GY  E P +    A+C  N +W   P  C+  +C     P N      + + N+T+ ++    CN G+ +  +            CQ  G+W      C  + C     P NG + G   T  S   + C  G QL G   R C   G+W      C       CG P             +HG++ E  ++ +S+      T ++  G  +     +G     +P     CKP Q  +       N +       D  T    V   C  GY L       C  NG+W+   P C    C    P +  + VR    F  +++ + A   C  GY   +  D   TL+         G W+  P   C+   CT PP   NG   LL  SD    T           V Y C P Y L  P I  C+ NG WS  ++P C
Sbjct: 2566 GATAIFTCDIGYMLVGSTVRECLSSGLWSGTETRCLGGHCGLPEQIVNGQVIGENFGYRDTVVYQCAPGFRLIGSSVRICQQDHNWSGQLPICVPIS--CGH----PGSPIYGRTIGNGFNLNDVVSFSCNTGYVMEGPVR----AQCQANRQWSQPPPTCKVVNCSDPGIPANSIRQSKIEHGNFTFGTVVFYDCNPGYYLFGSP--------VLTCQPTGQWDKPLPECIVVDCGHPGSPPNGVLSGEKFTFGSTVRYSCTGGRQLKGESSRTCQLNGHWSAPMPFCSGDSSGTCGDP----------GVPSHGSREESDFRIRSKVHFTCATGYVLFGSSERMCFPNGTWSGTQPS----CKPVQCGNPGT--PSNGRVYRL---DGTTFSHSVIYSCMEGYLLTGSTTRQCQANGTWSGTAPNCTMINCGD--PGVPANGVRYGEDFTIVQNITFA---CQPGY--TMEADSFPTLTCT-----GNGTWSA-PVPFCKAVTCTAPPPISNG---LLEGSDFEWGTS----------VSYSCSPGYELSFPAILTCVGNGTWS-GEVPQC 3074          

HSP 6 Score: 88.5817 bits (218), Expect = 1.342e-17
Identity = 130/529 (24.57%), Postives = 194/529 (36.67%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPEN----GEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFI-PRCVEAACS--ARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKG---PKIAVCLNGHWSPPQMPTCEFI 1946
            + C     P +G    +    G    +TC  GY L G   R C ++   SG+E  C      C     +P   V+     ++F   + V   C  G+     S  I + + N     PI C   SCG    P  GRT+  N +    +    CN G+ ++           R QCQA+ +WS     C  + C +   P N     ++     T  ++  + C  GY L GS +  C   G WD     CIV +CG P       ++ E  T G+   Y C     L GE+S  TC      +G    P P C         D   V  H + + ++F +  +      V   C  GY L       C+ NG+W+   P C    C     P + +   +   +  H  +  Y C  GY +        T ST    + N G W+      C    C  P  P NG  Y            +    + N  + + C P Y ++    P +    NG WS P +P C+ +
Sbjct: 2545 ISCGELPTPASGKKIGTQTTFGATAIFTCDIGYMLVGSTVRECLSSGLWSGTETRCLGGH--C----GLPEQIVNGQVIGENFGYRDTVVYQCAPGFRLIGSSVRICQQDHNWSGQLPI-CVPISCGHPGSPIYGRTI-GNGFNLNDVVSFSCNTGYVME--------GPVRAQCQANRQWSQPPPTCKVVNCSDPGIPANSIRQSKIEHGNFTFGTVVFYDCNPGYYLFGSPVLTCQPTGQWDKPLPECIVVDCGHPGSPPNGVLSGEKFTFGSTVRYSCTGGRQLKGESS-RTC----QLNGHWSAPMPFCSGDSSGTCGDPG-VPSHGSREESDFRIRSK------VHFTCATGYVLFGSSERMCFPNGTWSGTQPSCKPVQCGNPGTPSNGRVYRLDGTTFSHSVI--YSCMEGYLL--------TGSTTRQCQAN-GTWSGT-APNCTMINCGDPGVPANGVRY-----------GEDFTIVQN--ITFACQPGYTMEADSFPTLTCTGNGTWSAP-VPFCKAV 3019          

HSP 7 Score: 82.4185 bits (202), Expect = 1.205e-15
Identity = 88/347 (25.36%), Postives = 127/347 (36.60%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPR--KRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAIC---TAILCPELSPPENGEVMGVWN-TVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKV-AYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQ----VDSAKVYIHENNKTTNFI 1397
            + C  P  P NG        +   + + C+ GY ++        C  N   S   P C   T  C + P I    +  +    DF+ G  V   C  GYE  + +  I  C GN  W  +  +C  K CG    P +G      ++ YQS             C+       +  R CQADG WSG    C   T   C     P  G +   +   V S+  F C+ G+ L GS  R C  +  W GS   CI  NC  P       V   +   +G    Y C++   L G +    C      +G +P       L  KP +      S K+ + ++    N+I
Sbjct: 2959 INCGDPGVPANGVRYGEDFTIVQNITFACQPGYTMEADSFPTLTCTGNGTWSAPVPFCKAVT--CTAPPPISNGLLEGS----DFEWGTSVSYSCSPGYELSFPA--ILTCVGNGTWSGEVPQCLPKFCGDPGVPGHGFRE-GRSFIYQSEV--------SFSCSPPYIPVGSATRFCQADGTWSGFQPRCIEPTRTTCENPGTPRYGSMNRTFGFKVGSMVAFHCQPGHLLQGSTTRLCQADLTWSGSQPECIPHNCKQPESPPHVDVIGMDLPGYGYTLIYTCQTGFFLSGGSEHRVCRSDGTWTGKMPVCRAGSKLSEKPIKPVPGTPSPKLNVPDDVFAPNYI 3288          

HSP 8 Score: 57.3806 bits (137), Expect = 5.770e-8
Identity = 51/208 (24.52%), Postives = 80/208 (38.46%), Query Frame = 3
Query:  345 CVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRD-DFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTA 962
            CV +    G V   +   C  P  P +G       +   +V ++C   Y   G   R+CQA+   SG +P C + T      P  P    + + NR   FK G  V   CQ G+    +      C  +  W     +C   +C + E P +   +  +   Y    I  C  GF +   ++        R C++DG W+G   +C A
Sbjct: 3061 CVGNGTWSGEVPQCLPKFCGDPGVPGHGFREGRSFIYQSEVSFSCSPPYIPVGSATRFCQADGTWSGFQPRCIEPTRTTCENPGTPR---YGSMNRTFGFKVGSMVAFHCQPGHL--LQGSTTRLCQADLTWSGSQPECIPHNCKQPESPPHVDVIGMDLPGYGYTLIYTCQTGFFLSGGSEH-------RVCRSDGTWTGKMPVCRA 3256          
BLAST of C4b binding protein beta chain vs. Ensembl Cavefish
Match: CSMD1 (CUB and Sushi multiple domains 1 [Source:HGNC Symbol;Acc:HGNC:14026])

HSP 1 Score: 116.316 bits (290), Expect = 3.840e-26
Identity = 91/305 (29.84%), Postives = 123/305 (40.33%), Query Frame = 3
Query:  336 AQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNR--DDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPK----NGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAI---LCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKC 1223
             ++C  D    G   + + + C  P  P NG  N S   + D V +TC SGY L G  +  C+ N + S   P C  +   C S P      V  ++ R  + F     V   C+ G+     S +  + NG  W     KC   SCG    P      GR   N    + S             C+  +    N  RQCQ DG+WSG    C+ +   LC +   P +G  +G    V S+  F C+ GY L GS  R C + G+W G    C V  CG PP I F KV       G+   Y C
Sbjct: 2679 VRICQQDHRWSGQAPVCVPITCGHPGNPSNGRTNGSEFNLNDVVNFTCSSGYVLHGTSRAQCRMNGQWSNPLPVC--KVVNC-SDPGFVENAVRHSAQRYPESFSYTHSVMFHCKRGFYLLGSSVLTCQSNG-LWDRSLPKCLFISCGDPGTPPFAVLTGRKFTNGALVHYS-------------CSQGRTVVGNSTRQCQEDGRWSGSPPYCSGMNPGLCGDPGVPPHGSRLGEEFRVRSLLRFTCEAGYVLLGSAERTCLQNGSWSGVQPVCEVITCGQPPAIRFGKVEGSDLQWGSSVAYSC 2966          

HSP 2 Score: 103.99 bits (258), Expect = 2.242e-22
Identity = 101/400 (25.25%), Postives = 155/400 (38.75%), Query Frame = 3
Query:  453 VGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIK-----TFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIA 1634
            +G QV  +C  GY L G R   C  N    G E + + +T  C S    P T  H + +   ++  + V   C  G+     S  I + + + W      C   +CG   +P NGRT   + +    +    C+ G+ +  T+        R QC+ +G+WS    +C  + C +    EN           S        F CK G+ L GS +  C   G WD S   C+  +CG P    FA +     T+GA   Y C    T++G ++   C E    SG      P       P       V  H +       + +E    + +R  C  GY L       C  NGSW+ +    E     +PP++++  V    L+  S   Y C  GY ++
Sbjct: 2600 LGAQVMLSCTPGYYLGGRRTIKCLPNATWGGLEEKSSCKTGHCDSPD--PITNGHISGDGSSYR--DTVVYQCNLGFRLIGTSVRICQQD-HRWSGQAPVCVPITCGHPGNPSNGRTN-GSEFNLNDVVNFTCSSGYVLHGTS--------RAQCRMNGQWSNPLPVCKVVNCSDPGFVENAVRHSAQRYPESFSYTHSVMFHCKRGFYLLGSSVLTCQSNGLWDRSLPKCLFISCGDPGTPPFAVLTGRKFTNGALVHYSCSQGRTVVGNST-RQCQEDGRWSG-----SPPYCSGMNPGLCGDPGVPPHGSR------LGEEFRVRSLLRFTCEAGYVLLGSAERTCLQNGSWSGVQPVCEVITCGQPPAIRFGKVEGSDLQWGSSVAYSCFDGYQLS 2973          

HSP 3 Score: 92.4337 bits (228), Expect = 8.909e-19
Identity = 89/333 (26.73%), Postives = 128/333 (38.44%), Query Frame = 3
Query:  399 CQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAIL---CPELSPPENGEVMGVWN-TVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKV-AYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLP--KPEPKCLLHCKPFQVDSAKVYIHE 1373
            C  P  P +G        V   + +TC++GY L G  +R C  N   SG +P C  +   C   P I + +V  +    D + G  V   C +GY+    S  IA C GN  W+ +  +C    CG    P  G     N++TY+S    +C   F +  +         RR CQ DG W+G    C       C +   P  G  +      V S   F+C++ Y + GS  R C     W G    C+   C  P       V A +  T G    Y C+    L G +   TC      SG  P  K     ++    F ++S     +E
Sbjct: 2882 CGDPGVPPHGSRLGEEFRVRSLLRFTCEAGYVLLGSAERTCLQNGSWSGVQPVC--EVITCGQPPAIRFGKVEGS----DLQWGSSVAYSCFDGYQ--LSSPGIATCEGNGTWRGEIPQCLPVLCGDPGTPAEGYRE-GNHFTYKSEVAFYCRSPFLLVGSP--------RRVCQEDGSWTGIQPSCIDPAYNACKDPGTPAYGIPLQAQGFEVGSKVFFRCRKNYHILGSTTRTCLENLTWSGMQPECVAHACRQPETPSHVDVRAIDLPTLGYTLMYMCQDGFFLAGGSEHRTCRPDGRWSGKPPVCKASDTLIVPADVFSLNSGWTGFYE 3197          

HSP 4 Score: 73.559 bits (179), Expect = 6.234e-13
Identity = 117/518 (22.59%), Postives = 190/518 (36.68%), Query Frame = 3
Query:  456 GDQVEYTCKSGYALKGPRKRYCQ--ANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKC-NGNEWK--YDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQ--CTTDQFEDKNCRRQCQADGKWSG--DTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKC-LLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGSWN-FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNK-GNWTKMPT--EGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWSPPQMPTCEFIMHDELP 1964
            G +++Y C  GY L G R   C+   N       P    Q   C     +P +  + + +   +  G +V+  C  GY+    + + A C     W     P +C    C  +E      +M + +  ++ I+      G ++   CT   +       +C  +  W G  + + C    C    P  NG + G  ++      ++C  G++L G+ +R C ++  W G    C+   CG P      +             + C S   L G TS   C      +G    P P C +++C     D   V     +    +      TH      K  F Y L S +L    NG W+  +P+C+  +C   P +  ++ +      + +L  Y C  G  +     G  T       +C + G W+  P    G  P  C  P  P +G    LG+  R R            ++++ C   Y L G     CL NG WS  Q P CE I   + P
Sbjct: 2472 GSRIQYYCNPGYRLVGQRNATCRLHPNGLYQWDTPAPLCQAISC----GVPDSPANGSFHGLQYTVGSNVQYQCDEGYQPESAALLSAVCLEDGTWSNAARPTQCLPVQCPNIE------SMLSEHMVWRLISGSLNELGAQVMLSCTPGYYLGGRRTIKCLPNATWGGLEEKSSCKTGHCDSPDPITNGHISGDGSSYRDTVVYQCNLGFRLIGTSVRICQQDHRWSGQAPVCVPITCGHPGNPSNGRTNGSEFNLNDVVNFTCSSGYVLHG-TSRAQC----RMNGQWSNPLPVCKVVNCS----DPGFVENAVRHSAQRYPESFSYTHSVMFHCKRGF-YLLGSSVLTCQSNGLWDRSLPKCLFISC-GDPGTPPFAVLTGRKFTNGALVHYSCSQGRTVV----GNSTR------QCQEDGRWSGSPPYCSGMNPGLCGDPGVPPHGS--RLGEEFRVR-----------SLLRFTCEAGYVLLGSAERTCLQNGSWSGVQ-PVCEVITCGQPP 2944          
BLAST of C4b binding protein beta chain vs. Ensembl Cavefish
Match: csmd2 (CUB and Sushi multiple domains 2 [Source:ZFIN;Acc:ZDB-GENE-030616-39])

HSP 1 Score: 112.079 bits (279), Expect = 7.029e-25
Identity = 122/502 (24.30%), Postives = 184/502 (36.65%), Query Frame = 3
Query:  396 QCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAK-CNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTY-QSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFI-PRCVEAACS--ARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIA-------LRKDGMETLSTIFDIKCNK------GNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRV 1841
            +C  P  PV+G         G  V ++C+ GY L+G  +R C  N    G++PEC   +      P     Q HD            +   C+ GY   Y + ++ + C  N  W  D  +C   +CG    P NG  +  +++TY +S++ Q C+ GF +        D+     C  D  W+    +C AI+C       NG+VMG      S  ++ C +GYQL    +  C   GNW G    C    CG P      +      T+ +   + C     L+G T            G     +P C+       VD         N T  + +      G+ V   C  GY L   I   C  N +W+ + P C+   CS    P       +   SL +  +  Y C  G+Y+A        R DG  T         N+      G   + P    Q        +   G    LG+     L+  + +P  NRV
Sbjct: 2897 RCGDPGIPVHGIRLGEEFSSGSVVRFSCEPGYVLRGSSERTCLPNGTWQGTQPECQVVSCGNPGTPRNAQIQFHDG-----LVFSRSITYACREGY---YSTGLLTRHCTVNGTWTGDMPECTVINCGDPGVPANGLRL-GSDFTYSRSVSFQ-CSPGFTMDA------DRASTLICTKDRTWNSTKPVCKAIVCGAPPSIPNGQVMGTDFQWGSSISYTCNQGYQLSLPTILTCQGSGNWSGEKPQCFPVFCGDPGIPAQGRREDRGFTYLSSVSFSCFPPLVLVGSTR-----RYCQYDGTWSGTQPSCIDPSHTSCVDPGTPLFGYQNNTQGYQI------GSTVFYSCRKGYLLLGSISRTCLPNLTWSGMQPECIAHHCSQPELPAQADARAIELPSLGYTLI--YTCQPGFYLAGGSEHRTCRADGSWTGKPPLCAADNRPSGKTVGTVQEPPNTKLQGNGVFAKNSLWRGSYEYLGKKQPAMLSITAFEPFSNRV 3369          

HSP 2 Score: 105.916 bits (263), Expect = 5.588e-23
Identity = 107/431 (24.83%), Postives = 176/431 (40.84%), Query Frame = 3
Query:  417 PVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCN---------------GNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENG--EVMGVWNTVNSIKT---FKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFI-PRCVEAACSARPPSMKYSTVRFLSLKHDSLA-----RYYCHFGYY 1628
            P NG+   ++ + G    ++C +GY L G R R C +N   SGSE +C     L  +  ++ ++      + D   NG+   II +N Y   Y+  ++ +CN                + W      C   +CG   +P NG T + N +    +    CN G+ +Q           +  CQ +G+WS     C  + C E    EN   +V+       S +T   + C  GY L G+ +  C  +G WD S   C++  C  P    +A+++ +  T G+   Y C  + +++G T+ +   ++D +  W   P      HC     DS+              + +E + G+ VR  C  GY L       C  NG+W    P C   +C   P + + + ++F    HD L       Y C  GYY
Sbjct: 2592 PPNGNKIGTLTVYGATAIFSCNTGYTLVGTRVRECMSNGLWSGSEVQCLGHHLLVCA--WVFFSLAGHCGSPDPIVNGQ---IIGEN-YN--YRGSVVYQCNPGFRLIGVSVRICEQDHRWSGKAPVCVPITCGHPGNPANGVT-HGNQFNLNDVVRFACNTGYVLQGAV--------KSHCQPNGQWSNALPRCKIVNCTEPGHVENSVRQVLSSGPHRYSFQTTVSYTCNPGYYLLGTSILTCQGDGTWDRSLPKCLLVLCDHPSMPPYAQISGDRRTVGSVIRYSCMGQRSIVGNTTRMC--QLDGQ--WSGSPP-----HCT---GDSSGRCGDPGIPVHGIRLGEEFSSGSVVRFSCEPGYVLRGSSERTCLPNGTWQGTQPECQVVSC-GNPGTPRNAQIQF----HDGLVFSRSITYACREGYY 2988          

HSP 3 Score: 96.6709 bits (239), Expect = 4.895e-20
Identity = 137/596 (22.99%), Postives = 205/596 (34.40%), Query Frame = 3
Query:  399 CQPPVQPVNGHA-NHSILLVGDQVEYTCKSGYALKGPRKRYC----QANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNG---------RTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWS--GDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTC--------------IVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSW-NFIPRCVEAACSARPPSMKYSTVRFLS-----LKHDSLARYYCHFGYY------IALRKDGM--ETLSTIFDIKCNKGNWTKMP----TEGCQXXXXXXXXXXXNGEIYLLGQSDRT--------------------RLTDKSIKPIH----------NRVVKYECHPLYRLKGPKIAVCL-NGHWSPPQMPTCEFI 1946
            C PP  PVNG   + +   +G  + ++C  G+ L G     C    Q   + +   P C  Q   C     +P   V+ +    DF  G  V   C  G+       +   C     ++ P++   + C  +  P  G         R +Y     Y+++ +  C+ G+        F       +CQA   W        C  I C +L  P NG  +G      +   F C  GY L G+ +R+C   G W GS   C              +  +CG P  IV  ++  E   +     Y+C     LIG  S   C +    SG  P         C P          H  N        ++      VR  CN GY L   +   C  NG W N +PRC    C+  P  ++ S  + LS         +   Y C+ GYY      +  + DG    +L     + C+      MP      G +    +       G+  ++G + R                     R  D  I P+H            VV++ C P Y L+G     CL NG W   Q P C+ +
Sbjct: 2396 CSPPNPPVNGSVHSQTGTKLGSTLRFSCDQGFRLIGQSSATCTRSPQGIYQWNAPVPLC--QVVSC----GMPIAPVNGSVVGQDFTLGSRVTFRCNPGFRLANTVPLSTVCQ-ESGRWTPVETPPR-CIPVTCPDIGHSAVEHGRWRLIYGMQNQYEAMMMLTCDPGY--------FYKGQRVIRCQASSAWDYPEPRPACEIISCGDLGTPPNGNKIGTLTVYGATAIFSCNTGYTLVGTRVRECMSNGLWSGSEVQCLGHHLLVCAWVFFSLAGHCGSPDPIVNGQIIGENYNYRGSVVYQCNPGFRLIG-VSVRICEQDHRWSGKAPV--------CVPITCG------HPGNPANGVTHGNQFNLNDVVRFACNTGYVLQGAVKSHCQPNGQWSNALPRCKIVNCT-EPGHVENSVRQVLSSGPHRYSFQTTVSYTCNPGYYLLGTSILTCQGDGTWDRSLPKCLLVLCDH---PSMPPYAQISGDRRTVGSVIRYSCMGQRSIVGNTTRMCQLDGQWSGSPPHCTGDSSGRCGDPGI-PVHGIRLGEEFSSGSVVRFSCEPGYVLRGSSERTCLPNGTWQGTQ-PECQVV 2954          

HSP 4 Score: 92.8189 bits (229), Expect = 7.890e-19
Identity = 109/452 (24.12%), Postives = 169/452 (37.39%), Query Frame = 3
Query:  336 AQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNG-------EDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICT---AILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAY-EATTHGAQAEYKCKSRSTLIGETSFLT--CGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSD---ILPACYNGSWNFI-PRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIAL 1637
             ++C  D    G   + + + C  P  P NG  + +   + D V + C +GY L+G  K +CQ N + S + P C  +   C    ++      +NS R    +G         V   C  GY     S  I  C G+  W     KC    C     P   + +  +  T  S+         +  C   +    N  R CQ DG+WSG    CT   +  C +   P +G  +G   +  S+  F C+ GY L GS  R C   G W G+   C V +CG P     A++ + +         Y C+        T  LT  C      +G +P+        C         V            +  + T+   V  +C+ G+ +++D    L    + +WN   P C    C A PPS+    V     +  S   Y C+ GY ++L
Sbjct: 2695 VRICEQDHRWSGKAPVCVPITCGHPGNPANGVTHGNQFNLNDVVRFACNTGYVLQGAVKSHCQPNGQWSNALPRC--KIVNCTEPGHV------ENSVRQVLSSGPHRYSFQTTVSYTCNPGYYLLGTS--ILTCQGDGTWDRSLPKCLLVLCDHPSMPPYAQ-ISGDRRTVGSV--------IRYSCMGQRSIVGNTTRMCQLDGQWSGSPPHCTGDSSGRCGDPGIPVHGIRLGEEFSSGSVVRFSCEPGYVLRGSSERTCLPNGTWQGTQPECQVVSCGNPGTPRNAQIQFHDGLVFSRSITYACREGYY---STGLLTRHCTVNGTWTGDMPE--------CTVINCGDPGV------PANGLRLGSDFTYSRSVSFQCSPGFTMDADRASTLICTKDRTWNSTKPVCKAIVCGA-PPSIPNGQVMGTDFQWGSSISYTCNQGYQLSL 3109          

HSP 5 Score: 79.7221 bits (195), Expect = 8.599e-15
Identity = 136/560 (24.29%), Postives = 190/560 (33.93%), Query Frame = 3
Query:  381 MEIDLQCQPPVQPVNGHA----NHSILLVGDQVEY------TCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKN--GEDVKIICQNGYEDPYKSHIIAKCNGNE-WKYDPIKCE--------------KKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEI------VFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFIPRCVEAACSAR--PPSMKYSTVRF-LSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCEFI 1946
            +E   +C P   P  GH+        L+ G Q +Y      TC  GY  KG R   CQA+      EP    +   C      P      N N+       G      C  GY        + +C  N  W    ++C                  CG  +   NG+ +   NY Y+   +  CN GF++   +         R C+ D +WSG   +C  I C     P NG   G    +N +  F C  GY L G+    C   G W  +   C + NC  P  +      V +   +  +       Y C     L+G TS LTC       G   +  PKCLL           +  H +      I  D  T G+ +R  C     +  +    C  +G W+  P       S R   P +    +R        S+ R+ C  GY   LR     T           G W     E CQ   C  P TP+N +I         +  D     + +R + Y C   Y   G     C +NG W+   MP C  I
Sbjct: 2510 VETPPRCIPVTCPDIGHSAVEHGRWRLIYGMQNQYEAMMMLTCDPGYFYKGQRVIRCQASSAWDYPEPRPACEIISCGDLGTPP------NGNKIGTLTVYGATAIFSCNTGYT--LVGTRVRECMSNGLWSGSEVQCLGHHLLVCAWVFFSLAGHCGSPDPIVNGQII-GENYNYRGSVVYQCNPGFRLIGVS--------VRICEQDHRWSGKAPVCVPITCGHPGNPANGVTHGNQFNLNDVVRFACNTGYVLQGAVKSHCQPNGQWSNALPRCKIVNCTEPGHVENSVRQVLSSGPHRYSFQ-TTVSYTCNPGYYLLG-TSILTC----QGDGTWDRSLPKCLL----------VLCDHPSMPPYAQISGDRRTVGSVIRYSCMGQRSIVGNTTRMCQLDGQWSGSPPHCTGDSSGRCGDPGIPVHGIRLGEEFSSGSVVRFSCEPGY--VLRGSSERTC-------LPNGTWQGTQPE-CQVVSCGNPGTPRNAQI---------QFHDGL---VFSRSITYACREGYYSTGLLTRHCTVNGTWT-GDMPECTVI 3013          
BLAST of C4b binding protein beta chain vs. Ensembl Cavefish
Match: csmd3a (CUB and Sushi multiple domains 3a [Source:ZFIN;Acc:ZDB-GENE-050419-118])

HSP 1 Score: 104.76 bits (260), Expect = 1.463e-22
Identity = 138/534 (25.84%), Postives = 202/534 (37.83%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYAL--KGPRKRYCQANLRLSGSE--PECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNE-WKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCG----PPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWN-FIPRC---VEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWT-KMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWSPPQMPTCEFI 1946
            + C  PV P NG    +    G +  Y C  G+ L  K      CQA+   S     P CT       S   +P T  +          G      C  GY        + +C  +  W      C    CG+ E   NG+ +   N+ Y+   +  CN GF++  ++         R CQ D  WSG    C ++ C     P  G  +G    +N +  F C +GY L G    +C  +  W     +C V NC     P   I  +K+ +   T G    + C     L G  S LTC  +    G+  +P P+C+      +VD      H        ++ D+ T G+ VR  C  G EL  D    C  +G W+  +P C   V   C   P +  ++T    S +  S  R+ C  G+ +    +          I    G W+ + PT  C+P  C  P +P NG +        +R+   S     +  V Y C   YRL G    +CL NG WS  + P C  I
Sbjct: 2433 VSCGIPVAPGNGGVLAADYSAGTRATYFCNEGFRLSSKEVTSTVCQADGTWSSHNKIPRCT-----VISCGILP-TPPNGKKIGTQTTFGATAIFTCDAGYI--LVGSTVRECLASGLWSGTETSCLAGHCGEPERMVNGQVI-GENFGYRDTVVYQCNPGFRLIGSS--------VRICQQDHTWSGHLPSCVSVSCGHPGSPIYGRTVGDGFNLNDVVNFFCNDGYILEGPSQAQCQADRQWSQQPPSCRVVNCTDPGIPANSIRKSKIEFGNFTFGTVVSFDCNPGFYLFG-ASVLTCQPL----GYWDRPLPECI------EVDCG----HPGVPPHGALIGDKFTFGSAVRYTCTGGRELIGDQGRTCQLSGQWSGSLPHCSGDVAGEC-GDPGTPAHATREEGSFQLRSKVRFTCATGHTLYGSAE---------RICFPNGTWSGRQPT--CKPVHCGNPGSPPNGRV--------SRIDGTSF----SHSVVYSCVDGYRLSGSPTRLCLANGTWSGSE-PNCTLI 2909          

HSP 2 Score: 104.375 bits (259), Expect = 1.911e-22
Identity = 94/337 (27.89%), Postives = 137/337 (40.65%), Query Frame = 3
Query:  657 VKIICQNGYEDPYKSHIIAKCNGNE-----WKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAI--CTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFIP---RCVEAACSARPP-SMKYSTVRFLSLKHDSLARYYCHFGYYI 1631
            V+  C  GY+   KS  +A C   E     W      C+  SCG    P NG  +   +Y+  + A  FCN+GF++         +     CQADG WS    I  CT I C  L  P NG+ +G   T  +   F C  GY L GS +R+C   G W G+ ++C+  +CG P  +V  +V  E   +     Y+C     LIG +S   C +    SG LP         C           I+       F ++D V         CN GY L       C  +  W+  P   R V       P  S++ S + F +    ++  + C+ G+Y+
Sbjct: 2395 VRWACDRGYKLIGKS--MAVCRKTEFGFLTWDNSVPACQAVSCGIPVAPGNGGVL-AADYSAGTRATYFCNEGFRLS------SKEVTSTVCQADGTWSSHNKIPRCTVISCGILPTPPNGKKIGTQTTFGATAIFTCDAGYILVGSTVRECLASGLWSGTETSCLAGHCGEPERMVNGQVIGENFGYRDTVVYQCNPGFRLIG-SSVRICQQDHTWSGHLPS--------CVSVSCGHPGSPIYGRTVGDGFNLNDVVNF------FCNDGYILEGPSQAQCQADRQWSQQPPSCRVVNCTDPGIPANSIRKSKIEFGNFTFGTVVSFDCNPGFYL 2707          

HSP 3 Score: 93.5893 bits (231), Expect = 4.133e-19
Identity = 106/478 (22.18%), Postives = 165/478 (34.52%), Query Frame = 3
Query:  378 CMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECT-DQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQF---------EDKNCR-------------------------------------------RQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-----YNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYY-CHFGYYIA 1634
            C+E+D  C  P  P +G         G  V YTC  G  L G + R CQ + + SGS P C+ D    C      P T  H       F+    V+  C  G+     +  I   NG  W      C+   CG    P NGR    +  ++    +  C DG+++  +  +           + NC                                            R C  +G WSG    C A+ CP      +GEV G      S   ++C  GY+L  S    C   G+W G    C+ + CG P     AK   ++    ++  Y C +   L+G ++      +    G     +P+C+   +    +         N +  F +      G+ VR  C  G+ L       C     ++GS    P C+  +C  +P S  ++ V  + L        Y C  G+ + 
Sbjct: 2728 CIEVD--CGHPGVPPHGALIGDKFTFGSAVRYTCTGGRELIGDQGRTCQLSGQWSGSLPHCSGDVAGECGD----PGTPAHATREEGSFQLRSKVRFTCATGHTLYGSAERICFPNGT-WSGRQPTCKPVHCGNPGSPPNGRVSRIDGTSFSHSVVYSCVDGYRLSGSPTRLCLANGTWSGSEPNCTLISCGDPGIPANGLRFGETFTIGHNVSYACQPGYLMENATSNTRTCTHNGTWSGTLPTCQAVTCPPPPSLAHGEVEGSVFQWGSSVGYRCLTGYELSFSAALTCVANGSWSGEVPLCMPKFCGDPGLPPQAKREGQSFIFKSEVLYSCSTPYLLVGSST-----RICQADGTWSGNQPRCIEPTRTTCENPGTPEYGSLNASLGFKV------GSTVRFHCQTGHLLLGSTTRTCQQDLTWSGSQ---PECIAHSCK-QPRSPPHANVLGMDLPAFGYTLLYSCQPGFMLT 3183          

HSP 4 Score: 92.8189 bits (229), Expect = 6.511e-19
Identity = 82/310 (26.45%), Postives = 120/310 (38.71%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRK--RYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAIC---TAILCPELSPPENGEV-MGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKV-AYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLP 1301
            + C  P  P NG        +G  V Y C+ GY ++      R C  N   SG+ P C  Q   C   P + + +V  +     F+ G  V   C  GYE  + + +    NG+ W  +   C  K CG    P   +     ++ ++S  +          C+T      +  R CQADG WSG+   C   T   C     PE G +   +   V S   F C+ G+ L GS  R C ++  W GS   CI  +C  P     A V   +    G    Y C+    L G +    C    + +G +P
Sbjct: 2909 ISCGDPGIPANGLRFGETFTIGHNVSYACQPGYLMENATSNTRTCTHNGTWSGTLPTC--QAVTCPPPPSLAHGEVEGSV----FQWGSSVGYRCLTGYELSFSAALTCVANGS-WSGEVPLCMPKFCGDPGLPPQAKRE-GQSFIFKSEVL--------YSCSTPYLLVGSSTRICQADGTWSGNQPRCIEPTRTTCENPGTPEYGSLNASLGFKVGSTVRFHCQTGHLLLGSTTRTCQQDLTWSGSQPECIAHSCKQPRSPPHANVLGMDLPAFGYTLLYSCQPGFMLTGGSEHRVCRPDGSWTGKVP 3202          

HSP 5 Score: 92.8189 bits (229), Expect = 7.662e-19
Identity = 108/447 (24.16%), Postives = 169/447 (37.81%), Query Frame = 3
Query:  336 AQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPEC--TDQTDLCFSAPYIPYTQVHDNS-NRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPEL----SPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVA-YEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKC-LLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYEL---NSDILPACYNGSWN-FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIAL 1637
             ++C  D    G +   + + C  P  P+ G        + D V + C  GY L+GP +  CQA+ + S   P C   + TD     P IP   +  +     +F  G  V   C  G+     S +  +  G  W     +C +  CG    P +G  +  + +T+ S     C  G ++    DQ       R CQ  G+WSG    C+  +  E     +P       G +   + ++ F C  G+ L+GS  R C   G W G   TC   +CG P      +V+  + T+      Y C     L G  + L        +G     EP C L+ C    + +  +   E             T G +V   C  GY +    S+     +NG+W+  +P C    C   PPS+ +  V     +  S   Y C  GY ++ 
Sbjct: 2592 VRICQQDHTWSGHLPSCVSVSCGHPGSPIYGRTVGDGFNLNDVVNFFCNDGYILEGPSQAQCQADRQWSQQPPSCRVVNCTD-----PGIPANSIRKSKIEFGNFTFGTVVSFDCNPGFYLFGASVLTCQPLG-YWDRPLPECIEVDCGHPGVPPHG-ALIGDKFTFGSAVRYTCTGGREL--IGDQ------GRTCQLSGQWSGSLPHCSGDVAGECGDPGTPAHATREEGSFQLRSKVR-FTCATGHTLYGSAERICFPNGTWSGRQPTCKPVHCGNPGSPPNGRVSRIDGTSFSHSVVYSCVDGYRLSGSPTRLCL-----ANGTWSGSEPNCTLISCGDPGIPANGLRFGET-----------FTIGHNVSYACQPGYLMENATSNTRTCTHNGTWSGTLPTCQAVTCPP-PPSLAHGEVEGSVFQWGSSVGYRCLTGYELSF 3005          

HSP 6 Score: 60.8474 bits (146), Expect = 5.621e-9
Identity = 49/214 (22.90%), Postives = 81/214 (37.85%), Query Frame = 3
Query:  321 VEYDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIP-YTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAIC 956
            + +  A  CV +    G V + +   C  P  P          +   +V Y+C + Y L G   R CQA+   SG++P C + T      P  P Y  ++ +     FK G  V+  CQ G+           C  +  W     +C   SC +   P +   +  +   +    +  C  GF +   ++        R C+ DG W+G   +C
Sbjct: 3003 LSFSAALTCVANGSWSGEVPLCMPKFCGDPGLPPQAKREGQSFIFKSEVLYSCSTPYLLVGSSTRICQADGTWSGNQPRCIEPTRTTCENPGTPEYGSLNASLG---FKVGSTVRFHCQTGHL--LLGSTTRTCQQDLTWSGSQPECIAHSCKQPRSPPHANVLGMDLPAFGYTLLYSCQPGFMLTGGSEH-------RVCRPDGSWTGKVPVC 3204          
BLAST of C4b binding protein beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003364.1 (pep scaffold:Pmarinus_7.0:GL476462:338772:355022:-1 gene:ENSPMAG00000003078.1 transcript:ENSPMAT00000003364.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.612 bits (270), Expect = 4.772e-25
Identity = 133/526 (25.29%), Postives = 208/526 (39.54%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLV-GDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQ------LHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPE-----PKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNG-SW-NFIPRCVEAACSARPPSMKYSTVRFLSLK-HDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLN-GHWS 1916
            + + C+  V+P NG  + +   V G    Y C  GY+L GP+ R C  +   S  +P C   +  C   P +  + V   + +  F  G+ V   C++G+    ++HI    +G  W   P KC  + CG    P++GR +  +++T    A   C+ G+KI          +    C +DG+WS     C  + C    P  NG   G   T   + T+ C EG +      +  + +  C   G W G   TC  +    PP      VA          +Y    R T+       T G   +++   P        P+C+          AK     +     FI +DEVT GT V   CN GY+L       C    +W + IP C    C A P  +++  V   ++    S A Y C  G+ +  ++           +  + G W+      C   KC  P   ++GE+ +    DR  L         NRV+ Y CH    L+GP + +C + G WS
Sbjct:   74 VLVTCKVLVEPENGFISVATEPVYGSVASYMCADGYSLVGPQLRRCMQDGIWSDIDPVCEALS--CPQPPDVANSAVVQMA-QGTFSLGDSVMYACRDGFSISGEAHITCLESGI-WSKPP-KCIDEDCGNPGSPRHGR-LEGSSFTEGDSATFVCDIGYKIG------GKDHINTTCDSDGRWSRPLQDCELLSCGSPQPILNGRWTGNL-TYGQVITYSCNEGVKFSDGIMVESTSIVVCQANGLWLGRPPTCERKQTCAPPLPRTHSVASLPPVKTLGRQYPGSPRGTVASLPPVKTSGRQQSETQKCPHTGLLGRFPRCV------TTRLAKTCPALSAPRDGFIENDEVTVGTVVIFGCNKGYKLAGKPTTECQPSLTWSSSIPSCQMVTCRAAP--LEHGRVNVTAVTPFGSAAAYDCDLGFVLVGQR---------VRVCLDTGEWSGS-NPHCHRIKCKTPLELQHGEVVV----DRENL---------NRVI-YVCHEGLVLEGPNVRMCTDAGTWS 554          

HSP 2 Score: 71.2478 bits (173), Expect = 3.879e-13
Identity = 83/333 (24.92%), Postives = 125/333 (37.54%), Query Frame = 3
Query:  630 RDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVM----GVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKC-LLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYY 1610
            R  F   E V   C  GY     S+ I +C    W      C   +C  L +P+NG         Y S+A   C DG+ +     Q       R+C  DG WS    +C A+ CP+     N  V+    G ++  +S+  + C++G+ + G     C   G W      CI  +CG P      ++   + T G  A + C     + G+    T  + D +  W  +P   C LL C   Q       I     T N      +T+  +   K + G  + S  +  C  NG W   P   E   +  PP  +  +V  L     +L R Y
Sbjct:   33 RQWFFLQELVSYHCNIGYTVSGFSYSI-RCVEGGWTKHKFSCVLVTCKVLVEPENGFISVATEPVYGSVASYMCADGYSL--VGPQL------RRCMQDGIWSDIDPVCEALSCPQPPDVANSAVVQMAQGTFSLGDSV-MYACRDGFSISGEAHITCLESGIWS-KPPKCIDEDCGNPGSPRHGRLEGSSFTEGDSATFVCDIGYKIGGKDHINTTCDSDGR--W-SRPLQDCELLSCGSPQ------PILNGRWTGNLTYGQVITYSCNEGVKFSDGIMVESTSIVVCQANGLWLGRPPTCERKQTCAPPLPRTHSVASLP-PVKTLGRQY 344          

HSP 3 Score: 62.7734 bits (151), Expect = 1.609e-10
Identity = 67/272 (24.63%), Postives = 110/272 (40.44%), Query Frame = 3
Query:  921 ADGKWSGDTAICTAILCPELSPPENGEVMGVWNTV-NSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEAT---THGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSD--ILPAC-YNGSWNF-IPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMP 1712
             +G W+     C  + C  L  PENG +      V  S+ ++ C +GY L G  LR+C ++G W   +  C   +C  PP++  + V   A    + G    Y C+   ++ GE + +TC E    SG   KP PKC+         +     H   + ++F   D  T        C+ GY++     I   C  +G W+  +  C   +C +  P +        +L +  +  Y C+ G   +   DG+   ST   +    G W   P
Sbjct:   62 VEGGWTKHKFSCVLVTCKVLVEPENGFISVATEPVYGSVASYMCADGYSLVGPQLRRCMQDGIWSDIDPVCEALSCPQPPDVANSAVVQMAQGTFSLGDSVMYACRDGFSISGE-AHITCLE----SGIWSKP-PKCIDE----DCGNPGSPRHGRLEGSSFTEGDSATF------VCDIGYKIGGKDHINTTCDSDGRWSRPLQDCELLSCGSPQPILNGRWTG--NLTYGQVITYSCNEGVKFS---DGIMVESTSIVVCQANGLWLGRP 312          

HSP 4 Score: 53.1434 bits (126), Expect = 1.574e-7
Identity = 77/320 (24.06%), Postives = 127/320 (39.69%), Query Frame = 3
Query: 1014 WNTVNSIKTFKCKEGYQLHG-SHLRKCTREGNWDGSNSTCIVRNCG--PPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYR------LKGPKIAVC-LNGHWSPPQMPTCE 1940
            W  +  + ++ C  GY + G S+  +C  EG W     +C++  C     PE  F  VA E   +G+ A Y C    +L+G      C     + G     +P C     P   D A   + +  + T F + D V +       C  G+ ++ +    C  +G W+  P+C++  C   P S ++  +   S      A + C  GY I     G + ++T  D   + G W++ P + C+   C  P    NG           R T       + +V+ Y C+   +      ++   I VC  NG W   + PTCE
Sbjct:   35 WFFLQELVSYHCNIGYTVSGFSYSIRCV-EGGWTKHKFSCVLVTCKVLVEPENGFISVATEP-VYGSVASYMCADGYSLVGP-QLRRC----MQDGIWSDIDPVCEALSCPQPPDVANSAVVQMAQGT-FSLGDSVMYA------CRDGFSISGEAHITCLESGIWSKPPKCIDEDC-GNPGSPRHGRLEGSSFTEGDSATFVCDIGYKIG----GKDHINTTCD---SDGRWSR-PLQDCELLSCGSPQPILNG-----------RWTGNL---TYGQVITYSCNEGVKFSDGIMVESTSIVVCQANGLWL-GRPPTCE 316          

HSP 5 Score: 47.7506 bits (112), Expect = 7.035e-6
Identity = 43/167 (25.75%), Postives = 65/167 (38.92%), Query Frame = 3
Query:  633 DDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTC 1130
            D+   G  V   C  GY+   K     +C  +  W      C+  +C +    ++GR        + S A   C+ GF +             R C   G+WSG    C  I C      ++GEV+     +N +  + C EG  L G ++R CT  G W G+   C
Sbjct:  406 DEVTVGTVVIFGCNKGYKLAGKP--TTECQPSLTWSSSIPSCQMVTC-RAAPLEHGRVNVTAVTPFGSAAAYDCDLGFVLV--------GQRVRVCLDTGEWSGSNPHCHRIKCKTPLELQHGEVVVDRENLNRV-IYVCHEGLVLEGPNVRMCTDAGTWSGTEPKC 560          
BLAST of C4b binding protein beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001629.1 (pep scaffold:Pmarinus_7.0:GL476369:34656:293612:-1 gene:ENSPMAG00000001441.1 transcript:ENSPMAT00000001629.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.9005 bits (237), Expect = 1.499e-20
Identity = 95/416 (22.84%), Postives = 158/416 (37.98%), Query Frame = 3
Query:  399 CQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNG-SWNFI-PRCVEAACS--ARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIA 1634
            C  P  PV+G  +   + V   + + C  GY L+G R+R C      SG++P+C      C   P +P      +S+   F +   V   C +GY+    S  +   NG  W      C   +CG+     NG  +  +++T+       CN G++I          +  R C  DG WSG   +C  I C +     NG ++G   +  +  ++ C  GY+        C   G W G    C+   CG P      K   +     A   + C     L+G +S   C      SG     +P+C+   +   ++       E N T  + +   V+       +C  G+ +       C +  +W+   P C+  +C     P +     V    L +  +  Y C  G+Y+A
Sbjct: 2896 CGDPGIPVHGFRSADDVRVRSTIRFYCAEGYVLRGSRERVCNPGGVWSGTQPDC--HAVWC-GNPGVPAGGSILHSDGVVFSS--SVTYACWDGYQMSGLSTRLCSANGT-WTGVLPNCTVFNCGEPGTVANGVRI-GSDFTFGHNITYHCNPGYRID------PHHSSTRVCGKDGAWSGSLPLCRVITCRQPPRVVNGRLLGSDFSWGASVSYSCSSGYEPSFPATLTCEGNGTWRGDVPQCLPVFCGDPGTPAEGKREGKRFIFEADVSFSCNPPLVLVG-SSLRACRADRTWSG----TQPRCIDPSQTMCLNPGTPQFGEQNITQGYQVDSTVSF------RCQKGFHIQGSTTRTCLSDLTWSGTQPECISHSCKQLETPENADVGAVELPGLGYTLM--YSCQPGFYLA 3285          

HSP 2 Score: 92.4337 bits (228), Expect = 1.774e-19
Identity = 104/427 (24.36%), Postives = 157/427 (36.77%), Query Frame = 3
Query:  378 CMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPEC--TDQTDLCFSAPYIPYTQVHDNS-NRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTA---ILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAY-EATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELN---SDILPACYNGSWN-FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGY 1625
            C+ + + C  P  PV+G    +     D V +TC +GY  +G     CQAN + S S P C   + TD     P IP   +   S   ++F  G  V   C  G+   + S ++       W + P +C   SCG      N   +    +T+ +             CT  +    N  R CQADG+W+G    C       C +   P +G        V S   F C EGY L GS  R C   G W G+   C    CG P       + + +     +   Y C     + G ++ L C      +G LP        +C  F         +     ++F      T G ++   CN GY ++   S       +G+W+  +P C    C  +PP +    +        +   Y C  GY
Sbjct: 2708 CVPLPVCCGHPGNPVHGVTQGNWYSYSDVVNFTCNTGYTSEGSMHAQCQANGQWSSSIPVCKVVNCTD-----PGIPPNAIRKVSKGNENFMFGAMVFYECNPGFYL-FGSSVMTCQEKGTWDHHPSQCVVVSCGHPGVAPN-SLLSGEKFTFGATV--------TYSCTGSRLLIGNATRSCQADGRWTGSQPHCAGDYYGFCGDPGIPVHGFRSADDVRVRSTIRFYCAEGYVLRGSRERVCNPGGVWSGTQPDCHAVWCGNPGVPAGGSILHSDGVVFSSSVTYACWDGYQMSGLSTRL-CSANGTWTGVLP--------NCTVFNCGEPGTVANGVRIGSDF------TFGHNITYHCNPGYRIDPHHSSTRVCGKDGAWSGSLPLCRVITCR-QPPRVVNGRLLGSDFSWGASVSYSCSSGY 3103          

HSP 3 Score: 91.6633 bits (226), Expect = 2.992e-19
Identity = 108/433 (24.94%), Postives = 166/433 (38.34%), Query Frame = 3
Query:  399 CQPPVQPVNGHA-NHSILLVGDQVEYTCKSGYALKGPRKRYCQAN----LRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYD--PIKCEKKSCGKLE----DPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWS--GDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVR-NCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSW-NFIPRCVEAACSARPPSMKYSTVRFLS-----LKHDSLARYYCHFGYYI 1631
            C  P  P +G   + +   +G  V + C +GY L G     C  +       + S P C  Q   C     +P + ++   +  DF  G  V   C  GY         A C  N +W     P +C    C  +     D  + R + N +++     I F       QC    F       +CQA+G WS   +   C  + C EL  P N   +G   T  +   F+C+ G+ L GS +R+C   G W G+ + CI   +CGPP  +V  +V      +     Y+C     LIG +S   C +    SG +P        +C P  V       H  N        +  ++   V   CN GY     +   C  NG W + IP C    C+   P +  + +R +S         ++  Y C+ G+Y+
Sbjct: 2406 CSTPASPSHGLVLSQTGGQLGSGVRWACHTGYRLIGRSSAVCTQSPTGIFTWNTSVPAC--QAISC----GLPKSPIYGGIHAMDFSLGGHVAYSCNAGYTMVAGESASAVCLENGQWSNHNHPPQCTVVICPSVSAFSLDHGSWRVV-NGSHSEFGAQITF-------QCEPGYFLRGPSVIRCQANGTWSWNEERPTCEIMSCGELPIPANANKIGTQTTFGATAIFRCEMGFLLVGSVVRECLSSGLWSGNETRCIAAGHCGPPEALVNGEVVGVEFGYRDTVVYQCNPGFRLIG-SSVRVCQKDHKWSGQVP--------NCVPLPVCCG----HPGNPVHGVTQGNWYSYSDVVNFTCNTGYTSEGSMHAQCQANGQWSSSIPVCKVVNCTD--PGIPPNAIRKVSKGNENFMFGAMVFYECNPGFYL 2809          

HSP 4 Score: 81.6481 bits (200), Expect = 4.052e-16
Identity = 101/397 (25.44%), Postives = 159/397 (40.05%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPR--KRYCQANLRLSGSE--PECTD---QTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPE---NGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRN--CGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKC-LLHCK-PFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYEL-NSDILPACYNGSWNFIP-RCVEAAC 1532
            + C  P  P+ G  +     +G  V Y+C +GY +         C  N + S     P+CT     +   FS  +  +  V  N +  +F  G  +   C+ GY     S I  + NG   W  +   CE  SCG+L  P N   +     T+ + AI  C  GF +          +  R+C + G WSG+   C  I      PPE   NGEV+GV         ++C  G++L GS +R C ++  W G    C+     CG P   V         ++     + C +     G TS  +       +G      P C +++C  P    +A   + + N+  NF+       G  V  +CN G+ L  S ++     G+W+  P +CV  +C
Sbjct: 2467 ISCGLPKSPIYGGIHAMDFSLGGHVAYSCNAGYTMVAGESASAVCLENGQWSNHNHPPQCTVVICPSVSAFSLDHGSWRVV--NGSHSEF--GAQITFQCEPGYFLRGPSVIRCQANGTWSWNEERPTCEIMSCGELPIPANANKI-GTQTTFGATAIFRCEMGFLLV--------GSVVRECLSSGLWSGNETRC--IAAGHCGPPEALVNGEVVGVEFGYRDTVVYQCNPGFRLIGSSVRVCQKDHKWSGQVPNCVPLPVCCGHPGNPVHGVTQGNWYSYSDVVNFTCNT-----GYTSEGSMHAQCQANGQWSSSIPVCKVVNCTDPGIPPNAIRKVSKGNE--NFMF------GAMVFYECNPGFYLFGSSVMTCQEKGTWDHHPSQCVVVSC 2835          

HSP 5 Score: 77.7962 bits (190), Expect = 5.519e-15
Identity = 109/480 (22.71%), Postives = 163/480 (33.96%), Query Frame = 3
Query:  456 GDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKN--GEDVKIICQNGYEDPYKSHIIAKC-NGNEWKYDPIKC-EKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKI----------------------------------------------------QCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENG---EVMGVWNTVNSIKTF-KCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFI-PRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKM 1709
            G Q+ + C+ GY L+GP    CQAN   S +E   T +   C   P      +  N+N+   +   G      C+ G+       ++ +C +   W  +  +C     CG  E   NG  +    + Y+   +  CN GF++                                                     C T    + +   QCQA+G+WS    +C  + C +   P N       G  N +     F +C  G+ L GS +  C  +G WD   S C+V +CG P     + ++ E  T GA   Y C     LIG  +  +C       G     +P C      F  D   + +H       F   D+V   + +R  C  GY L       C   G W+   P C    C         S +    +   S   Y C  GY        M  LST   +    G WT +
Sbjct: 2555 GAQITFQCEPGYFLRGPSVIRCQANGTWSWNEERPTCEIMSCGELP------IPANANKIGTQTTFGATAIFRCEMGFL--LVGSVVRECLSSGLWSGNETRCIAAGHCGPPEALVNGEVV-GVEFGYRDTVVYQCNPGFRLIGSSVRVCQKDHKWSGQVPNCVPLPVCCGHPGNPVHGVTQGNWYSYSDVVNFTCNTGYTSEGSMHAQCQANGQWSSSIPVCKVVNCTDPGIPPNAIRKVSKGNENFMFGAMVFYECNPGFYLFGSSVMTCQEKGTWDHHPSQCVVVSCGHPGVAPNSLLSGEKFTFGATVTYSCTGSRLLIGNAT-RSC----QADGRWTGSQPHCAGDYYGFCGDPG-IPVH------GFRSADDVRVRSTIRFYCAEGYVLRGSRERVCNPGGVWSGTQPDCHAVWCGNPGVPAGGSILHSDGVVFSSSVTYACWDGYQ-------MSGLST--RLCSANGTWTGV 3004          

HSP 6 Score: 67.0106 bits (162), Expect = 1.262e-11
Identity = 73/282 (25.89%), Postives = 99/282 (35.11%), Query Frame = 3
Query:  327 YDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKC---EKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGV-WNTVNSIKTFKCKEGYQLHG-SHLRKCTREGNWDGSNSTCIVRNCGPPP 1157
            +   ++C  D    G + +   + C+ P + VNG    S    G  V Y+C SGY    P    C+ N    G  P+C      C      P T          F    DV   C N       S + A      W     +C    +  C     P+ G       Y   S     C  GF IQ +T         R C +D  WSG    C +  C +L  PEN +V  V    +     + C+ G+ L G S  R C  +G W G    C   + GP P
Sbjct: 3049 HSSTRVCGKDGAWSGSLPLCRVITCRQPPRVVNGRLLGSDFSWGASVSYSCSSGYEPSFPATLTCEGNGTWRGDVPQCLPV--FCGD----PGTPAEGKREGKRFIFEADVSFSC-NPPLVLVGSSLRACRADRTWSGTQPRCIDPSQTMCLNPGTPQFGEQNITQGYQVDSTVSFRCQKGFHIQGSTT--------RTCLSDLTWSGTQPECISHSCKQLETPENADVGAVELPGLGYTLMYSCQPGFYLAGGSEHRSCRPDGTWSGKTPIC---HPGPKP 3312          

HSP 7 Score: 56.225 bits (134), Expect = 2.473e-8
Identity = 115/543 (21.18%), Postives = 187/543 (34.44%), Query Frame = 3
Query:  432 ANHSILL------VGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADG-----------------KWSGDTAIC--------TAILCPELSPPENGEVMG-VWNTVNSIKTFKCKEGYQLHGSHLRKCTREGN----WDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLI-GETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF---IPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTC 1937
            AN  IL+      +GD ++Y C  G+ L G     CQ   RL  +    T Q  LC               + ++ +  E   +I   GY   Y +                    ++CG +   + G T+      +QS   Q+  D  +I     Q      RR     G                 +WS D A          TA  C   + P +G V+      + S   + C  GY+L G     CT+       W+ S   C   +CG P   ++  +     + G    Y C +  T++ GE++   C  ++N         P+C +   P    SA    H + +  N   H E   G  +  +C  GY L    +  C  NG+W++    P C   +C   P     + +        + A + C  G+ +         + ++     + G W+   T       C  P    NGE+               ++  +   V Y+C+P +RL G  + VC   H    Q+P C
Sbjct: 2235 ANAEILMEDETFEIGDIIKYRCLLGFTLVGSEVLTCQLGTRLQANVASPTCQA-LC---------------STNEIRR-ESSGVILSPGYPSNYPN-------------------LQTCGWMLSVEKGYTITLYVEFFQS-EKQY--DELEIYDVVTQGPTSQGRRLAALSGDYSSPLNVTSASNQMFVRWSADHATSKKGFRISYTAQYCSTPASPSHGLVLSQTGGQLGSGVRWACHTGYRLIGRSSAVCTQSPTGIFTWNTSVPACQAISCGLPKSPIYGGIHAMDFSLGGHVAYSCNAGYTMVAGESASAVC--LENGQWSNHNHPPQCTVVICP--SVSAFSLDHGSWRVVNG-SHSEF--GAQITFQCEPGYFLRGPSVIRCQANGTWSWNEERPTCEIMSCGELPIPANANKIG-TQTTFGATAIFRCEMGFLL---------VGSVVRECLSSGLWSGNETRCIAAGHCGPPEALVNGEVV-------------GVEFGYRDTVVYQCNPGFRLIGSSVRVCQKDHKWSGQVPNC 2708          
BLAST of C4b binding protein beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010323.1 (pep scaffold:Pmarinus_7.0:GL476365:125003:472029:-1 gene:ENSPMAG00000009333.1 transcript:ENSPMAT00000010323.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.5153 bits (236), Expect = 2.078e-20
Identity = 129/526 (24.52%), Postives = 188/526 (35.74%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGP---RKRYCQANLRLSGSE--PECTDQTDLCFSAPYIPYTQVHDN---SNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFG-YELNSDILPACYNGSWNF-IPRCVEAACS--ARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNK-GNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWSPPQ 1925
            + C  PV P NG        +G +V Y C  GY   GP       C  N   S +   P C     + F+A    ++  H +    N  D+K G  +   CQ GY       I  + NG   W+ D  +C   SCG L    NGR +      + S AI  C+ GF +  +          R+C A G WSG +  C A  C    P  NG V+G     +    ++C+ G++L GS +R C ++  W G    C+  +CG P   V       +        + C S     G +      +    + W  +P P C +   P   +        N     F+       G+ V   C  G Y + S +L    NG W+  IP+C   +C      P+   S  +F              FG  +     G   L       C   G WT            +          + +G+  R +            VV++ C   Y L GP   VCL +G WS  Q
Sbjct: 2475 ISCGIPVSPANGEILTVNYSIGGRVTYGCNRGYT-TGPGDTLAAVCLENGTWSNNNQPPMCNAIACMDFNA----FSLDHGSWLLLNGSDYKYGSRIIFHCQPGYTLLGPRIIQCQENGAWSWENDRPRCSLISCGSLSALPNGRKI-GTQTGFGSTAIYRCDPGFTLLGSQ--------VRECLASGLWSGTSNRCIAGHCGVPDPVTNGAVVGQSFGYHDTVVYRCQPGFRLVGSSVRMCQQDHQWSGQPPACVPISCGHPGTPVHGLTEGSSFHLYDTVNFTCNSGYISEGASQ----AQCMPDALW-SQPLPTCKVVSCPDPGEPLNGVRKVNKGYGKFVF------GSVVFYDCKQGFYLIGSSVLTCLPNGLWDRPIPQCFLVSCGHPGVAPNSLLSGEKFT-------------FGATVIYSCTGSRLLIGNATRSCQADGRWTGAQPHCSGDSAGSCGDPGIPSHGHRIGEEFRVK-----------SVVRFGCAVGYALHGPSERVCLPSGSWSRSQ 2951          

HSP 2 Score: 88.5817 bits (218), Expect = 2.681e-18
Identity = 122/537 (22.72%), Postives = 179/537 (33.33%), Query Frame = 3
Query:  228 KPECHVKSLDNVKHLPNG-----CPSKACTANIDCWVEY----DRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPI-KCEKKSCGKLEDPKNGRTMYNNNY---TYQSIAIQFCNDGFKI--------------------------------------------------QCTTDQFEDKNCRRQCQADGKWSGDTAICT---AILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAY-EATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSD--ILPACY-NGSWN-FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGY 1625
            +P C + S  ++  LPNG           TA   C   +     + + C+      G     I   C  P    NG          D V Y C+ G+ L G   R CQ + + SG  P C   +  C      P T VH  +    F   + V   C +GY     S   A+C  +     P+  C+  SC    +P NG    N  Y    + S+    C  GF +                                                   CT  +    N  R CQADG+W+G    C+   A  C +   P +G  +G    V S+  F C  GY LHG   R C   G+W  S + C    CG P       + + +     +   Y C     + G ++ L C      +G LP         C      +  V          F +  E T   +V   C  GY ++S    + +C  +G+W+  +P C    C  +PP +    +        +   Y C  GY
Sbjct: 2596 RPRCSLISCGSLSALPNGRKIGTQTGFGSTAIYRCDPGFTLLGSQVRECLASGLWSGTSNRCIAGHCGVPDPVTNGAVVGQSFGYHDTVVYRCQPGFRLVGSSVRMCQQDHQWSGQPPACVPIS--CGH----PGTPVHGLTEGSSFHLYDTVNFTCNSGYISEGASQ--AQCMPDALWSQPLPTCKVVSCPDPGEPLNGVRKVNKGYGKFVFGSVVFYDCKQGFYLIGSSVLTCLPNGLWDRPIPQCFLVSCGHPGVAPNSLLSGEKFTFGATVIYSCTGSRLLIGNATRSCQADGRWTGAQPHCSGDSAGSCGDPGIPSHGHRIGEEFRVKSVVRFGCAVGYALHGPSERVCLPSGSWSRSQAECKAVWCGNPGVPAGGSILHSDGVVFSSSVTYACWDGYQMSGLSTRL-CSANATWTGVLPV--------CTVISCGNPGV------AANGFYLGKEFTFSQNVSYHCYPGYSMSSGATAVRSCQKDGTWSGALPSCHVITCR-QPPRVLNGRLLGSDFSWGASVSYSCSSGY 3108          

HSP 3 Score: 85.8853 bits (211), Expect = 2.126e-17
Identity = 87/342 (25.44%), Postives = 129/342 (37.72%), Query Frame = 3
Query:  315 CWVEYDRA----QLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALK--GPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAI-----LCPELSPPENGEVMGVWN-TVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKV-AYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLP 1301
            CW  Y  +    +LC  ++   G++ +   + C  P    NG            V Y C  GY++       R CQ +   SG+ P C   T  C   P +    ++      DF  G  V   C +GYE  + + +  + NG  W+ D  +C    CG    P  GR     ++ Y+S     C +   +  ++         R C ADG WSG    C  +      CP     + GE+   +   V S   F+C +GY + GS  R C  +  W G+   CI  +C        A V A E    G    Y C+    L G +   +C      SG  P
Sbjct: 2986 CWDGYQMSGLSTRLCSANATWTGVLPVCTVISCGNPGVAANGFYLGKEFTFSQNVSYHCYPGYSMSSGATAVRSCQKDGTWSGALPSCHVIT--CRQPPRV----LNGRLLGSDFSWGASVSYSCSSGYEPSFPATLTCEGNGT-WRGDVPQCLPIYCGDPGVPAEGRRE-GTSFMYKSKVAFSCKNTLLLVGSS--------LRMCTADGTWSGTQPRCIDLDPLQNTCPNPGALQFGELNSTFGFQVGSKVKFRCGKGYHILGSTTRSCQSDYVWSGTRPQCIPHSCRQLETPENADVGAVELPGLGYTLMYSCQPGFYLAGGSEHRSCRPDGTWSGKTP 3311          

HSP 4 Score: 82.8037 bits (203), Expect = 1.711e-16
Identity = 102/432 (23.61%), Postives = 156/432 (36.11%), Query Frame = 3
Query:  399 CQPPVQPVNGHA-NHSILLVGDQVEYTCKSGYALKGPRKRYC----QANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYD--PIKCEKKSCGKLE----DPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWS--GDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNF-IPRCVEAACSARPPSMKYSTVR-----FLSLKHDSLARYYCHFGYYI 1631
            C  P  P +G   + S   +   V + C  GY L G     C    Q       + P C  Q   C     IP +  +      ++  G  V   C  GY       + A C  N  W  +  P  C   +C        D  +   +  ++Y Y S  I  C  G+ +              QCQ +G WS   D   C+ I C  LS   NG  +G      S   ++C  G+ L GS +R+C   G W G+++ CI  +CG P  +    V  ++  +     Y+C+    L+G +S   C +    SG  P         C P         +H   + ++F ++D V         CN GY         C  +  W+  +P C   +C    P    + VR     +      S+  Y C  G+Y+
Sbjct: 2414 CSIPAAPAHGSVMSQSGGHLNSVVWWACDRGYTLIGKSSAVCIKAPQGFHMWDSAVPTC--QAISC----GIPVSPANGEILTVNYSIGGRVTYGCNRGYTTGPGDTLAAVCLENGTWSNNNQPPMCNAIACMDFNAFSLDHGSWLLLNGSDYKYGSRIIFHCQPGYTLLGPR--------IIQCQENGAWSWENDRPRCSLISCGSLSALPNGRKIGTQTGFGSTAIYRCDPGFTLLGSQVRECLASGLWSGTSNRCIAGHCGVPDPVTNGAVVGQSFGYHDTVVYRCQPGFRLVG-SSVRMCQQDHQWSGQPPA--------CVPISCGHPGTPVHGLTEGSSFHLYDTVNF------TCNSGYISEGASQAQCMPDALWSQPLPTCKVVSCPD--PGEPLNGVRKVNKGYGKFVFGSVVFYDCKQGFYL 2814          

HSP 5 Score: 80.1073 bits (196), Expect = 1.139e-15
Identity = 71/294 (24.15%), Postives = 112/294 (38.10%), Query Frame = 3
Query:  399 CQPPVQPVNGHANHSILLV-GDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCI-----VRNCGPPPEIVFAKV-AYEATTHGAQAEYKCKSRSTLIGETS 1256
            C  P  P  G   HS  +V    V Y C  GY + G   R C AN   +G  P CT  +  C +    P    +      +F   ++V   C  GY     +  +  C  +  W      C   +C +     NGR +  +++++ +     C+ G++                C+ +G W GD   C  I C +   P  G   G      S   F CK    L GS LR CT +G W G+   CI        C  P  + F ++ +      G++ +++C     ++G T+
Sbjct: 2959 CGNPGVPAGGSILHSDGVVFSSSVTYACWDGYQMSGLSTRLCSANATWTGVLPVCTVIS--CGN----PGVAANGFYLGKEFTFSQNVSYHCYPGYSMSSGATAVRSCQKDGTWSGALPSCHVITCRQPPRVLNGR-LLGSDFSWGASVSYSCSSGYE--------PSFPATLTCEGNGTWRGDVPQCLPIYCGDPGVPAEGRREGTSFMYKSKVAFSCKNTLLLVGSSLRMCTADGTWSGTQPRCIDLDPLQNTCPNPGALQFGELNSTFGFQVGSKVKFRCGKGYHILGSTT 3237          

HSP 6 Score: 67.0106 bits (162), Expect = 1.130e-11
Identity = 54/207 (26.09%), Postives = 80/207 (38.65%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-----EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPE 992
            + + C  P  P  G    +  +   +V ++CK+   L G   R C A+   SG++P C D   L  + P     Q  + ++   F+ G  VK  C  GY      HI+     +      W     +C   SC +LE P+N               +  C  GF +   ++        R C+ DG WSG T IC     P L P E
Sbjct: 3132 LPIYCGDPGVPAEGRREGTSFMYKSKVAFSCKNTLLLVGSSLRMCTADGTWSGTQPRCIDLDPLQNTCPNPGALQFGELNSTFGFQVGSKVKFRCGKGY------HILGSTTRSCQSDYVWSGTRPQCIPHSCRQLETPENADVGAVELPGLGYTLMYSCQPGFYLAGGSEH-------RSCRPDGTWSGKTPICH----PGLKPSE 3321          

HSP 7 Score: 60.8474 bits (146), Expect = 9.086e-10
Identity = 63/253 (24.90%), Postives = 96/253 (37.94%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMY---NNNYTYQ-SIAIQF-CNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGV-WNTVNSIKTFKCKEGYQLH-GSHLRKCTREGNWDGSNSTC 1130
            + C+ P + +NG    S    G  V Y+C SGY    P    C+ N    G  P+C     +    P +P     + ++   F     V   C+N       S  +   +G  W     +C      +   P  G   +   N+ + +Q    ++F C  G+ I  +T         R CQ+D  WSG    C    C +L  PEN +V  V    +     + C+ G+ L  GS  R C  +G W G    C
Sbjct: 3076 ITCRQPPRVLNGRLLGSDFSWGASVSYSCSSGYEPSFPATLTCEGNGTWRGDVPQC---LPIYCGDPGVPAEGRREGTS---FMYKSKVAFSCKNTLLLVGSSLRMCTADGT-WSGTQPRCIDLDPLQNTCPNPGALQFGELNSTFGFQVGSKVKFRCGKGYHILGST--------TRSCQSDYVWSGTRPQCIPHSCRQLETPENADVGAVELPGLGYTLMYSCQPGFYLAGGSEHRSCRPDGTWSGKTPIC 3313          

HSP 8 Score: 53.5286 bits (127), Expect = 1.979e-7
Identity = 106/446 (23.77%), Postives = 156/446 (34.98%), Query Frame = 3
Query:  669 CQNGYEDPYKSHII---AKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTA--ICTAILCPELSPPENGEVMGVWNTVN-------SIKTFKCKEGYQLHGSHLRKCTREGNWDGSNST--CIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLL-HCK-PFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNF-IPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSI-KPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWSPPQMPTCEFI 1946
            C  GY    KS  +   A    + W      C+  SCG    P NG  +   NY+        CN G+                 C  +G WS +    +C AI C + +        G W  +N       S   F C+ GY L G  + +C   G W   N    C + +CG    +   +     T  G+ A Y+C    TL+G +    C      SG       +C+  HC  P  V +  V         +F  HD V +      +C  G+ L    +  C  +  W+   P CV  +C   P +  +      S        + C+ GY      +G      + D       W++ P   C+   C  P  P NG           R  +K   K +   VV Y+C   + L G  +  CL NG W  P +P C  +
Sbjct: 2441 CDRGYTLIGKSSAVCIKAPQGFHMWDSAVPTCQAISCGIPVSPANGEIL-TVNYSIGGRVTYGCNRGYTTG------PGDTLAAVCLENGTWSNNNQPPMCNAIACMDFNAFSLDH--GSWLLLNGSDYKYGSRIIFHCQPGYTLLGPRIIQCQENGAWSWENDRPRCSLISCGSLSALPNGRKIGTQTGFGSTAIYRCDPGFTLLG-SQVREC----LASGLWSGTSNRCIAGHCGVPDPVTNGAVV------GQSFGYHDTVVY------RCQPGFRLVGSSVRMCQQDHQWSGQPPACVPISC-GHPGTPVHGLTEGSSFHLYDTVNFTCNSGYI----SEGASQAQCMPDAL-----WSQ-PLPTCKVVSCPDPGEPLNG----------VRKVNKGYGKFVFGSVVFYDCKQGFYLIGSSVLTCLPNGLWDRP-IPQCFLV 2838          
BLAST of C4b binding protein beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003453.1 (pep scaffold:Pmarinus_7.0:GL476692:191866:231388:-1 gene:ENSPMAG00000003157.1 transcript:ENSPMAT00000003453.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.2041 bits (230), Expect = 6.458e-20
Identity = 86/336 (25.60%), Postives = 126/336 (37.50%), Query Frame = 3
Query:  333 RAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALK--GPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAIC---TAILCPELSPPENG-EVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKV-AYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKC 1319
            R + C  +    G +   I + C  P  P N          G  V Y C  GY ++     +R C      SG+ P C  +   C   P +    +H      DF  G  V   C  GY+  + + +  +  G EW  +  +C    CG    P NG      ++T+QS             C +      + +R C A G WSG    C   +   C     P NG +   +   V S  +F+CK+G+ + GS  R C  +  W+G    C+   C  P    +A V A +    G    Y C+    L G +   TC   D +  W  KP P C
Sbjct:  339 RTRHCSANGTWSGSLPSCIVITCGDPGTPANAVRTGVDFTFGHNVTYRCHPGYTMEPTTQSQRVCTKEGVWSGNLPLC--KIIRCQEPPVV----MHGRRESGDFTWGSAVAYGCLAGYQLSHSATLFCEGRG-EWTGELPQCLPMFCGDPGVPANGERQ-GRSFTFQSEV--------SFTCASPLVLVGSAKRVCMASGMWSGTQPRCIEASHTTCTNPGTPHNGFQNFSLGYQVGSTVSFECKKGFHIQGSSTRTCLPDLTWNGLQPECVSHRCSQPETPAYADVRAQDVAQLGYTLLYSCQPGYYLSGGSEHRTC---DPEGAWSGKP-PLC 654          

HSP 2 Score: 84.3445 bits (207), Expect = 3.636e-17
Identity = 73/310 (23.55%), Postives = 122/310 (39.35%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTA---ILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPP-PEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPK 1304
            + + C  P  PV+G A+     + D V ++C  G+ + GP    C  + + S   P C  +   C    ++  + +   +    F  G  V   C+ GY     S +  + +G +W   P  C   +C     P +G  +    +TY S     C++   +          +  R CQA G WSG T +C+      C +   P +G   G      S+ +F C +GY L GS  R C   G+W G+   C    C  P  +   ++ ++          Y C+    ++G+ +   C      SG LP 
Sbjct:   59 VPISCGHPGSPVHGIAHGGRFNLDDVVGFSCDVGFVIHGPESTQCLPSGQWSDPLPVC--KVVNCTGPAHVENSYLEIKNKNKMFTYGTLVSYHCKPGYYLMGSSTLSCQPSG-QWDKPPPVCTVVNCSHPGLPPHG-ILAAEGFTYGSSVTYSCSERRALL--------GHPTRTCQASGHWSGSTPLCSGDGHGACGDPGVPPHGSRRGGAFRTESVVSFSCDDGYVLRGSERRSCLANGSWSGTQPDCREFQCALPFSDRDGSRPSWAGAVFPDSVTYACRDGFRMLGQRT-RHCSANGTWSGSLPS 355          

HSP 3 Score: 82.8037 bits (203), Expect = 1.292e-16
Identity = 69/251 (27.49%), Postives = 101/251 (40.24%), Query Frame = 3
Query:  390 DLQCQPPVQPVNG-HANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGY--EDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCI 1133
            + QC  P    +G   + +  +  D V Y C+ G+ + G R R+C AN   SGS P C   T      P  P   V       DF  G +V   C  GY  E   +S  +    G  W  +   C+   C +     +GR   + ++T+ S     C  G+++  +   F        C+  G+W+G+   C  + C +   P NGE  G   T  S  +F C     L GS  R C   G W G+   CI
Sbjct:  299 EFQCALPFSDRDGSRPSWAGAVFPDSVTYACRDGFRMLGQRTRHCSANGTWSGSLPSCIVIT---CGDPGTPANAVRTGV---DFTFGHNVTYRCHPGYTMEPTTQSQRVCTKEG-VWSGNLPLCKIIRCQEPPVVMHGRRE-SGDFTWGSAVAYGCLAGYQLSHSATLF--------CEGRGEWTGELPQCLPMFCGDPGVPANGERQGRSFTFQSEVSFTCASPLVLVGSAKRVCMASGMWSGTQPRCI 533          

HSP 4 Score: 82.0333 bits (201), Expect = 2.022e-16
Identity = 93/372 (25.00%), Postives = 137/372 (36.83%), Query Frame = 3
Query:  444 ILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKK---SCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTV--NSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGET-SFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYN-GSWNF-IPRCVEAAC 1532
            +   G  V Y CK GY L G     CQ + +     P CT    +  S P +P    H     + F  G  V   C          H    C  +  W      C      +CG    P +G +     +  +S+    C+DG+ ++ +         RR C A+G WSG    C    C       +G        V  +S+ T+ C++G+++ G   R C+  G W GS  +CIV  CG P     A       T G    Y+C    T+   T S   C +    SG LP         CK  +     V +H   ++ +F     V +G      C  GY+L+      C   G W   +P+C+   C
Sbjct:  140 MFTYGTLVSYHCKPGYYLMGSSTLSCQPSGQWDKPPPVCTV---VNCSHPGLP---PHGILAAEGFTYGSSVTYSCSE--RRALLGHPTRTCQASGHWSGSTPLCSGDGHGACGDPGVPPHG-SRRGGAFRTESVVSFSCDDGYVLRGSE--------RRSCLANGSWSGTQPDCREFQCALPFSDRDGSRPSWAGAVFPDSV-TYACRDGFRMLGQRTRHCSANGTWSGSLPSCIVITCGDPGTPANAVRTGVDFTFGHNVTYRCHPGYTMEPTTQSQRVCTKEGVWSGNLPL--------CKIIRCQEPPVVMHGRRESGDFTWGSAVAYG------CLAGYQLSHSATLFCEGRGEWTGELPQCLPMFC 479          

HSP 5 Score: 75.0998 bits (183), Expect = 2.642e-14
Identity = 98/404 (24.26%), Postives = 154/404 (38.12%), Query Frame = 3
Query:  768 CGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEI----VFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKC-LLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWN-FIPRCV---EAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCEFI 1946
            CG LE   NG+ +   +Y Y+   +  C+ GF++   +         R CQ D  WSG++  C  I C     P +G   G    ++ +  F C  G+ +HG    +C   G W      C V NC  P  +    +  K   +  T+G    Y CK    L+G +S L+C      SG   KP P C +++C            H        +  +  T+G+ V   C+    L       C  +G W+   P C      AC   P    + + R  + + +S+  + C  GY +     G E  S + +     G+W+    + C+  +C             L  SDR          +    V Y C   +R+ G +   C  NG WS   +P+C  I
Sbjct:    5 CGVLEPIVNGQVV-GESYGYRDTVVYQCSPGFRLIGFS--------VRICQQDHNWSGNSPACVPISCGHPGSPVHGIAHGGRFNLDDVVGFSCDVGFVIHGPESTQCLPSGQWSDPLPVCKVVNCTGPAHVENSYLEIKNKNKMFTYGTLVSYHCKPGYYLMG-SSTLSC----QPSGQWDKPPPVCTVVNCS-----------HPGLPPHGILAAEGFTYGSSVTYSCSERRALLGHPTRTCQASGHWSGSTPLCSGDGHGAC-GDPGVPPHGSRRGGAFRTESVVSFSCDDGYVL----RGSERRSCLAN-----GSWSGTQPD-CREFQCA------------LPFSDRDGSRPSWAGAVFPDSVTYACRDGFRMLGQRTRHCSANGTWS-GSLPSCIVI 359          

HSP 6 Score: 62.7734 bits (151), Expect = 2.245e-10
Identity = 96/420 (22.86%), Postives = 148/420 (35.24%), Query Frame = 3
Query:  420 VNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGY--EDPYKSHIIAKCNGNEWKYDPIK-CEKKSCGKLEDPKNGRTMYNNN---YTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRN---CGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNF---IMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWN-FIPRCVEAACS--ARPPSMKYSTVRFLSLKHDSLARYYCHFGYYI 1631
            VNG          D V Y C  G+ L G   R CQ +   SG+ P C   +  C      P + VH  ++   F   + V   C  G+    P  +  +      +W  DP+  C+  +C      +N      N    +TY ++    C  G+ +  ++           CQ  G+W     +CT + C     P +G +     T  S  T+ C E   L G   R C   G+W GS   C       CG P           A    +   + C     L G     +C    + SG  P         C+ FQ   A  +   +    ++   +  D VT+       C  G+ +       C  NG+W+  +P C+   C     P +   + V F +  H+    Y CH GY +
Sbjct:   12 VNGQVVGESYGYRDTVVYQCSPGFRLIGFSVRICQQDHNWSGNSPACVPIS--CGH----PGSPVHGIAHGGRFNLDDVVGFSCDVGFVIHGPESTQCLPS---GQWS-DPLPVCKVVNCTGPAHVENSYLEIKNKNKMFTYGTLVSYHCKPGYYLMGSST--------LSCQPSGQWDKPPPVCTVVNCSHPGLPPHGILAAEGFTYGSSVTYSCSERRALLGHPTRTCQASGHWSGSTPLCSGDGHGACGDPGVPPHGSRRGGAFRTESVVSFSCDDGYVLRGSER-RSCLANGSWSGTQPD--------CREFQC--ALPFSDRDGSRPSWAGAVFPDSVTY------ACRDGFRMLGQRTRHCSANGTWSGSLPSCIVITCGDPGTPANAVRTGVDF-TFGHN--VTYRCHPGYTM 393          

HSP 7 Score: 53.9138 bits (128), Expect = 1.041e-7
Identity = 43/199 (21.61%), Postives = 70/199 (35.18%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-----EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAIL 968
            + + C  P  P NG           +V +TC S   L G  KR C A+   SG++P C + +    + P  P+    + S    ++ G  V   C+ G+      HI             W     +C    C + E P        +        +  C  G+ +   ++        R C  +G WSG   +C A +
Sbjct:  475 LPMFCGDPGVPANGERQGRSFTFQSEVSFTCASPLVLVGSAKRVCMASGMWSGTQPRCIEASHTTCTNPGTPHNGFQNFSL--GYQVGSTVSFECKKGF------HIQGSSTRTCLPDLTWNGLQPECVSHRCSQPETPAYADVRAQDVAQLGYTLLYSCQPGYYLSGGSEH-------RTCDPEGAWSGKPPLCHATV 658          
BLAST of C4b binding protein beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009096.1 (pep scaffold:Pmarinus_7.0:GL479728:66801:80742:-1 gene:ENSPMAG00000008231.1 transcript:ENSPMAT00000009096.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 1.157e-11
Identity = 99/391 (25.32%), Postives = 138/391 (35.29%), Query Frame = 3
Query:  399 CQPPVQPVNGH--ANHSILLVGDQVEYTCKSGYAL--KGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWK-YDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPP---ENGEVMGVWNTV---NSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCI---VRNCGPPPEIVFAKVAYEATTH--GAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFIPRCV 1520
            C PP +  NG   + ++   V D V Y C SGYA       +  C AN         C  +T  C   P      +   S       G+ +   C  GY    K++ +       W   DP  C+  SC +++  +      +  Y Y S     C  GF +    D F D      C   GKWSG   IC        +P     +G+ MG        N I  ++C   Y+   S +  CT    W  +   C+   V  C  PP I    V    + +  G  A YKC+    L G  + + C E D    W   P    +    P  V + K  I E  KT          +G  V   C+  Y L  +    C  NG W+  P C 
Sbjct:   22 CGPPPRVNNGRPDSTNTFFPVNDMVRYQCNSGYAATKNSSLRLQCVANGTWGELNYWCERKT--CSPKP------IDQGSYTGGISFGDTITYTCDTGYALTGKTYQLTCMADGTWNPVDPPDCQSVSCPEIDLTEKLVFQLSLQYQYGSRVTYSCEAGFSL--IGDSFRD------CLESGKWSGSNPICKVSDVKCKTPQWDISHGQAMGERKEAYKYNDIVRYECSARYRAEPSEIH-CTESNEWSAT-VNCVFKAVTVCRSPPLIGNGDVVQPKSEYAMGDSASYKCRKGYRLEGNETAV-CRENDQ---WTQPPTCASVTCGPPATVINGK--IKEQAKT-------PYAYGDRVSYICDDTYHLVGNGEITCQNNGQWSPSPSCA 381          

HSP 2 Score: 65.0846 bits (157), Expect = 1.607e-11
Identity = 91/371 (24.53%), Postives = 134/371 (36.12%), Query Frame = 3
Query:  639 FKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKN-GRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSG-DTAICTAILCPELSPPENGEV-MGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRN--CGPPPEIVFAKVAY----EATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKC-NKGNWTKMPT 1715
            F   + V+  C +GY     S +  +C  N  W      CE+K+C     PK   +  Y    ++       C+ G+ +   T Q         C ADG W+  D   C ++ CPE+   E     + +     S  T+ C+ G+ L G   R C   G W GSN  C V +  C  P   +    A     EA  +     Y+C +R     E S + C E +  S  +      C+   K   V  +   I   +         E   G     KC  GY L  +    C  N  W   P C    C   PP    +TV    +K  +   Y   +G  ++   D    L    +I C N G W+  P+
Sbjct:   40 FPVNDMVRYQCNSGYAATKNSSLRLQCVANGTWGELNYWCERKTC----SPKPIDQGSYTGGISFGDTITYTCDTGYALTGKTYQL-------TCMADGTWNPVDPPDCQSVSCPEIDLTEKLVFQLSLQYQYGSRVTYSCEAGFSLIGDSFRDCLESGKWSGSNPICKVSDVKCKTPQWDISHGQAMGERKEAYKYNDIVRYECSAR--YRAEPSEIHCTESNEWSATV-----NCVF--KAVTVCRSPPLIGNGDVVQ---PKSEYAMGDSASYKCRKGYRLEGNETAVCRENDQWTQPPTCASVTCG--PP----ATVINGKIKEQAKTPY--AYGDRVSYICDDTYHLVGNGEITCQNNGQWSPSPS 379          
BLAST of C4b binding protein beta chain vs. Ensembl Nematostella
Match: EDO36503 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIF8])

HSP 1 Score: 129.413 bits (324), Expect = 6.149e-31
Identity = 88/286 (30.77%), Postives = 125/286 (43.71%), Query Frame = 3
Query:  399 CQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGED-VKIICQNGYEDPYKSHIIAKCNGNE-WKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGE 1250
            C P V P+NG    S+    + + + C  G+ L G  KR CQ+N R SG       Q   C +    P T   + S         + V   C  G++       +  C  N  W  D + C+ + CG L  P NG T   +  T+ +     C++GF +  + +        R CQ++GKWSG    C A  C  L  P NG  +G   T  +  TF C EG+ L GS +R C  +  W GS  TC VR+CGP P     K+    TT+ +   ++C     LIG 
Sbjct:  658 CGPLVSPLNGTKTGSLTTFPNIITFKCDPGFNLIGSPKRTCQSNARWSG-------QMVSCKARDCGPLTTPRNGSKLGSLTTFPNKVHFWCDEGFD--LLGSKLRVCQANAIWSGDKVTCQARDCGPLNTPLNG-TKTGSLTTFPNTVKFMCDEGFNLIGSRN--------RTCQSNGKWSGQQVACGARDCGPLPTPMNGTKIGSLTTFPNKVTFTCVEGFNLIGSSIRHCQSDSTWSGSQPTCKVRDCGPLPVPANGKMLGLHTTYPSDIHFRCYKGFNLIGS 925          

HSP 2 Score: 109.383 bits (272), Expect = 1.127e-24
Identity = 87/338 (25.74%), Postives = 143/338 (42.31%), Query Frame = 3
Query:  399 CQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQT------------------DLCFSAPYIPYTQVHDNSNRDDFK-----------NGEDV----------KIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMG-VWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSG 1292
            C  P  P NG        VG +V +TCK G+ LKG   R C  + + +G++P C  +T                   L  S     +  ++  SN                NG  +          +  C  G+E     + +A C  +      + C   +CG L+ P +G ++  ++ T+ S  +  C+ G+ +  +          R C  +  WSG    C A+ C +L+ P NG  +G +W   N+++ F C EG++L GS +R C  +G+W+G+ S C   +CGP P  +   +  EAT +  Q E KC  R  ++  + F  C    + SG
Sbjct:  213 CGDPGLPENGAKVGLSYGVGARVFFTCKLGFNLKGSPSRRCGEDNKWTGTQPRCESKTVSFAERALAEEAFRLFYYKLPLSTLQKSHVDINSGSNSGSLALETLALIEAPTNGSVIGNETTFQKIMRFACDPGFE--MDGNPVAICQSDGKWSSTVTCNPVNCGSLDAPAHG-SVSGDSTTFTSRLVFSCDAGYIMSGSP--------IRTCLKNASWSGTQPRCDAVECGKLAVPRNGTRVGTLWTFPNTVR-FACDEGFELSGSAVRTCQADGSWNGTLSECNAVDCGPLPVPMNGSIPGEATVYPFQREVKCD-RGFILRGSRFRLCQADGSWSG 537          

HSP 3 Score: 105.916 bits (263), Expect = 1.528e-23
Identity = 102/413 (24.70%), Postives = 156/413 (37.77%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFIP-RCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGY 1625
            L C     P+NG    +     +QV ++C  G+ L G  +R C +N   SG    C          P +         +   F N   +   C  G+          + N   W    + C+ + CG L  P+NG  +  +  T+ +    +C++GF      D    K   R CQA+  WSGD   C A  C  L+ P NG   G   T  +   F C EG+ L GS  R C   G W G    C  R+CGP P  +        TT   +  + C     LIG +S   C      SG     +P C +       D   + +  N K    ++    T+ + +  +C  G+ L      +C  N  W+     C    C      M  S+V  L++   ++ ++ C  G+
Sbjct:  598 LDCGFLATPMNGSKIGAKTFFPNQVLFSCDEGFELIGSARRACLSNGSWSGVSVICKAHD----CGPLVSPLNGTKTGSLTTFPN--IITFKCDPGFNLIGSPKRTCQSNA-RWSGQMVSCKARDCGPLTTPRNGSKL-GSLTTFPNKVHFWCDEGF------DLLGSK--LRVCQANAIWSGDKVTCQARDCGPLNTPLNGTKTGSLTTFPNTVKFMCDEGFNLIGSRNRTCQSNGKWSGQQVACGARDCGPLPTPMNGTKIGSLTTFPNKVTFTCVEGFNLIG-SSIRHCQSDSTWSG----SQPTCKVR------DCGPLPVPANGK----MLGLHTTYPSDIHFRCYKGFNLIGSPTRSCQSNAKWSGKEVSCNAVDCGPLAAPMNGSSVGNLTV-FPNIIKFICDEGF 978          

HSP 4 Score: 97.8265 bits (242), Expect = 5.777e-21
Identity = 72/250 (28.80%), Postives = 107/250 (42.80%), Query Frame = 3
Query:  399 CQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNG--EDVKIICQNGYE---DPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTC 1130
            C P   P+NG    S+    ++V +TC  G+ L G   R+CQ++   SGS+P C  +   C   P      V  N            D+   C  G+     P +S     C  N +W    + C    CG L  P NG ++  N   + +I    C++GF +  ++          +C +DGKW G T  C A+ C  L  P NG +MG      +  +F C +G+ L GS +R C     W G N+ C
Sbjct:  832 CGPLPTPMNGTKIGSLTTFPNKVTFTCVEGFNLIGSSIRHCQSDSTWSGSQPTC--KVRDCGPLP------VPANGKMLGLHTTYPSDIHFRCYKGFNLIGSPTRS-----CQSNAKWSGKEVSCNAVDCGPLAAPMNGSSV-GNLTVFPNIIKFICDEGFDLLGSSVW--------RCSSDGKWDGITTTCKAVDCGPLVKPLNGSMMGSLTYYPNHVSFTCDKGFLLRGSEVRACQANRTWSGMNTRC 1059          

HSP 5 Score: 96.2857 bits (238), Expect = 1.793e-20
Identity = 103/444 (23.20%), Postives = 161/444 (36.26%), Query Frame = 3
Query:  372 LVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTA--------ILCPE-------------------------------------LSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWN-FIPRCVEAACSARPPSMKYS 1562
            + C+ + L C  P    N     +     D V YTC  G+ + G   + C A     G+ P C      C    +IP      N  ++ + +GE V   C+ GY     +  +  C   +W   P KCEK  CG    P+NG  +   +Y   +     C  GF ++ +          R+C  D KW+G    C +         L  E                                     +  P NG V+G   T   I  F C  G+++ G+ +  C  +G W  S  TC   NCG         V+ ++TT  ++  + C +   + G +   TC +  + SG     +P+C        V+  K+ +  N      +     T    VR  C+ G+EL+   +  C  +GSWN  +  C    C   P  M  S
Sbjct:   87 VTCLLVGLSCGQPRDVRNAEYKLTGTGFNDNVTYTCNEGFTVIGTVTKRCTAKGEWGGALPTCMAD---CPKPSHIPENAFIVN-EKERYMSGERVTFKCKPGYNQEGLATTL--CFLGDWNIMPFKCEKGGCGDPGLPENGAKV-GLSYGVGARVFFTCKLGFNLKGSPS--------RRCGEDNKWTGTQPRCESKTVSFAERALAEEAFRLFYYKLPLSTLQKSHVDINSGSNSGSLALETLALIEAPTNGSVIGNETTFQKIMRFACDPGFEMDGNPVAICQSDGKWS-STVTCNPVNCGSLDAPAHGSVSGDSTTFTSRLVFSCDAGYIMSG-SPIRTCLKNASWSG----TQPRCD------AVECGKLAVPRNGTRVGTLW----TFPNTVRFACDEGFELSGSAVRTCQADGSWNGTLSECNAVDCGPLPVPMNGS 499          

HSP 6 Score: 92.0485 bits (227), Expect = 3.403e-19
Identity = 74/286 (25.87%), Postives = 116/286 (40.56%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGE 1250
            ++C     P NG    ++    + V + C  G+ L G   R CQA+   +G+  EC +  D C   P      +   +    F+     ++ C  G+        + + +G+ W         + CG L  P NG T   +  T+ +     C++GF +  +          R CQ+ GKWSG+   C A+ C  L+ P NG  +G      +   F C EG++L GS  R C   G+W G +  C   +CGP    +        TT      +KC     LIG 
Sbjct:  429 VECGKLAVPRNGTRVGTLWTFPNTVRFACDEGFELSGSAVRTCQADGSWNGTLSEC-NAVD-CGPLPVPMNGSIPGEATVYPFQR----EVKCDRGFILRGSRFRLCQADGS-WSG-----RTRDCGPLATPTNG-TKTGSLTTFPNKVTFSCDEGFILIGSP--------LRSCQSSGKWSGEQVRCEALDCGFLATPMNGSKIGAKTFFPNQVLFSCDEGFELIGSARRACLSNGSWSGVSVICKAHDCGPLVSPLNGTKTGSLTTFPNIITFKCDPGFNLIGS 693          

HSP 7 Score: 85.1149 bits (209), Expect = 5.162e-17
Identity = 78/290 (26.90%), Postives = 108/290 (37.24%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDD----FKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGE 1250
            + C     P +G  +        ++ ++C +GY + G   R C  N   SG++P C         A       V  N  R      F N   V+  C  G+E    +    + +G+ W     +C    CG L  P NG ++      Y       C+ GF ++    +F      R CQADG WSG T  C       L+ P NG   G   T  +  TF C EG+ L GS LR C   G W G    C   +CG     +        T    Q  + C     LIG 
Sbjct:  371 VNCGSLDAPAHGSVSGDSTTFTSRLVFSCDAGYIMSGSPIRTCLKNASWSGTQPRC--------DAVECGKLAVPRNGTRVGTLWTFPN--TVRFACDEGFELSGSAVRTCQADGS-WNGTLSECNAVDCGPLPVPMNG-SIPGEATVYPFQREVKCDRGFILR--GSRF------RLCQADGSWSGRTRDCG-----PLATPTNGTKTGSLTTFPNKVTFSCDEGFILIGSPLRSCQSSGKWSGEQVRCEALDCGFLATPMNGSKIGAKTFFPNQVLFSCDEGFELIGS 635          

HSP 8 Score: 83.9593 bits (206), Expect = 1.001e-16
Identity = 84/364 (23.08%), Postives = 137/364 (37.64%), Query Frame = 3
Query:  909 RQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVR-NCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHC-KPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGSWNFIP-RCVEAACSARPPSMKYSTVRFLSLKHDSLARYY--CHFGYYIA---LRKDGMETLSTIFDIKCNKGN----------------WTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSI---KPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWS 1916
            R+C  D KW+G    C  + C  L  P NG V+G   T + I  F C  GY++HG     C   G W  + +  +V  +CG P ++  A+     T       Y C    T+IG T    C       G L    P C+  C KP  +      ++E          +    G  V  KC  GY         C+ G WN +P +C +  C    P +  +  + + L +   AR +  C  G+ +     R+ G +   T    +C                    + K+P    Q           +G + L   +     T+ S+   +    +++++ C P + + G  +A+C  +G WS
Sbjct:   17 RKCGKDNKWTGTQPRCEIVDCGPLRAPMNGHVIGNETTFHKIVRFSCNPGYKMHGYPDAICQANGEWSNTVTCLLVGLSCGQPRDVRNAEYKLTGTGFNDNVTYTCNEGFTVIG-TVTKRCTAKGEWGGAL----PTCMADCPKPSHIPENAFIVNE---------KERYMSGERVTFKCKPGYNQEGLATTLCFLGDWNIMPFKCEKGGCGD--PGLPENGAK-VGLSYGVGARVFFTCKLGFNLKGSPSRRCGEDNKWTGTQPRCESKTVSFAERALAEEAFRLFYYKLPLSTLQKSHVDINSGSNSGSLALETLALIEAPTNGSVIGNETTFQKIMRFACDPGFEMDGNPVAICQSDGKWS 363          

HSP 9 Score: 73.559 bits (179), Expect = 1.711e-13
Identity = 109/434 (25.12%), Postives = 169/434 (38.94%), Query Frame = 3
Query:  465 VEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKC--EKKSCGKLEDPKNGR-----TMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELS-PPENGEVMGVWNTVNSIK--TFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPP--PEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSA--------------KVYIHENNK-----------------TTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIA 1634
            V + CK G+ L G   R C  + + +G++P C    ++    P       H   N   F   + V+  C  GY+       I + NG EW  + + C     SCG+  D +N       T +N+N TY       CN+GF +  T          ++C A G+W G    C A  CP+ S  PEN  ++       S +  TFKCK GY   G     C   G+W+     C    CG P  PE   AKV       GA+  + CK    L G  S   CGE +  +G  P+ E K +   +    + A              K ++  N+                  T   ++ +E T    +R  C+ G+E++ + +  C  +G W+    C    C +   +  + +V   S    S   + C  GY ++
Sbjct:    1 VFFMCKYGFKLIGSPVRKCGKDNKWTGTQPRC----EIVDCGPLRAPMNGHVIGNETTFH--KIVRFSCNPGYKMHGYPDAICQANG-EWS-NTVTCLLVGLSCGQPRDVRNAEYKLTGTGFNDNVTYT------CNEGFTVIGTVT--------KRCTAKGEWGGALPTCMAD-CPKPSHIPENAFIVNEKERYMSGERVTFKCKPGYNQEGLATTLCFL-GDWNIMPFKCEKGGCGDPGLPENG-AKVGLSYGV-GARVFFTCKLGFNLKGSPS-RRCGEDNKWTGTQPRCESKTVSFAERALAEEAFRLFYYKLPLSTLQKSHVDINSGSNSGSLALETLALIEAPTNGSVIGNETTFQKIMRFACDPGFEMDGNPVAICQSDGKWSSTVTCNPVNCGSL-DAPAHGSVSGDSTTFTSRLVFSCDAGYIMS 406          
BLAST of C4b binding protein beta chain vs. Ensembl Nematostella
Match: EDO36504 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIF9])

HSP 1 Score: 120.168 bits (300), Expect = 3.429e-28
Identity = 84/296 (28.38%), Postives = 129/296 (43.58%), Query Frame = 3
Query:  375 VCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDV-KIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQF-CNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETS 1256
             C  +D  C P   PVNG +  S+    +++ + C  G+ L G R R CQ N + SG       +T  C +    P +   + S         +V K  C  G+ D   S +    +  +W  +   C+   CG L  P NG ++   N T     I+F C++GF +  ++         RQC + GKW+G    C A+ C  L  P NG  +G      +  TF C EG+ + GS  R+C     W G+ +TC   +CGP    V   +A +ATT      + C     L+G ++
Sbjct:  157 TCKAVD--CGPLTVPVNGSSAGSLTYFPNKISFECDKGFLLDGSRVRVCQENRKWSG-------ETTTCNAVDCGPLSIPLNGSRTGSLTIFPNVVKFSCDEGF-DLLGSSVRQCTSKGQWDGNTASCKAVDCGPLAAPMNGSSV--GNLTVFPNIIKFSCDEGFDLLGSS--------VRQCTSTGKWAGSKTSCKAVDCGPLPVPLNGTRVGSLTFYPNTMTFACDEGFLIRGSVTRRCQLNRRWSGTRTTCNAVDCGPLATPVNGSLAGDATTFPNIIRFTCDEGFDLLGSSA 432          

HSP 2 Score: 108.227 bits (269), Expect = 1.754e-24
Identity = 75/263 (28.52%), Postives = 114/263 (43.35%), Query Frame = 3
Query:  375 VCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQF-CNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPP 1157
            +C  +D  C P   P+NG  +  + +  +   ++C  G+ L G   R C A  R SG++  C    D     P           +   F N   +   C  G+        +  C  N +W  +   C    CG L  P NG      + T     ++F C++GF +  ++         RQC + G+W G+TA C A+ C  L+ P NG  +G      +I  F C EG+ L GS +R+CT  G W GS ++C   +CGP P
Sbjct:   99 ICRAVD--CGPLSPPMNGTLSGHLTVFPNSFSFSCDEGFDLLGSSVRQCTAERRWSGTQTTC-KAVDC---GPLTVPVNGSSAGSLTYFPN--KISFECDKGFL--LDGSRVRVCQENRKWSGETTTCNAVDCGPLSIPLNGS--RTGSLTIFPNVVKFSCDEGFDLLGSS--------VRQCTSKGQWDGNTASCKAVDCGPLAAPMNGSSVGNLTVFPNIIKFSCDEGFDLLGSSVRQCTSTGKWAGSKTSCKAVDCGPLP 341          

HSP 3 Score: 106.301 bits (264), Expect = 7.316e-24
Identity = 91/348 (26.15%), Postives = 132/348 (37.93%), Query Frame = 3
Query:  210 MKSAQYKPECHVKSLDNVKHLPNGCPSKACTANIDCWVEYDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGET 1253
            M S  Y P  HV    +   L  G   +AC AN   W   +               C  +D  C P   P NG  + S+ +  +   +TC  G+ L G   R C  +    G+   C        S P       H     + F         C  G+ D   S +        W      C+   CG L  P NG +  +  Y    I+ + C+ GF +        D +  R CQ + KWSG+T  C A+ C  LS P NG   G      ++  F C EG+ L GS +R+CT +G WDG+ ++C   +CGP    +        T      ++ C     L+G +
Sbjct:    1 MGSLTYYPN-HVSFTCDKGFLLRGSEVRACQAN-RTWSGMNTR-------------CEAVD--CGPLAAPRNGSMSGSLTVYPNTKTFTCDRGFELLGSSLRRCTPSGLWDGTNAICRAVDCGPLSPPMNGTLSGHLTVFPNSF------SFSCDEGF-DLLGSSVRQCTAERRWSGTQTTCKAVDCGPLTVPVNGSSAGSLTYFPNKISFE-CDKGFLL--------DGSRVRVCQENRKWSGETTTCNAVDCGPLSIPLNGSRTGSLTIFPNVVKFSCDEGFDLLGSSVRQCTSKGQWDGNTASCKAVDCGPLAAPMNGSSVGNLTVFPNIIKFSCDEGFDLLGSS 315          

HSP 4 Score: 99.3673 bits (246), Expect = 1.124e-21
Identity = 79/304 (25.99%), Postives = 128/304 (42.11%), Query Frame = 3
Query:  375 VCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPEC--------TDQTDLCFSAPY----IPYTQVHDNSNRDDFKNGED---------VKIICQN------GYEDP-YKSHIIAKCNGNEWKYDPIKCEK------------KSCGKLEDPKNG-----RTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGP 1151
             C  +D  C P   PVNG          + + +TC  G+ L G   R C  + + +G+   C            DL  S+ +    I  + +H  +    +  G+          + ++  +      G   P ++   +      EW  + ++  K              CG L  P+NG     RT + N  T++      C+ GF ++ ++         R CQA+  WSG+T  C A+ C  L+ P NG ++G      S+ +F C EG+ L GS LRKCT EG WDGS+++ +  +CGP
Sbjct:  389 TCNAVD--CGPLATPVNGSLAGDATTFPNIIRFTCDEGFDLLGSSARKCMPSRKWNGTLTSCKGKHVIHLMSSEDLGASSVHHQYVIDTSSLHHLNGNGRYPEGDKKGNLSKKCFIMLLLSDESRLRRGVRPPRFECENMHLKRSMEWDENYVQSNKILKNNIQVPLVAVDCGPLPSPRNGSMEGSRTFFPNKITFR------CDKGFTLKGSST--------RVCQANRAWSGETTTCQAVDCGRLNAPVNGSMIGALTVYPSVISFSCDEGFDLLGSSLRKCTSEGRWDGSSTSSV--DCGP 674          

HSP 5 Score: 70.8626 bits (172), Expect = 1.031e-12
Identity = 41/158 (25.95%), Postives = 73/158 (46.20%), Query Frame = 3
Query:  657 VKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTC 1130
            +   C  G+     S  + + N   W  +   C+   CG+L  P NG +M      Y S+    C++GF +  ++         R+C ++G+W G +   +++ C  LS P NG  +G      +   FKC +G+ + GS +R C     W+G+ ++C
Sbjct:  580 ITFRCDKGFTLKGSSTRVCQAN-RAWSGETTTCQAVDCGRLNAPVNG-SMIGALTVYPSVISFSCDEGFDLLGSS--------LRKCTSEGRWDGSST--SSVDCGPLSAPTNGSKIGSLTYYPNKVWFKCNKGFLMRGSQVRACQANQRWNGTRTSC 725          
BLAST of C4b binding protein beta chain vs. Ensembl Nematostella
Match: EDO43337 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ29])

HSP 1 Score: 103.99 bits (258), Expect = 3.814e-24
Identity = 95/367 (25.89%), Postives = 130/367 (35.42%), Query Frame = 3
Query:  471 YTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGP-PPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKV------------YIHENNKT----TNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGSWN-FIPRC 1517
            Y+C   Y  +GP  R C+   +  G +  C      C     IPY       +    + G  ++  C  G +    S +I      +W      C  KSCG    P NGR      YT++S     C+ G                RQCQ++ KWSG T  C    C +   P NG   G   T  S   F C  G+   G   R+C     W G   TC   +CG  P     AK     TT+  +  ++C  +   +  +    C E     G   K        C P + D                YI+ +  T     NF M     HG  V   CN G++L       C +G+WN  IP C
Sbjct:    2 YSCTQPYQRRGPETRTCRGIGKWDGKKTRCRK---FCKDPGDIPYGNRDKGRSDSSHRVGTSIRYWCFPGTQ-LVGSAVITCMKSGDWSDKTPNCSPKSCGDPGTPANGR-RSGQVYTFKSKVFFSCDRG--------HIRVGPAFRQCQSNQKWSGVTPTCQPKSCGDPGTPANGGRSGQVYTFKSKVFFSCDRGHIRVGPAFRQCQSNQKWSGVTPTCQPVDCGSLPTPKNGAKTEETKTTYQGRVSFRCVKKGHELKGSRVRVCQEDGRWDGTFTK--------CDPVECDDPGTPRFGGRNPDKDKYIYGDTVTYECKKNFTMRSNYEHGQSVSFGCNKGFQLKGASAIVCNSGNWNDTIPTC 347          

HSP 2 Score: 71.633 bits (174), Expect = 2.212e-13
Identity = 71/268 (26.49%), Postives = 104/268 (38.81%), Query Frame = 3
Query:  453 VGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNE-WKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENG-EVMGVWNTVNSIKTFKC-KEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPP--PEIVFAKVAYEATTHGAQAEYKCKSRSTL 1241
            VG  + Y C  G  L G     C  +   S   P C+ ++  C      P T  +   +   +     V   C  G+          +C  N+ W      C+ KSCG    P NG       YT++S     C+ G                RQCQ++ KWSG T  C  + C  L  P+NG +      T     +F+C K+G++L GS +R C  +G WDG+ + C    C  P  P         +   +G    Y+CK   T+
Sbjct:   57 VGTSIRYWCFPGTQLVGSAVITCMKSGDWSDKTPNCSPKS--CGD----PGTPANGRRSGQVYTFKSKVFFSCDRGHI--RVGPAFRQCQSNQKWSGVTPTCQPKSCGDPGTPANG-GRSGQVYTFKSKVFFSCDRG--------HIRVGPAFRQCQSNQKWSGVTPTCQPVDCGSLPTPKNGAKTEETKTTYQGRVSFRCVKKGHELKGSRVRVCQEDGRWDGTFTKCDPVECDDPGTPRFGGRNPDKDKYIYGDTVTYECKKNFTM 307          

HSP 3 Score: 68.1662 bits (165), Expect = 2.514e-12
Identity = 69/268 (25.75%), Postives = 95/268 (35.45%), Query Frame = 3
Query:  399 CQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNE-WKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCR-RQCQADGKWSGDTAICTAILCPELSPPENGE--------VMGVWNTVNSIK--------------TFKCKEGYQLHGSHLRKCTREGNWDGSNSTC 1130
            C  P  P NG  +  +     +V ++C  G+   GP  R CQ+N + SG  P C  Q   C      P T  +   +   +     V   C  G+          +C  N+ W      C+   CG L  PKNG        TYQ             +C     E K  R R CQ DG+W G    C  + C +   P  G         + G   T    K              +F C +G+QL G+    C   GNW+ +  TC
Sbjct:   97 CGDPGTPANGRRSGQVYTFKSKVFFSCDRGHIRVGPAFRQCQSNQKWSGVTPTC--QPKSCGD----PGTPANGGRSGQVYTFKSKVFFSCDRGHI--RVGPAFRQCQSNQKWSGVTPTCQPVDCGSLPTPKNGAKTEETKTTYQGRV--------SFRCVKKGHELKGSRVRVCQEDGRWDGTFTKCDPVECDDPGTPRFGGRNPDKDKYIYGDTVTYECKKNFTMRSNYEHGQSVSFGCNKGFQLKGASAIVCN-SGNWNDTIPTC 347          
BLAST of C4b binding protein beta chain vs. Ensembl Nematostella
Match: EDO36528 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIG6])

HSP 1 Score: 102.064 bits (253), Expect = 3.264e-23
Identity = 84/301 (27.91%), Postives = 120/301 (39.87%), Query Frame = 3
Query:  378 CMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAIC--------TAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETS 1256
            C  +D  C   V P NG    S    G     TC  GY L G + R CQA+   SG++  C  +   C   P + + Q+  N     ++    ++I C  GY+       I + +G  W   P KC+   CG+L  P NG+ +  +  TY S     C++G+ +             R CQA+G WSG    C        + I C     P +G V G   T  S   F C  GY + GS +R C    +W G+   C   +CG         +    TT+       C +   LIG  S
Sbjct:  112 CSAVD--CGNLVNPANGETTGSSTTYGSTASVTCHEGYDLIGSKSRVCQADGTWSGNDTWCKGRE--CGPMPPLAHGQISGNGT--SYRT--VLRISCHPGYQFAGSDVSICQASG-LWSVIP-KCKVIDCGRLTVPLNGK-LEGSLTTYSSTINITCDEGYALIGPES--------RVCQANGTWSGSNVTCRGWFNTNPSLIDCGSPGAPAHGSVSGDSTTFTSRLAFSCDAGYIMSGSLIRTCLENASWSGTQPRCSAVDCGTLDSPANGIMRGSVTTYRGVVNITCDTGFHLIGSHS 393          

HSP 2 Score: 100.908 bits (250), Expect = 9.639e-23
Identity = 101/416 (24.28%), Postives = 154/416 (37.02%), Query Frame = 3
Query:  399 CQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKC--LLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFI-PRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYI 1631
            C  P  P +G        VG +V +TCK G+ L G   R C  +   +G +P C        + P       H + + D       +   C +GY        I  C  N  W     +C    CG L +P NG T   ++ TY S A   C++G+      D    K+  R CQADG WSG+   C    C  + P  +G++ G   +  ++    C  GYQ  GS +  C   G W      C V +CG     +  K+    TT+ +     C     LIG  S      V   +G        C    +  P  +D        +      +  D  T  + +   C+ GY ++  ++  C  N SW+   PRC    C     S     +R     +  +    C  G+++
Sbjct:    1 CFDPGVPTHGRKMGVQYDVGSRVYFTCKHGFVLTGSSVRTCGPDFNWTGIQPTCKAVDCGYHNKP------AHGSVSGDSTTFTSRLVFSCDSGYI--MSGSPIRTCLENGSWSGTQPRCSAVDCGNLVNPANGETT-GSSTTYGSTASVTCHEGY------DLIGSKS--RVCQADGTWSGNDTWCKGRECGPMPPLAHGQISGNGTSYRTVLRISCHPGYQFAGSDVSICQASGLWS-VIPKCKVIDCGRLTVPLNGKLEGSLTTYSSTINITCDEGYALIGPES-----RVCQANGTWSGSNVTCRGWFNTNPSLIDCGSPGAPAHGS----VSGDSTTFTSRLAFSCDAGYIMSGSLIRTCLENASWSGTQPRCSAVDCGTL-DSPANGIMRGSVTTYRGVVNITCDTGFHL 388          

HSP 3 Score: 70.8626 bits (172), Expect = 5.053e-13
Identity = 81/319 (25.39%), Postives = 126/319 (39.50%), Query Frame = 3
Query:  969 CPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFIPR-CVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWS 1916
            C +   P +G  MGV   V S   F CK G+ L GS +R C  + NW G   TC   +CG   +     V+ ++TT  ++  + C S   + G +   TC E  + SG     +P+C        VD   +    N +TT        T+G+     C+ GY+L       C  +G+W+     C    C   PP + +  +      + ++ R  CH GY  A          +   I    G W+ +P   C+   C +   P NG++             +     ++  +   C   Y L GP+  VC  NG WS
Sbjct:    1 CFDPGVPTHGRKMGVQYDVGSRVYFTCKHGFVLTGSSVRTCGPDFNWTGIQPTCKAVDCGYHNKPAHGSVSGDSTTFTSRLVFSCDSGYIMSG-SPIRTCLENGSWSG----TQPRC------SAVDCGNLVNPANGETTG----SSTTYGSTASVTCHEGYDLIGSKSRVCQADGTWSGNDTWCKGRECGPMPP-LAHGQISGNGTSYRTVLRISCHPGYQFA---------GSDVSICQASGLWSVIPK--CKVIDCGRLTVPLNGKL-------------EGSLTTYSSTINITCDEGYALIGPESRVCQANGTWS 279          
BLAST of C4b binding protein beta chain vs. Ensembl Nematostella
Match: EDO34701 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNM5])

HSP 1 Score: 98.5969 bits (244), Expect = 7.271e-23
Identity = 70/263 (26.62%), Postives = 105/263 (39.92%), Query Frame = 3
Query:  849 CNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFI-PRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYI 1631
            CNDGF++          +  R CQ+DG WSG    C A  CP+   P  G V+G+  +V     F+C+EGY++ G     C   G+WD    TC + +CG PP +    +     T+G++ +Y+C     L G         V    G      P CL           +   +  N        ++ T+G  V   CN G+ ++      C  NG W    P C  A C    P    +  +  +  + S   Y C  GY +
Sbjct:   11 CNDGFRLV--------GSATRTCQSDGLWSGLQPSCVAAACPDPVAPAKGLVVGLQRSVGDTVRFECQEGYRVSGKAYSVCQSSGSWDSPTPTCAIVDCGKPPALASGSIVGSVYTYGSKIQYRCIQDWHLSGPAE-----RVCQADGLWSGKAPVCL----------ERSCGNPGNLANGKRTGEDFTYGKVVTFTCNSGHVMSGSSTRTCQTNGKWTGTQPTCDPAICG--DPGAPVNGEKTGAFTYGSTLTYDCMPGYKL 248          

HSP 2 Score: 93.9745 bits (232), Expect = 2.325e-21
Identity = 77/262 (29.39%), Postives = 107/262 (40.84%), Query Frame = 3
Query:  465 VEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGE 1250
            V  TC  G+ L G   R CQ++   SG +P C          P  P   +     R     G+ V+  CQ GY    K++ + + +G+ W      C    CGK     +G ++  + YTY S  IQ+       +C  D        R CQADG WSG   +C    C       NG+  G   T   + TF C  G+ + GS  R C   G W G+  TC    CG P   V  +    A T+G+   Y C     L+G+
Sbjct:    7 VHITCNDGFRLVGSATRTCQSDGLWSGLQPSCVAAA---CPDPVAPAKGLVVGLQR---SVGDTVRFECQEGYRVSGKAYSVCQSSGS-WDSPTPTCAIVDCGKPPALASG-SIVGSVYTYGS-KIQY-------RCIQDWHLSGPAERVCQADGLWSGKAPVCLERSCGNPGNLANGKRTGEDFTYGKVVTFTCNSGHVMSGSSTRTCQTNGKWTGTQPTCDPAICGDPGAPVNGE-KTGAFTYGSTLTYDCMPGYKLVGD 251          

HSP 3 Score: 84.7297 bits (208), Expect = 3.568e-18
Identity = 66/264 (25.00%), Postives = 101/264 (38.26%), Query Frame = 3
Query:  339 QLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTC 1130
            + C  D    GL    +   C  PV P  G        VGD V + C+ GY + G     CQ++       P C      C   P +    +  +     +  G  ++  C   +     +  + + +G  W      C ++SCG   +  NG+     ++TY  +    CN G  +  ++         R CQ +GKW+G    C   +C +   P NGE  G + T  S  T+ C  GY+L G   R C     W GS   C
Sbjct:   23 RTCQSDGLWSGLQPSCVAAACPDPVAPAKGLVVGLQRSVGDTVRFECQEGYRVSGKAYSVCQSSGSWDSPTPTCAIVD--CGKPPALASGSIVGSV----YTYGSKIQYRCIQDWHLSGPAERVCQADG-LWSGKAPVCLERSCGNPGNLANGKRT-GEDFTYGKVVTFTCNSGHVMSGSS--------TRTCQTNGKWTGTQPTCDPAICGDPGAPVNGEKTGAF-TYGSTLTYDCMPGYKLVGDRQRTCQANAQWTGSQPHC 269          

HSP 4 Score: 65.855 bits (159), Expect = 7.183e-12
Identity = 51/190 (26.84%), Postives = 80/190 (42.11%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTA 962
            + C  P    +G    S+   G +++Y C   + L GP +R CQA+   SG  P C +++  C +    P    +     +DF  G+ V   C +G+     S    + NG +W      C+   CG    P NG       +TY S     C  G+K+        D+  +R CQA+ +W+G    CT 
Sbjct:   99 VDCGKPPALASGSIVGSVYTYGSKIQYRCIQDWHLSGPAERVCQADGLWSGKAPVCLERS--CGN----PGNLANGKRTGEDFTYGKVVTFTCNSGHVMSGSSTRTCQTNG-KWTGTQPTCDPAICGDPGAPVNGEK--TGAFTYGSTLTYDCMPGYKL------VGDR--QRTCQANAQWTGSQPHCTG 271          

HSP 5 Score: 48.9062 bits (115), Expect = 2.917e-6
Identity = 68/306 (22.22%), Postives = 115/306 (37.58%), Query Frame = 3
Query: 1020 TVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF-IPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWT-KMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQ 1925
            +++S     C +G++L GS  R C  +G W G   +C+   C  P       V     + G    ++C+    + G+ ++  C      SG    P P C +      VD  K     +      I+    T+G+ ++ +C   + L+      C  +G W+   P C+E +C   P ++           +  +  + C+ G+ ++       T  T        G WT   PT  C P  C  P  P NGE              K+    +   + Y+C P Y+L G +   C  N  W+  Q
Sbjct:    2 SLDSDVHITCNDGFRLVGSATRTCQSDGLWSGLQPSCVAAACPDPVAPAKGLVVGLQRSVGDTVRFECQEGYRVSGK-AYSVC----QSSGSWDSPTPTCAI------VDCGKPPALASGS----IVGSVYTYGSKIQYRCIQDWHLSGPAERVCQADGLWSGKAPVCLERSC-GNPGNLANGKRTGEDFTYGKVVTFTCNSGHVMS--GSSTRTCQT-------NGKWTGTQPT--CDPAICGDPGAPVNGE--------------KTGAFTYGSTLTYDCMPGYKLVGDRQRTCQANAQWTGSQ 266          

HSP 6 Score: 48.521 bits (114), Expect = 3.721e-6
Identity = 33/104 (31.73%), Postives = 45/104 (43.27%), Query Frame = 3
Query:  258 NVKHLPNGCPSKACTANIDCWVEYDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQ 569
            N  H+ +G  ++ C  N   W          CD  +CG            P  PVNG    +    G  + Y C  GY L G R+R CQAN + +GS+P CT +
Sbjct:  186 NSGHVMSGSSTRTCQTNGK-WTGTQP----TCDPAICG-----------DPGAPVNGEKTGA-FTYGSTLTYDCMPGYKLVGDRQRTCQANAQWTGSQPHCTGE 272          
BLAST of C4b binding protein beta chain vs. Ensembl Medaka
Match: csmd2 (CUB and Sushi multiple domains 2 [Source:NCBI gene;Acc:101155284])

HSP 1 Score: 114.775 bits (286), Expect = 9.858e-26
Identity = 140/544 (25.74%), Postives = 211/544 (38.79%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGP--RKRYCQANLRLSGSE--PECTDQTDLCFSAPYIPYTQVHDNSNRDDF--KNGED--VKIICQNGYEDPYKSHIIAKCNGN-EWKY-DP-IKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDN---KSGWLPKPEPKC-LLHC-KPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWN-FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCN-KGNWTKMP------TEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWSPPQMPTCEFI 1946
            + C  PV PVNG        +G +  Y C  G+ L GP      CQ + R S  E  P C     L  + P I ++ V     R  +  +N  D  + ++C  GY   Y+   I +C  N  W Y DP   C+  SCG L  P NG  +      Y + AI  CN G+ +  +          R+C ++G WSG    C A  C    P  NG+++G          ++C  G++L G  +R C ++  W G    C+   CG P    F       TT G Q  +        +  T ++  G V +    SG    P P+C +++C +P  V+++   +  +            +  T V  +CN GY L      +C  +G+W+  +P+C+   C   P    Y+ +        S+ RY C           G  T+       C   G W+  P      + G            + GE + +G                  VV++ C P Y LKG     CL NG W   Q P C+ I
Sbjct: 2523 MSCGMPVPPVNGSIAGQEFSLGAKATYQCNPGFRLSGPITTSLICQESGRWSPIEAPPRC-----LSVTCPDIGHSAVEHGRWRLIYGTQNQYDAMMMLVCDPGYY--YRGQRIIRCQENGTWNYPDPHPVCDIISCGDLGTPPNGNKI-GTLTVYGATAIFSCNTGYTLVGSR--------VRECMSNGLWSGTQVQCLAGHCGSPEPIVNGQIIGENYNYRGSVVYQCNPGFRLIGVSVRICEQDHRWSGRTPVCVPITCGHPGNPTF------GTTQGTQ--FNLNDVVRFVCNTGYVLQGAVKSTCQASGQWSNPLPRCKIVNCTEPGHVENSIRQVLSSGA-------HRYSFQTTVSYRCNPGYYLLGTSSISCQGDGTWDRSLPKCLLMLCD-HPSVSPYAKISGDRRTVGSVIRYSCM----------GQRTVIGNTTRMCQLDGQWSGSPPHCSGESSGLCGDPGVPVHGIRLGEEFTVGS-----------------VVRFSCEPGYVLKGSSERTCLANGTWLNTQ-PECQVI 3006          

HSP 2 Score: 113.235 bits (282), Expect = 3.019e-25
Identity = 118/502 (23.51%), Postives = 180/502 (35.86%), Query Frame = 3
Query:  399 CQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAK-CNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWN-FIPRCVEAACS--ARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIA-------LRKDGMETLSTIFDIKCNKGNWTKMPTEGCQX--------XXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRV 1841
            C  P  PV+G        VG  V ++C+ GY LKG  +R C AN     ++PEC   +      P   +  +HD            +   C+ GY   Y + ++ + C  N  W  +  +C   +CG    P NG   +  +++Y       C+ GF +        D+     C  D  W+G   +C AI+C       NG+V+G   T  S  ++ C +GYQL    +  C   GNW G    C    CG P      +       + +   + C     L+G              G     +P C+        D +       N +  F +      G+ V   C  GY L   I   C  N +W+ F P C+   CS    P       +   SL +  +  Y C  G+Y+A        R DG  +         N+G   K P    Q                +   G    LG+     L+  + +P+ NRV
Sbjct: 2950 CGDPGVPVHGIRLGEEFTVGSVVRFSCEPGYVLKGSSERTCLANGTWLNTQPECQVISCGNPGTPRNSHILIHDG-----LTFSRSITYSCREGY---YSTGLLTRHCTVNGTWTGNMPECSVINCGDPGVPANG-VRFGTDFSYNHTVSFQCSPGFTMDA------DRASTLICTKDRTWNGTKPLCKAIVCGPPPTIPNGQVVGTDFTWGSSISYSCNQGYQLSLPTVLTCQGNGNWSGEKPQCFPVFCGDPGTPAHGRREDRGFNYLSSVSFSCNHPLVLVGSAR-----RYCQYDGTWSGTQPSCIDPSHTTCSDPSTPLFGNQNNSQGFQI------GSTVFFNCRKGYLLQGSISRTCQPNLTWSGFQPECIAHHCSQPELPAQSDVKAIELPSLGYTLI--YTCQPGFYLAGGSEHRTCRSDGSWSGKAPLCAADNRGKIEKSPVGPVQEPPSKLPVPSGVFAKNSLWTGSYEYLGKKQPAMLSITAFEPLSNRV 3423          

HSP 3 Score: 98.9821 bits (245), Expect = 8.018e-21
Identity = 116/439 (26.42%), Postives = 174/439 (39.64%), Query Frame = 3
Query:  348 VCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENG--EVMGVWNTVNSIKT---FKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSW-NFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLA-----RYYCHFGYY 1628
            VCD   CG      DL   P     NG+   ++ + G    ++C +GY L G R R C +N   SG++ +C      C S    P   V+     +++     V   C  G+     S  I + + + W      C   +CG   +P  G T     +    +    CN G+ +Q           +  CQA G+WS     C  + C E    EN   +V+       S +T   ++C  GY L G+    C  +G WD S   C++  C  P    +AK++ +  T G+   Y C  + T+IG T+ +   ++D +  W   P P C         D   V +H         + +E T G+ VR  C  GY L       C  NG+W N  P C   +C   P + + S +    L HD L       Y C  GYY
Sbjct: 2646 VCDIISCG------DLGTPP-----NGNKIGTLTVYGATAIFSCNTGYTLVGSRVRECMSNGLWSGTQVQCL--AGHCGS----PEPIVNGQIIGENYNYRGSVVYQCNPGFRLIGVSVRICEQD-HRWSGRTPVCVPITCGHPGNPTFGTTQ-GTQFNLNDVVRFVCNTGYVLQGAV--------KSTCQASGQWSNPLPRCKIVNCTEPGHVENSIRQVLSSGAHRYSFQTTVSYRCNPGYYLLGTSSISCQGDGTWDRSLPKCLLMLCDHPSVSPYAKISGDRRTVGSVIRYSCMGQRTVIGNTTRMC--QLDGQ--WSGSP-PHCSGESSGLCGDPG-VPVH------GIRLGEEFTVGSVVRFSCEPGYVLKGSSERTCLANGTWLNTQPECQVISC-GNPGTPRNSHI----LIHDGLTFSRSITYSCREGYY 3040          

HSP 4 Score: 86.2705 bits (212), Expect = 7.157e-17
Identity = 141/583 (24.19%), Postives = 216/583 (37.05%), Query Frame = 3
Query:  231 PECHVKSLDNVKHLPNG-----CPSKACTANIDCWVEY----DRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSC---GKLEDP-KNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRN---CGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF-IPRCVEAACSARPPSMKYSTVRF-LSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWS 1916
            P C + S  ++   PNG           TA   C   Y     R + C+ +    G     +   C  P   VNG            V Y C  G+ L G   R C+ + R SG  P C   T      P    TQ         F   + V+ +C  GY    +  + + C  + +W     +C+  +C   G +E+  +   +   + Y++Q+     CN G+ +  T+           CQ DG W      C  +LC   S     ++ G   TV S+  + C     + G+  R C  +G W GS   C   +   CG P   V      E  T G+   + C+    L G +S  TC  + N + WL   +P+C       QV S        N  ++ ++HD +T    +   C  GY     +   C  NG+W   +P C    C    P +  + VRF     ++    + C  G+ +   +      ST+   K    N TK     C+   C  PPT  NG++        T  T  S        + Y C+  Y+L  P +  C  NG+WS
Sbjct: 2645 PVCDIISCGDLGTPPNGNKIGTLTVYGATAIFSCNTGYTLVGSRVRECMSNGLWSGTQVQCLAGHCGSPEPIVNGQIIGENYNYRGSVVYQCNPGFRLIGVSVRICEQDHRWSGRTPVCVPITCGHPGNPTFGTTQ------GTQFNLNDVVRFVCNTGYV--LQGAVKSTCQASGQWSNPLPRCKIVNCTEPGHVENSIRQVLSSGAHRYSFQTTVSYRCNPGYYLLGTSSI--------SCQGDGTWDRSLPKCLLMLCDHPSVSPYAKISGDRRTVGSVIRYSCMGQRTVIGNTTRMCQLDGQWSGSPPHCSGESSGLCGDPGVPVHGIRLGEEFTVGSVVRFSCEPGYVLKG-SSERTC--LANGT-WL-NTQPEC-------QVISCGNPGTPRN--SHILIHDGLTFSRSITYSCREGYYSTGLLTRHCTVNGTWTGNMPECSVINCGD--PGVPANGVRFGTDFSYNHTVSFQCSPGFTMDADR-----ASTLICTKDRTWNGTK---PLCKAIVCGPPPTIPNGQVV------GTDFTWGS-------SISYSCNQGYQLSLPTVLTCQGNGNWS 3174          

HSP 5 Score: 65.0846 bits (157), Expect = 2.583e-10
Identity = 102/441 (23.13%), Postives = 169/441 (38.32%), Query Frame = 3
Query:  729 EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQ--CTTDQFEDKNCRRQCQADGKWSGDTAI--CTAILCPEL--SPPENGE---VMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWD--GSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLL-HC-KPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF-IPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCN-KGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWSPPQMPTCEFIMHDELPISWLYYRSDDKK 2000
            +W      C+  SCG    P NG ++    ++  + A   CN GF++    TT           CQ  G+WS   A   C ++ CP++  S  E+G    + G  N  +++    C  GY   G  + +C   G W+    +  C + +CG              T +GA A + C +  TL+G +    C      +G     + +CL  HC  P  + + ++ I EN      +++           +CN G+ L    +  C  +  W+   P CV   C   P +  + T +      + + R+ C+ GY           L       C   G W+  P   C+   CT+P   +N        S R  L+  + +      V Y C+P Y L G     C  +G W    +P C  ++ D   +S     S D++
Sbjct: 2512 QWNAPVPLCQVMSCGMPVPPVNG-SIAGQEFSLGAKATYQCNPGFRLSGPITTSLI--------CQESGRWSPIEAPPRCLSVTCPDIGHSAVEHGRWRLIYGTQNQYDAMMMLVCDPGYYYRGQRIIRCQENGTWNYPDPHPVCDIISCGDLGTPPNGNKIGTLTVYGATAIFSCNTGYTLVG-SRVREC----MSNGLWSGTQVQCLAGHCGSPEPIVNGQI-IGENYNYRGSVVY-----------QCNPGFRLIGVSVRICEQDHRWSGRTPVCVPITC-GHPGNPTFGTTQGTQFNLNDVVRFVCNTGY----------VLQGAVKSTCQASGQWSN-PLPRCKIVNCTEPGHVEN--------SIRQVLSSGAHRYSFQTTVSYRCNPGYYLLGTSSISCQGDGTWD-RSLPKCLLMLCDHPSVSPYAKISGDRR 2905          
BLAST of C4b binding protein beta chain vs. Ensembl Medaka
Match: CSMD1 (CUB and Sushi multiple domains 1 [Source:NCBI gene;Acc:101164142])

HSP 1 Score: 114.39 bits (285), Expect = 1.248e-25
Identity = 110/447 (24.61%), Postives = 166/447 (37.14%), Query Frame = 3
Query:  336 AQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPEC--TDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAI---LCPELS-PPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAY-EATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYEL-----NSDILPACYNGSWNFI-PRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIAL 1637
             ++C  D    G   + + + C  P  P NG  N +   + D V +TC  GY L G  +  C+ N + S   P C   + +D       +  + +H     + F  G  V I C+ G+     S I+   +   W     +C   SCG    P N   +   ++TY S+         +  C        N  R CQ DG WSG    CT     +C +   PP    + G      S+  F C+ GY L GS  R C   G W G+   C   +CG P      ++   +  T G    Y C        +TS LT         W  +P    ++ C      +  +Y           + ++ T    V  +CN G+ +      SD++     G+WN   P C    C   PP + Y  V    L   S   Y C  GY +++
Sbjct: 2581 VRICQQDHRWSGTTPVCVPITCGHPGNPPNGRTNGTEFNLNDVVNFTCNKGYILSGSPRAQCRLNGQWSSPLPVCKVVNCSDPGHVENGVRQSGLH---YPEVFSYGVTVAIHCKRGFY-LLGSAILTCQHDGLWDRPMPRCLAISCGDPGVPPNAVVLGTRSWTYGSV--------LQYSCLPSGLLVGNSTRHCQEDGTWSGVPPYCTGASVGICGDPGIPPHGSRLGGEEFKTKSLLRFSCEAGYSLIGSAERTCLHNGTWSGTQPVCQAVSCGNPGTPAHGRIVLNDGITFGNSVAYACLEGF----KTSGLTTRHCTTNGTWTGQPPDCTVISCGDPGPIANGIY-----------LGNDFTFNHTVVYRCNPGHLMEPSGPGSDVIRCSKEGTWNQTKPSCKVIQCGP-PPQVLYGKVEGSDLSWGSSVSYNCFHGYQLSI 2999          

HSP 2 Score: 104.76 bits (260), Expect = 1.367e-22
Identity = 110/427 (25.76%), Postives = 165/427 (38.64%), Query Frame = 3
Query:  414 QPVNGHA-NHSILLVGDQVEYTCKSGYALKGPRKRYCQAN----LRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYE-DPYKSHIIAKCNGNEWK--YDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDG--FKIQCTTDQFEDKNCRR-QCQADGKWSG--DTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF-IPRCVEAACSARPPSMKYSTVRFLSLKHDSLARY------YCHFGYYI 1631
             P+NG   N + L  G +++Y C  GY L G     C+ N     +     P C  Q   C     IP +  + + +   F  G  V   C  GY  DP             W     P +C    C  +E      T+ +++ T++ +       G    ++C++  +     R   C A+G W G  D A C  I C EL  P  G  +G   T  +   F C  GY L GSH+R+C  +G W G+ + C+  +C  P  IV   ++ + +++     Y+C     LIG TS   C +    SG  P         C P          +     T F ++D V         CN GY L+      C  NG W+  +P C    CS   P    + VR   L +  +  Y      +C  G+Y+
Sbjct: 2300 SPLNGGVVNRTKLSPGSRIQYFCNRGYYLVGSSNATCRLNSNGLYKWDSPPPFC--QAISC----GIPLSPGNGSFHATQFTVGSQVTYYCSQGYHLDPAVPMTAVCLEDGSWSNSLSPPRCLPVHCPSIE------TILSDHMTFRLLRGILGEFGSMVMLECSSGYYLGAGYRTLHCLANGTWEGSDDPATCKIISCGELPSPPFGTKLGTLTTFGATTIFMCNHGYTLVGSHVRECGADGLWSGAETRCLAGHCDSPDPIVNGHISGDGSSYRDTVVYQCMLGYRLIG-TSVRICQQDHRWSGTTPV--------CVPITCGHPGNPPNGRTNGTEFNLNDVVNF------TCNKGYILSGSPRAQCRLNGQWSSPLPVCKVVNCSD--PGHVENGVRQSGLHYPEVFSYGVTVAIHCKRGFYL 2697          

HSP 3 Score: 80.1073 bits (196), Expect = 5.604e-15
Identity = 129/542 (23.80%), Postives = 193/542 (35.61%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECT----DQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENG---------EVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCG----PPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNFI-PRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHP--LYRLKGPK---IAVCLNGHWSPPQMPTCEFI 1946
            + C     P  G    ++   G    + C  GY L G   R C A+   SG+E  C     D  D        P    H + +   ++  + V   C  GY     S  I + + + W      C   +CG   +P NGRT     +    +    CN G+ +  +         R QC+ +G+WS    +C  + C +    ENG         EV     TV       CK G+ L GS +  C  +G WD     C+  +CG    PP  +V    ++   T+G+  +Y C     L+G ++   C E    SG  P      +  C         +  H +      +  +E    + +R  C  GY L       C +NG+W+   P C   +C           V    +   +   Y C  G+    +  G+ T           G WT  P + C    C  P    NG IYL   +D T           N  V Y C+P  L    GP    I     G W+  + P+C+ I
Sbjct: 2484 ISCGELPSPPFGTKLGTLTTFGATTIFMCNHGYTLVGSHVRECGADGLWSGAETRCLAGHCDSPD--------PIVNGHISGDGSSYR--DTVVYQCMLGYRLIGTSVRICQQD-HRWSGTTPVCVPITCGHPGNPPNGRTN-GTEFNLNDVVNFTCNKGYILSGSP--------RAQCRLNGQWSSPLPVCKVVNCSDPGHVENGVRQSGLHYPEVFSYGVTV----AIHCKRGFYLLGSAILTCQHDGLWDRPMPRCLAISCGDPGVPPNAVVLGTRSW---TYGSVLQYSCLPSGLLVGNST-RHCQEDGTWSGVPPYCTGASVGICG-----DPGIPPHGSR-----LGGEEFKTKSLLRFSCEAGYSLIGSAERTCLHNGTWSGTQPVCQAVSCGNPGTPAHGRIVLNDGITFGNSVAYACLEGF----KTSGLTTRHCT-----TNGTWTGQPPD-CTVISCGDPGPIANG-IYL--GNDFT----------FNHTVVYRCNPGHLMEPSGPGSDVIRCSKEGTWNQTK-PSCKVI 2963          

HSP 4 Score: 67.3958 bits (163), Expect = 4.202e-11
Identity = 79/331 (23.87%), Postives = 122/331 (36.86%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALK--GPRKRY--CQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAIL---CPELSPPENG-EVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKV-AYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAK 1358
            + C  P    NG    +       V Y C  G+ ++  GP      C      + ++P C  +   C   P + Y +V  +    D   G  V   C +GY+    + +  + NG  W  +  +C +K C              N     S+ ++ C    +  C        +  R CQADG WSG+   C       C +   P  G  V+     V S  +FKC++ Y + GS  R C     W G+   C+  +C  P       V + +  T G    Y C+    L G +   TC + D +  W  KP       CK  ++ S K
Sbjct: 2901 ISCGDPGPIANGIYLGNDFTFNHTVVYRCNPGHLMEPSGPGSDVIRCSKEGTWNQTKPSC--KVIQCGPPPQVLYGKVEGS----DLSWGSSVSYNCFHGYQLSIPAVLTCEGNGT-WTGEVPQCLRKLC-------------INTEALISMRVRVCRSEVRFYCHAPHVLVGSASRLCQADGIWSGEQPACIDPAFNSCRDPGTPAYGIPVVAQGFQVGSKISFKCRKNYHILGSTTRTCLENLTWSGTQPECVAHSCRQPETPTNVDVRSMDLPTLGYTLLYTCQEGFYLSGGSEHRTC-KSDGR--WSGKPP-----LCKGMEIQSQK 3203          
BLAST of C4b binding protein beta chain vs. Ensembl Medaka
Match: csmd2 (CUB and Sushi multiple domains 2 [Source:NCBI gene;Acc:101155284])

HSP 1 Score: 109.768 bits (273), Expect = 3.684e-24
Identity = 102/418 (24.40%), Postives = 156/418 (37.32%), Query Frame = 3
Query:  399 CQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAK-CNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWN-FIPRCVEAACS--ARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIA 1634
            C  P  PV+G        VG  V ++C+ GY LKG  +R C AN     ++PEC   +      P   +  +HD            +   C+ GY   Y + ++ + C  N  W  +  +C   +CG    P NG   +  +++Y       C+ GF +        D+     C  D  W+G   +C AI+C       NG+V+G   T  S  ++ C +GYQL    +  C   GNW G    C    CG P      +       + +   + C     L+G              G     +P C+        D +       N +  F +      G+ V   C  GY L   I   C  N +W+ F P C+   CS    P       +   SL +  +  Y C  G+Y+A
Sbjct: 2917 CGDPGVPVHGIRLGEEFTVGSVVRFSCEPGYVLKGSSERTCLANGTWLNTQPECQVISCGNPGTPRNSHILIHDG-----LTFSRSITYSCREGY---YSTGLLTRHCTVNGTWTGNMPECSVINCGDPGVPANG-VRFGTDFSYNHTVSFQCSPGFTMDA------DRASTLICTKDRTWNGTKPLCKAIVCGPPPTIPNGQVVGTDFTWGSSISYSCNQGYQLSLPTVLTCQGNGNWSGEKPQCFPVFCGDPGTPAHGRREDRGFNYLSSVSFSCNHPLVLVGSAR-----RYCQYDGTWSGTQPSCIDPSHTTCSDPSTPLFGNQNNSQGFQI------GSTVFFNCRKGYLLQGSISRTCQPNLTWSGFQPECIAHHCSQPELPAQSDVKAIELPSLGYTLI--YTCQPGFYLA 3306          

HSP 2 Score: 106.686 bits (265), Expect = 3.703e-23
Identity = 141/561 (25.13%), Postives = 214/561 (38.15%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGP--RKRYCQANLRLSGSE--PECTDQTDLCFSAPYIPYTQVHDNSNRDDF--KNGED--VKIICQNGYEDPYKSHIIAKCNGN-EWKY-DP-IKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAIL----------CPELS-------PPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDN---KSGWLPKPEPKC-LLHC-KPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWN-FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCN-KGNWTKMP------TEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWSPPQMPTCEFI 1946
            + C  PV PVNG        +G +  Y C  G+ L GP      CQ + R S  E  P C     L  + P I ++ V     R  +  +N  D  + ++C  GY   Y+   I +C  N  W Y DP   C+  SCG L  P NG  +      Y + AI  CN G+ +  +          R+C ++G WSG    C   L          CP ++       P  NG+++G          ++C  G++L G  +R C ++  W G    C+   CG P    F       TT G Q  +        +  T ++  G V +    SG    P P+C +++C +P  V+++   +  +            +  T V  +CN GY L      +C  +G+W+  +P+C+   C   P    Y+ +        S+ RY C           G  T+       C   G W+  P      + G            + GE + +G                  VV++ C P Y LKG     CL NG W   Q P C+ I
Sbjct: 2473 MSCGMPVPPVNGSIAGQEFSLGAKATYQCNPGFRLSGPITTSLICQESGRWSPIEAPPRC-----LSVTCPDIGHSAVEHGRWRLIYGTQNQYDAMMMLVCDPGYY--YRGQRIIRCQENGTWNYPDPHPVCDIISCGDLGTPPNGNKI-GTLTVYGATAIFSCNTGYTLVGSR--------VRECMSNGLWSGTQVQCLVQLFTEKHSKHSFCPYIAGHCGSPEPIVNGQIIGENYNYRGSVVYQCNPGFRLIGVSVRICEQDHRWSGRTPVCVPITCGHPGNPTF------GTTQGTQ--FNLNDVVRFVCNTGYVLQGAVKSTCQASGQWSNPLPRCKIVNCTEPGHVENSIRQVLSSGA-------HRYSFQTTVSYRCNPGYYLLGTSSISCQGDGTWDRSLPKCLLMLCD-HPSVSPYAKISGDRRTVGSVIRYSCM----------GQRTVIGNTTRMCQLDGQWSGSPPHCSGESSGLCGDPGVPVHGIRLGEEFTVGS-----------------VVRFSCEPGYVLKGSSERTCLANGTWLNTQ-PECQVI 2973          

HSP 3 Score: 104.375 bits (259), Expect = 1.691e-22
Identity = 122/456 (26.75%), Postives = 182/456 (39.91%), Query Frame = 3
Query:  348 VCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQ--TDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCN---------------GNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENG--EVMGVWNTVNSIKT---FKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSW-NFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLA-----RYYCHFGYY 1628
            VCD   CG      DL   P     NG+   ++ + G    ++C +GY L G R R C +N   SG++ +C  Q  T+      + PY   H  S  +   NG+   II +N Y   Y+  ++ +CN                + W      C   +CG   +P  G T     +    +    CN G+ +Q           +  CQA G+WS     C  + C E    EN   +V+       S +T   ++C  GY L G+    C  +G WD S   C++  C  P    +AK++ +  T G+   Y C  + T+IG T+ +   ++D +  W   P P C         D   V +H         + +E T G+ VR  C  GY L       C  NG+W N  P C   +C   P + + S +    L HD L       Y C  GYY
Sbjct: 2596 VCDIISCG------DLGTPP-----NGNKIGTLTVYGATAIFSCNTGYTLVGSRVRECMSNGLWSGTQVQCLVQLFTEKHSKHSFCPYIAGHCGS-PEPIVNGQ---IIGEN-YN--YRGSVVYQCNPGFRLIGVSVRICEQDHRWSGRTPVCVPITCGHPGNPTFGTTQ-GTQFNLNDVVRFVCNTGYVLQGAV--------KSTCQASGQWSNPLPRCKIVNCTEPGHVENSIRQVLSSGAHRYSFQTTVSYRCNPGYYLLGTSSISCQGDGTWDRSLPKCLLMLCDHPSVSPYAKISGDRRTVGSVIRYSCMGQRTVIGNTTRMC--QLDGQ--WSGSP-PHCSGESSGLCGDPG-VPVH------GIRLGEEFTVGSVVRFSCEPGYVLKGSSERTCLANGTWLNTQPECQVISC-GNPGTPRNSHI----LIHDGLTFSRSITYSCREGYY 3007          

HSP 4 Score: 62.3882 bits (150), Expect = 1.552e-9
Identity = 64/276 (23.19%), Postives = 95/276 (34.42%), Query Frame = 3
Query:  321 VEYDRAQLCVC--DSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDP--IKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGV-WNTVNSIKTFKCKEGYQLHG-SHLRKCTREGNWDGSNSTC 1130
            ++ DRA   +C  D    G   +   + C PP    NG    +    G  + Y+C  GY L  P    CQ N   SG +P+C      C      P T  H       F     V   C +       +    + +G      P  I     +C     P  G    +  +   S     C  G+ +Q         +  R CQ +  WSG    C A  C +   P   +V  +   ++     + C+ G+ L G S  R C  +G+W G    C
Sbjct: 3066 MDADRASTLICTKDRTWNGTKPLCKAIVCGPPPTIPNGQVVGTDFTWGSSISYSCNQGYQLSLPTVLTCQGNGNWSGEKPQCFPV--FCGD----PGTPAHGRREDRGFNYLSSVSFSCNHPLVLVGSARRYCQYDGTWSGTQPSCIDPSHTTCSDPSTPLFGNQNNSQGFQIGSTVFFNCRKGYLLQ--------GSISRTCQPNLTWSGFQPECIAHHCSQPELPAQSDVKAIELPSLGYTLIYTCQPGFYLAGGSEHRTCRSDGSWSGKAPLC 3327          

HSP 5 Score: 59.3066 bits (142), Expect = 1.343e-8
Identity = 48/189 (25.40%), Postives = 69/189 (36.51%), Query Frame = 3
Query:  399 CQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGN-EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTA 962
            C  P  P +G            V ++C     L G  +RYCQ +   SG++P C D +    S P  P     +NS    F+ G  V   C+ GY    +  I   C  N  W     +C    C + E P           +     I  C  GF +   ++        R C++DG WSG   +C  
Sbjct: 3152 CGDPGTPAHGRREDRGFNYLSSVSFSCNHPLVLVGSARRYCQYDGTWSGTQPSCIDPSHTTCSDPSTPLFGNQNNSQ--GFQIGSTVFFNCRKGYL--LQGSISRTCQPNLTWSGFQPECIAHHCSQPELPAQSDVKAIELPSLGYTLIYTCQPGFYLAGGSEH-------RTCRSDGSWSGKAPLCAG 3329          
BLAST of C4b binding protein beta chain vs. Ensembl Medaka
Match: csmd3a (CUB and Sushi multiple domains 3 [Source:NCBI gene;Acc:101161736])

HSP 1 Score: 105.916 bits (263), Expect = 6.995e-23
Identity = 121/503 (24.06%), Postives = 170/503 (33.80%), Query Frame = 3
Query:  378 CMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQF----------------------------------------------------EDKNCRRQCQADGKWSGDTAICTAILCPELSPP--ENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWNFI-PRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWT-KMPT 1715
            C+ +D  C  P  P NG  +      G  V Y+C  G  LKG   R CQ N   S   P C+         P IP      +  + DFK    V   C  GYE    S  +   NG  W      C+   CG    P NGR    +  T+    I  C DG+ +   T +                                                     ED +  R C  +G WSG   ICTA+ C  LSPP   NG + G      S  ++ C  GY+L    +  C   G W G    C+ + CG P   V       +  + ++  + C     L+G T+   C      SG     +P+C+   +    +         N+T  F +      G+ V   C  G+ +       C  + +W+   P C+  AC      +    V            Y C  GY++A    G E       +  N G WT KMP 
Sbjct: 2765 CIVVD--CGHPGSPPNGALSGDKFTFGSTVRYSCLGGRQLKGESSRTCQLNGMWSFPMPFCSGDIAGSCGDPGIP---AQGSREQTDFKIRSKVHFTCSEGYELIGSSERMCFPNGT-WSGTQPFCKPVQCGNPGTPSNGRVFRLDGTTFSHSVIYSCMDGYILTGPTTRLCQANGTWSGAQPNCTMINCGDPGVPANGLRYGEDFTIGQNVTFQCQPGYRMEEDGSPVRMCTHNGTWSGSMPICTAVTC--LSPPAISNGALQGSDFEWGSSVSYSCSPGYELSFPAVLTCVSNGTWSGMLPQCLPKFCGDPGTPVGGSREGRSFIYQSEVSFSCSPPLILVG-TATRRCESDGTWSG----TQPRCIEPTRTSCENPGTPRYGSLNRTFGFKV------GSIVSFHCQPGHLIQGSSSRTCQPDLTWSGTQPECIPHACKQPESPLHVDVVGMDLPGFGYTLVYSCQHGYFLA---GGSE-----HRVCKNDGTWTGKMPV 3240          

HSP 2 Score: 104.76 bits (260), Expect = 1.574e-22
Identity = 107/444 (24.10%), Postives = 173/444 (38.96%), Query Frame = 3
Query:  336 AQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNS-NRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAIL---CPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKV-AYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKC-LLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPA---CYNGSWN-FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIAL 1637
             ++C+ D+   G + + I + C  P  P+ G    +   + + V + C  GY ++GP    CQAN + +   P C  +   C S P IP   +  +     +F  G  V   C  GY   + S ++      +W     +C    CG    P NG  +  + +T+ S     C  G +++  +         R CQ +G WS     C+  +   C +   P  G        + S   F C EGY+L GS  R C   G W G+   C    CG P      +V   + TT      Y C     L G T+ L        +G     +P C +++C    V +  +   E           + T G +V  +C  GY +  D  P     +NG+W+  +P C    C + PP++    ++    +  S   Y C  GY ++ 
Sbjct: 2629 VRICLQDNQWSGQLPICIPISCGHPGSPIYGRTVGNGYNLNNVVSFVCNRGYEMEGPAHAQCQANRQWNHPPPTC--KVVNC-SDPGIPANSIRQSKIEHGNFTFGTVVFYDCNPGYYL-FGSPVLTCQPTGQWDKPLPECIVVDCGHPGSPPNG-ALSGDKFTFGSTVRYSCLGGRQLKGESS--------RTCQLNGMWSFPMPFCSGDIAGSCGDPGIPAQGSREQTDFKIRSKVHFTCSEGYELIGSSERMCFPNGTWSGTQPFCKPVQCGNPGTPSNGRVFRLDGTTFSHSVIYSCMDGYILTGPTTRLC-----QANGTWSGAQPNCTMINCGDPGVPANGLRYGE-----------DFTIGQNVTFQCQPGYRMEEDGSPVRMCTHNGTWSGSMPICTAVTCLS-PPAISNGALQGSDFEWGSSVSYSCSPGYELSF 3042          

HSP 3 Score: 97.4413 bits (241), Expect = 2.825e-20
Identity = 149/583 (25.56%), Postives = 219/583 (37.56%), Query Frame = 3
Query:  369 GLVCMEIDLQCQPPVQPVNGH-ANHSILLVGDQVEYTCKSGYALKGPRKRYCQANL----RLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGY--------------EDPYKSH-IIAKCNGNEW---KYDPIKC---------EKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCG----PPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF-IPRCV-EAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCEFIMHDE--LPISWLYYRSD 1991
            G     + + C  P  P++G  ++ S   V   V + C  GY L G     C+           S P C  Q   C   P  P   ++      D+  G  V   C +GY              +  + +H  I +C+G  W   K D + C             CG  E   NG+ +   N+ Y+   +  C  GF++  ++         R C  D +WSG   IC  I C     P  G  +G    +N++ +F C  GY++ G    +C     W+    TC V NC     P   I  +K+ +   T G    Y C     L G +  LTC      +G   KP P+C++      VD      H  +     +  D+ T G+ VR  C  G +L  +    C  NG W+F +P C  + A S   P +     R    + D   R   HF        +G E + +   +    G W+      C+P +C  P TP NG ++ L   D T  +   I         Y C   Y L GP   +C  NG WS  Q P C  I   +  +P + L Y  D
Sbjct: 2435 GFRIRYVAMYCSTPDSPLHGSISSQSGGHVNSVVRWACDRGYRLIGNATGTCRRTPLGYHAWDSSVPAC--QAVSC--GP--PKAPINGAVLASDYSVGTRVSYFCNDGYRLSSKEVTSAICQPDGTWSNHNKIPRCSG--WIFLKLDFVVCPSIGSFSLEHAGHCGIPEGIVNGQVI-GENFGYRDTVVYQCLPGFRLIGSS--------VRICLQDNQWSGQLPICIPISCGHPGSPIYGRTVGNGYNLNNVVSFVCNRGYEMEGPAHAQCQANRQWNHPPPTCKVVNCSDPGIPANSIRQSKIEHGNFTFGTVVFYDCNPGYYLFG-SPVLTC----QPTGQWDKPLPECIV------VDCG----HPGSPPNGALSGDKFTFGSTVRYSCLGGRQLKGESSRTCQLNGMWSFPMPFCSGDIAGSCGDPGIPAQGSR---EQTDFKIRSKVHF-----TCSEGYELIGSSERMCFPNGTWSGT-QPFCKPVQCGNPGTPSNGRVFRL---DGTTFSHSVI---------YSCMDGYILTGPTTRLCQANGTWSGAQ-PNCTMINCGDPGVPANGLRYGED 2963          

HSP 4 Score: 58.5362 bits (140), Expect = 2.411e-8
Identity = 65/269 (24.16%), Postives = 94/269 (34.94%), Query Frame = 3
Query:  336 AQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDP--IKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGV-WNTVNSIKTFKCKEGYQLH-GSHLRKCTREGNWDGSNSTC 1130
             ++C  +    G + +   + C  P    NG    S    G  V Y+C  GY L  P    C +N   SG  P+C  +   C      P T V  +     F    +V   C         +    + +G      P  I+  + SC     P+ G       +   SI    C  G  IQ ++         R CQ D  WSG    C    C +   P + +V+G+          + C+ GY L  GS  R C  +G W G    C
Sbjct: 2987 VRMCTHNGTWSGSMPICTAVTCLSPPAISNGALQGSDFEWGSSVSYSCSPGYELSFPAVLTCVSNGTWSGMLPQCLPK--FCGD----PGTPVGGSREGRSFIYQSEVSFSCSPPLILVGTATRRCESDGTWSGTQPRCIEPTRTSCENPGTPRYGSLNRTFGFKVGSIVSFHCQPGHLIQGSSS--------RTCQPDLTWSGTQPECIPHACKQPESPLHVDVVGMDLPGFGYTLVYSCQHGYFLAGGSEHRVCKNDGTWTGKMPVC 3241          

HSP 5 Score: 51.9878 bits (123), Expect = 2.282e-6
Identity = 47/221 (21.27%), Postives = 82/221 (37.10%), Query Frame = 3
Query:  321 VEYDRAQLCVCDSYLCGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRD-DFKNGEDVKIICQNGYEDPYKSHIIAKCNGN------EWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTA 962
            + +     CV +    G++   +   C  P  PV G       +   +V ++C     L G   R C+++   SG++P C + T      P  P    + + NR   FK G  V   CQ G       H+I   +         W     +C   +C + E P +   +  +   +    +  C  G+ +   ++        R C+ DG W+G   +C A
Sbjct: 3040 LSFPAVLTCVSNGTWSGMLPQCLPKFCGDPGTPVGGSREGRSFIYQSEVSFSCSPPLILVGTATRRCESDGTWSGTQPRCIEPTRTSCENPGTPR---YGSLNRTFGFKVGSIVSFHCQPG-------HLIQGSSSRTCQPDLTWSGTQPECIPHACKQPESPLHVDVVGMDLPGFGYTLVYSCQHGYFLAGGSEH-------RVCKNDGTWTGKMPVCRA 3243          
BLAST of C4b binding protein beta chain vs. Ensembl Medaka
Match: svep1 (sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1 [Source:NCBI gene;Acc:101171700])

HSP 1 Score: 105.145 bits (261), Expect = 1.133e-22
Identity = 110/429 (25.64%), Postives = 168/429 (39.16%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGS-WN-FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGY------YIALRKDG 1649
            I  +C+ P  P +G  N +   VG  V Y+C+ GY LKG   R C +    +   P C   +  C +   I     H      DF   E +   C  G+     S  IA     +W      CE   CG    P +  T+    YTY S     C  GF ++  +           CQADG WS ++  C    C + SP  +G  MG     NS   ++C  GY+L G     C  +G WD     C + +C PP +I    +   +  +    EY C     ++G+   L C       G +P+ +P C+  C    V   KV            +      G  ++ +C+ GY+L       C  G  W+  +P C    CS+ PP +  + ++  ++     A Y C  GY      +++  +DG
Sbjct: 2534 IPAECETPPNPEHGWVNVTDASVGSIVTYSCERGYELKGESVRQCISGHLWTSDAPTCHPIS--CDNPGPIDNGTTHGV----DFVYLEVMHFECDPGFVL-RGSDTIACLADGKWNGQKPLCEPVLCGPPIVPSD-VTVEGKEYTYNSRIELSCPPGFVLKGMSVHV--------CQADGTWSHESPTCIPARCSKPSPIPHGHYMGSEFGYNSKVKYECDRGYKLSGDPTLVCKSDGLWDKPVPRCDIISCDPPEDISHGFLNGSSFNYNDVVEYVCFDGYEIVGD-PVLRCSYEGLWLGSVPECQP-CV--CALPGVKFGKV------------LSSGHACGDRLQFQCDKGYKLLGPSQATCEKGGVWSPGVPMCSRGRCSSPPPVVPNAVLQGDTVTLLDTAIYKCRPGYQRKGPLFVSCGRDG 2930          

HSP 2 Score: 100.908 bits (250), Expect = 2.121e-21
Identity = 127/518 (24.52%), Postives = 189/518 (36.49%), Query Frame = 3
Query:  435 NHSILLVGDQ----VEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKC-NGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKT-----TNFIMHDEVTHGTHVRAKCNFGYELNSDILPACY-NGSWN-FIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWSPPQMPTCEFIM 1949
            NH +L   D     VE +C+ GY L+G +   C  +   + + P C  +   C   P I +     +           V   C +G+   +K      C    +W     +C    C +  +  NG  +      Y S A+  C  G+ +          N    C   G W G    C  I CP      NG+V           T+ C  G++L G  + KC   GNWD     C+  +C PP  I    V  +  + G    Y C     L+G+   LTC EV   S         C L   P  +D    Y+   + T     T   +     HGT +  +C+ GYE+       C  NG WN   P C+ A C   PP+ ++  V        S+  Y C  GY   L+ + +         +C  G+        C P  C  P    NG             T   +  ++  V+ +EC P + L+G     CL +G W+  Q P CE ++
Sbjct: 2182 NHMVLKRLDYESGIVELSCEIGYVLEGAQIIRCTPSQEWNDTFPVC--KQVFCGPPPEISFGAPSSSPPFSFSSV---VTYTCMDGFS--FKKEDFVSCLVSGQWSTPYPECIPVECPQPVEISNG-IVDVQGLMYLSKALYTCKSGYNLV--------GNSTVLCGERGIWIGGVPSCRPIECPIPKQVANGKVAYRKLQFGHSATYSCHRGFRLEGPEMVKCLANGNWDLEPPNCVQISCTPPKAIENGFVEGQDHSFGVTIFYSCFPGFQLVGQ-DHLTCEEVGWSSSVPVCVPSDCGL---PPHIDFGD-YVRVTDSTSIDALTAAPLDLNFLHGTLIEYRCHKGYEITFHTRLMCQENGGWNGTAPSCIPAECET-PPNPEHGWVNVTDASVGSIVTYSCERGY--ELKGESVR--------QCISGHLWTSDAPTCHPISCDNPGPIDNG-------------TTHGVDFVYLEVMHFECDPGFVLRGSDTIACLADGKWN-GQKPLCEPVL 2653          

HSP 3 Score: 98.5969 bits (244), Expect = 1.125e-20
Identity = 126/528 (23.86%), Postives = 204/528 (38.64%), Query Frame = 3
Query:  405 PPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSC---GKLEDPKNGRTMYNNNYTYQSIAIQF-CNDGFKIQCTTDQFEDKNCRRQCQADGKW--SGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRN---CGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCK-PFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNG-SW-NFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKG-NWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWSPPQMPTCEFI 1946
            PPV P       ++ L+ D   Y C+ GY  KGP    C  + +    EP    +   C   P I + QV +    D+F     +   C +GYE    +  ++  +   W    IKC    C     L DP     +     T     I F C  GF +Q         +   +CQ  G W  S  T  C  ++C +  P  +G + G       +  + C  G+ + G  ++ C  +  W+G+   C+  +   CGPPP +  A+    A +H     Y C +   L+G  + LTC  + + +  LP P  +    C  P Q+   +V  H        I++ E      +  +C+ G+ L  D L  C  G +W +  P C   +C   PP  + ++ R +     S   +Y   G  + +     + +     I C     WT + +  C+   C  P    NG +    +    +  D         V  Y C+  Y ++G   + C  NG W+PP  PTC  +
Sbjct: 2889 PPVVPNAVLQGDTVTLL-DTAIYKCRPGYQRKGPLFVSCGRDGQWG--EPRIRCEAVNCGKPPAILHAQVLE----DNFTFPNKITYRCDDGYELATLAASLSCQSDGTWSKRNIKCHPTPCLLPSNLSDPH--LVVSGRKLTPVGDTITFSCPPGFYLQ--------GSALAECQVGGIWAPSISTVFCKMVVCEKPPPLLHGVIKGDSYNYGDLVLYSCLPGFDMKGEAVQTCQADRKWNGTQPVCVASSEYACGPPPTVSHAQFRITAESHLLNVSYLCNAGMQLVGPET-LTC--LADGTWSLPAPTCEVARGCDGPVQLVHGRVQDH--------ILNSE----RALEFQCDKGFSLVGDHLVVCLGGNTWSSAFPTCQPKSCPP-PPGWRGNSSRSVG----SHQEFY--VGQSVPVSCPKGQKVKGSGSITCRPDQTWTSV-SSVCERVPCGPPLHVANGVV----RGAVFQFGD---------VAVYSCYAGYTMEGVGRSRCQENGTWTPP--PTCRAV 3361          

HSP 4 Score: 96.2857 bits (238), Expect = 5.858e-20
Identity = 136/553 (24.59%), Postives = 207/553 (37.43%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTD------------------QFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPE----PKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGS-WNFIP---RCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNW-TKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVC-LNGHWSPPQMPTCEFIMHDELPI 1967
            + C  P    NG    +    G  V Y C +G+ L G  + YC  N +  G  P C D  +    +         D       KN  D   IC   +  PY           + K   +KC+         P+ G  +  +N+   S  +  C++G+K+  ++                   Q    + +  C+ +G+WS     C +I C +    ++   +G    + +   + CKEGY L G   R+C   G W  S++ C+ R+CGPPP I  A+       +G  A Y C     + G T+      V N  G    P+    P+C+ +  P  +D     +   +K        +    T V  KC  G+  N+     C  G  W   P    C+   CS +P S+++  V   +    ++  Y C  G+ I  R +   T           G W   +P   C P  C+ PP  +NG I       R+ LT KS        V Y C   YRL G    VC  N  WS  + PTC  +     PI
Sbjct: 1631 VSCGRPHPLENGLFQGADFHAGSSVVYQCNAGFYLLGDARVYCSNNGKWGGHPPACLDVDECALGS---------DCDTHASCKN-TDGSYICTCIH--PYT---------GDGKNCTVKCQNPG-----SPEFGHRV-GSNFLMGSQVVFSCDEGYKLYGSSKLRCLESGVWDDPVPIVLLQRPQGSMKVVCEENGEWSRPVPRCVSIKCSQPPALKDAITVGENFEMGNKVHYVCKEGYTLIGPESRECLLTGQWSESSAQCVPRSCGPPPAIDHAEPYESHQLYGDTANYYC-----IDGYTASNNSKMVCNAQGVWAPPDGLEVPRCIANFCPRPLDLPHAILDAVSKP-------KYPTNTEVIYKCEEGFMPNTTASLRCLMGGIWEPSPFEISCIPVRCS-KPESIEHGYVAETNYSFGAVVAYSCDPGFMI--RGEKRRTCQA-------NGEWGGALPV--CMPVTCSSPPLLRNGYI-----KTRSGLTFKS-------KVTYACREGYRLDGRPERVCQANRKWSSQETPTCVLLTCKPPPI 2120          

HSP 5 Score: 93.9745 bits (232), Expect = 2.891e-19
Identity = 128/525 (24.38%), Postives = 203/525 (38.67%), Query Frame = 3
Query:  387 IDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQF-CNDGFKIQCTTDQFEDKNCRRQCQADGKWSG-DTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVF-AKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCL-LHC-KPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYEL--NSDILPACYNGSW-NFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTC 1937
            I ++C  P    +G+   +    G  V Y+C  G+ ++G ++R CQAN    G+ P C   T  C S P +    +   S    FK+   V   C+ GY    +   + + N      +   C   +C     P     +Y  +       +Q+ CN+G+++        DKN        G W       C+ + CPE    EN  V+   +  + I    C+ GY L G+ + +CT    W+ +   C    CGPPPEI F A  +    +  +   Y C    +   E  F++C      SG    P P+C+ + C +P ++ +  V +              + + +     C  GY L  NS +L     G W   +P C    C   P  +    V +  L+    A Y CH G+    R +G E +  + +     GNW   P   C    CT P   +NG  ++ GQ     +T           + Y C P ++L G     C    WS   +P C
Sbjct: 1993 IPVRCSKPESIEHGYVAETNYSFGAVVAYSCDPGFMIRGEKRRTCQANGEWGGALPVCMPVT--CSSPPLLRNGYIKTRSGLT-FKS--KVTYACREGYRLDGRPERVCQANRKWSSQETPTCVLLTCKP--PPIIPHGVYKGSDFQVGHKVQYVCNEGYELSGDAIWTCDKN--------GTWDKMKPPRCSPVKCPEPLLEENHMVLKRLDYESGIVELSCEIGYVLEGAQIIRCTPSQEWNDTFPVCKQVFCGPPPEISFGAPSSSPPFSFSSVVTYTCMDGFSFKKE-DFVSC----LVSGQWSTPYPECIPVECPQPVEISNGIVDVQ------------GLMYLSKALYTCKSGYNLVGNSTVLCG-ERGIWIGGVPSCRPIECPI-PKQVANGKVAYRKLQFGHSATYSCHRGF----RLEGPEMVKCLAN-----GNWDLEPPN-CVQISCTPPKAIENG--FVEGQDHSFGVT-----------IFYSCFPGFQLVGQDHLTCEEVGWS-SSVPVC 2459          

HSP 6 Score: 93.9745 bits (232), Expect = 3.150e-19
Identity = 136/590 (23.05%), Postives = 211/590 (35.76%), Query Frame = 3
Query:  399 CQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKI------QCTTD------------------------------------QFE-DKN------CRRQCQADGKWSGDTAICTAILCPELSPP---ENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPK-CLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGSWNFIPRCVEAACSA----RPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCL-NGHWSPPQMPTCEFIMHDELPISWLYYRSDD 1994
            C PP+ P +            ++E +C  G+ LKG     CQA+   S   P C      C     IP    H +    +F     VK  C  GY+      ++ K +G  W     +C+  SC   ED  +G  +  +++ Y  +    C DG++I      +C+ +                                    QF+ DK        +  C+  G WS    +C+   C   SPP    N  + G   T+     +KC+ GYQ  G     C R+G W      C   NCG PP I+ A+V  +  T   +  Y+C     L    + L+C      S    K  P  CLL   P  +    + +     T    + D +T        C  G+ L    L  C  G   + P      C      +PP + +  ++  S  +  L  Y C  G+   ++ + ++T          K N T+          C  PPT  + +  +  +S             H   V Y C+   +L GP+   CL +G WS P  PTCE     + P+  ++ R  D
Sbjct: 2654 CGPPIVPSDVTVEGKEYTYNSRIELSCPPGFVLKGMSVHVCQADGTWSHESPTCIPAR--CSKPSPIP----HGHYMGSEFGYNSKVKYECDRGYKLSGDPTLVCKSDG-LWDKPVPRCDIISCDPPEDISHG-FLNGSSFNYNDVVEYVCFDGYEIVGDPVLRCSYEGLWLGSVPECQPCVCALPGVKFGKVLSSGHACGDRLQFQCDKGYKLLGPSQATCEKGGVWSPGVPMCSRGRCS--SPPPVVPNAVLQGDTVTLLDTAIYKCRPGYQRKGPLFVSCGRDGQWGEPRIRCEAVNCGKPPAILHAQVLEDNFTFPNKITYRCDDGYELATLAASLSCQSDGTWSKRNIKCHPTPCLL---PSNLSDPHLVVSGRKLTP---VGDTITF------SCPPGFYLQGSALAECQVGGI-WAPSISTVFCKMVVCEKPPPLLHGVIKGDSYNYGDLVLYSCLPGF--DMKGEAVQTCQAD-----RKWNGTQPVCVASSEYACGPPPTVSHAQFRITAES-------------HLLNVSYLCNAGMQLVGPETLTCLADGTWSLP-APTCEVARGCDGPVQLVHGRVQD 3199          

HSP 7 Score: 85.5001 bits (210), Expect = 1.437e-16
Identity = 131/582 (22.51%), Postives = 206/582 (35.40%), Query Frame = 3
Query:  393 LQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCG-----------KLEDPKNGRTM----YNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEY------KCKSRSTLIGETSFLTCGEVDNKSGWLPKPEP-----------------------KCLLHCKP-FQVDSAKVYIHENNKTTN--------------------FIMHDEVTHGTHVRAKCNFGYELNSDILPAC-YNGSWNF-IPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTC 1937
            ++C  P Q  NG   +  L  G    Y+C  G+ L+GP    C AN       P C   +     A    + +  D+S       G  +   C  G++   + H+   C    W      C    CG           ++ D  +   +     + N+ + ++    C+ G++I   T        R  CQ +G W+G    C    C     PE+G V     +V SI T+ C+ GY+L G  +R+C     W     TC   +C  P  I         TTHG    Y      +C     L G  + + C      +G  P  EP                       +  L C P F +    V++ + + T +                      M  E  + + V+ +C+ GY+L+ D    C  +G W+  +PRC   +C   P  + +  +   S  ++ +  Y C  GY I     G   L   ++     G W     E CQP  C  P     G++   G +   RL             +++C   Y+L GP  A C  G    P +P C
Sbjct: 2347 IECPIPKQVANGKVAYRKLQFGHSATYSCHRGFRLEGPEMVKCLANGNWDLEPPNCVQISCTPPKAIENGFVEGQDHSF------GVTIFYSCFPGFQLVGQDHLT--CEEVGWSSSVPVCVPSDCGLPPHIDFGDYVRVTDSTSIDALTAAPLDLNFLHGTLIEYRCHKGYEITFHT--------RLMCQENGGWNGTAPSCIPAECETPPNPEHGWVNVTDASVGSIVTYSCERGYELKGESVRQCISGHLWTSDAPTCHPISCDNPGPI------DNGTTHGVDFVYLEVMHFECDPGFVLRGSDT-IACLADGKWNGQKPLCEPVLCGPPIVPSDVTVEGKEYTYNSRIELSCPPGFVLKGMSVHVCQADGTWSHESPTCIPARCSKPSPIPHGHYMGSEFGYNSKVKYECDRGYKLSGDPTLVCKSDGLWDKPVPRCDIISCDP-PEDISHGFLNGSSFNYNDVVEYVCFDGYEIV----GDPVLRCSYE-----GLWLGSVPE-CQPCVCALPGVKF-GKVLSSGHACGDRL-------------QFQCDKGYKLLGPSQATCEKGGVWSPGVPMC 2880          

HSP 8 Score: 69.3218 bits (168), Expect = 1.235e-11
Identity = 46/134 (34.33%), Postives = 70/134 (52.24%), Query Frame = 3
Query:  954 CTAILCPELSPPENGE-VMGVWNT-VNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGP--PPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCL-LHCKPF 1340
            C  + CP LSPPENG  V  V N   ++    +C+ G++L G+ +R C  +G W G+ ++C VR+C P   P   F K     T +GA+ +  C     L G ++ LTC      S W  +P+P+C+ + C P 
Sbjct:  338 CQVVYCPALSPPENGFFVQNVCNNHFDAACGVRCQPGFELQGTGIRLCQADGTWSGTPASCRVRSCPPLSRPHHGFLKCGDGGTAYGAECQVGCARGYRLEGNST-LTC---QANSEW-SEPQPRCVEVRCSPI 466          

HSP 9 Score: 58.5362 bits (140), Expect = 2.808e-8
Identity = 52/178 (29.21%), Postives = 73/178 (41.01%), Query Frame = 3
Query:  747 IKCEKKSCGKLEDPKNGRTMYN--NNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVM-GVWNTVNSIK-TFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTC 1268
            + C+   C  L  P+NG  + N  NN+   +  ++ C  GF++Q T          R CQADG WSG  A C    CP LS P +G +  G   T    +    C  GY+L G+    C     W      C+   C P   IV  K       +   +   C  ++ L G T  L+C
Sbjct:  336 MTCQVVYCPALSPPENGFFVQNVCNNHFDAACGVR-CQPGFELQGTG--------IRLCQADGTWSGTPASCRVRSCPPLSRPHHGFLKCGDGGTAYGAECQVGCARGYRLEGNSTLTCQANSEWSEPQPRCVEVRCSP---IVNQK-------NFLLSPPACGKKAVLAGFTCILSC 494          

HSP 10 Score: 58.151 bits (139), Expect = 3.216e-8
Identity = 65/293 (22.18%), Postives = 107/293 (36.52%), Query Frame = 3
Query:  399 CQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTD-LCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCE-KKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTF--------KCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIG 1247
            C+ P   ++G         GD V Y+C  G+ +KG   + CQA+ + +G++P C   ++  C   P + + Q    +         +V  +C  G +      +    +G  W      CE  + C       +GR   +   + +++  Q C+ GF +    D          C     WS     C     P+  PP  G       +V S + F         C +G ++ GS    C  +  W   +S C    CGPP  +    V       G  A Y C +  T+ G
Sbjct: 3066 CEKPPPLLHGVIKGDSYNYGDLVLYSCLPGFDMKGEAVQTCQADRKWNGTQPVCVASSEYACGPPPTVSHAQFRITAESHLL----NVSYLCNAGMQLVGPETLTCLADGT-WSLPAPTCEVARGCDGPVQLVHGRVQDHILNSERALEFQ-CDKGFSL--VGDHL------VVCLGGNTWSSAFPTCQ----PKSCPPPPGWRGNSSRSVGSHQEFYVGQSVPVSCPKGQKVKGSGSITCRPDQTWTSVSSVCERVPCGPPLHVANGVVRGAVFQFGDVAVYSCYAGYTMEG 3340          

HSP 11 Score: 52.373 bits (124), Expect = 1.877e-6
Identity = 43/175 (24.57%), Postives = 68/175 (38.86%), Query Frame = 3
Query:  663 IICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQF-CNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPE--------LSPPENGE--VMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPP 1154
            + CQ G+E       + + +G  W   P  C  +SC  L  P +G     +  T      Q  C  G++++         N    CQA+ +WS     C  + C          LSPP  G+  V+  +  +       C++GY LHG+    C   GNW  +    +  +  PP
Sbjct:  369 VRCQPGFELQGTGIRLCQADGT-WSGTPASCRVRSCPPLSRPHHGFLKCGDGGTAYGAECQVGCARGYRLE--------GNSTLTCQANSEWSEPQPRCVEVRCSPIVNQKNFLLSPPACGKKAVLAGFTCI-----LSCRKGYTLHGNRKAVCQSSGNWTANVHKAVCADTEPP 529          
BLAST of C4b binding protein beta chain vs. Planmine SMEST
Match: SMESG000011729.1 (SMESG000011729.1)

HSP 1 Score: 1104.74 bits (2856), Expect = 0.000e+0
Identity = 540/540 (100.00%), Postives = 540/540 (100.00%), Query Frame = 3
Query:  381 MEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQXXXXXXXXXXXNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTCEFIMHDELPISWLYYRSDDKK 2000
            MEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQPKKCTKPPTPKNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTCEFIMHDELPISWLYYRSDDKK
Sbjct:    1 MEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKRYCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKIICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNNNYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAILCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDGSNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLTCGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVTHGTHVRAKCNFGYELNSDILPACYNGSWNFIPRCVEAACSARPPSMKYSTVRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPTEGCQPKKCTKPPTPKNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPLYRLKGPKIAVCLNGHWSPPQMPTCEFIMHDELPISWLYYRSDDKK 540          
The following BLAST results are available for this feature:
BLAST of C4b binding protein beta chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CSMD13.667e-2724.15CUB and Sushi multiple domains 1 [Source:HGNC Symb... [more]
CSMD13.714e-2724.15CUB and Sushi multiple domains 1 [Source:HGNC Symb... [more]
CSMD13.732e-2724.15CUB and Sushi multiple domains 1 [Source:HGNC Symb... [more]
CSMD13.732e-2724.15CUB and Sushi multiple domains 1 [Source:HGNC Symb... [more]
CSMD14.454e-2724.15CUB and Sushi multiple domains 1 [Source:HGNC Symb... [more]
back to top
BLAST of C4b binding protein beta chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lev-95.262e-5329.24pep chromosome:WBcel235:X:6286129:6291579:-1 gene:... [more]
lev-97.418e-5329.24pep chromosome:WBcel235:X:6286453:6291732:-1 gene:... [more]
lev-92.096e-5129.24pep chromosome:WBcel235:X:6281847:6291579:-1 gene:... [more]
C54G4.44.135e-1023.81pep chromosome:WBcel235:I:7996728:8003179:-1 gene:... [more]
F36H2.31.985e-919.38pep chromosome:WBcel235:I:9251838:9261657:-1 gene:... [more]
back to top
BLAST of C4b binding protein beta chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hasp2.084e-5027.35gene:FBgn0032797 transcript:FBtr0081281[more]
Hasp2.528e-5027.35gene:FBgn0032797 transcript:FBtr0302108[more]
Hasp2.528e-5027.35gene:FBgn0032797 transcript:FBtr0302107[more]
Hasp2.770e-5027.35gene:FBgn0032797 transcript:FBtr0081280[more]
fw5.373e-2325.75gene:FBgn0001083 transcript:FBtr0112806[more]
back to top
BLAST of C4b binding protein beta chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svep14.305e-2824.65sushi, von Willebrand factor type A, EGF and pentr... [more]
csmd3a2.363e-2727.00CUB and Sushi multiple domains 3a [Source:ZFIN;Acc... [more]
csmd3a4.214e-2428.78CUB and Sushi multiple domains 3a [Source:ZFIN;Acc... [more]
csmd21.588e-2325.78CUB and Sushi multiple domains 2 [Source:ZFIN;Acc:... [more]
csmd3a3.828e-1924.41CUB and Sushi multiple domains 3a [Source:ZFIN;Acc... [more]
back to top
BLAST of C4b binding protein beta chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SVEP13.104e-3025.51sushi, von Willebrand factor type A, EGF and pentr... [more]
SVEP11.248e-2424.33sushi, von Willebrand factor type A, EGF and pentr... [more]
SVEP11.632e-2424.33sushi, von Willebrand factor type A, EGF and pentr... [more]
SVEP11.638e-2424.33sushi, von Willebrand factor type A, EGF and pentr... [more]
SVEP11.811e-2424.33sushi, von Willebrand factor type A, EGF and pentr... [more]
back to top
BLAST of C4b binding protein beta chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Svep16.965e-3126.36sushi, von Willebrand factor type A, EGF and pentr... [more]
Csmd16.751e-2624.15CUB and Sushi multiple domains 1 [Source:MGI Symbo... [more]
Csmd34.799e-2426.94CUB and Sushi multiple domains 3 [Source:MGI Symbo... [more]
Csmd27.417e-2425.94CUB and Sushi multiple domains 2 [Source:MGI Symbo... [more]
Csmd32.474e-2329.03CUB and Sushi multiple domains 3 [Source:MGI Symbo... [more]
back to top
BLAST of C4b binding protein beta chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q22328|LEV9_CAEEL9.435e-5229.24Protein lev-9 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|P0C6B8|SVEP1_RAT2.334e-3126.90Sushi, von Willebrand factor type A, EGF and pentr... [more]
sp|A2AVA0|SVEP1_MOUSE4.872e-3026.36Sushi, von Willebrand factor type A, EGF and pentr... [more]
sp|Q96PZ7|CSMD1_HUMAN1.761e-2624.15CUB and sushi domain-containing protein 1 OS=Homo ... [more]
sp|Q4LDE5|SVEP1_HUMAN3.223e-2525.35Sushi, von Willebrand factor type A, EGF and pentr... [more]
back to top
BLAST of C4b binding protein beta chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3NX166.891e-14737.46Protein lev-9 OS=Schistocephalus solidus OX=70667 ... [more]
A0A068WN991.186e-14238.59C4b binding protein beta chain OS=Echinococcus gra... [more]
A0A0R3S8B51.047e-14137.11Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A068Y4F21.080e-13937.93C4b binding protein beta chain OS=Echinococcus mul... [more]
A0A4S2LP648.057e-12734.15Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of C4b binding protein beta chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svep17.503e-3426.48sushi, von Willebrand factor type A, EGF and pentr... [more]
csmd3a1.376e-2826.82CUB and Sushi multiple domains 3a [Source:ZFIN;Acc... [more]
CSMD13.840e-2629.84CUB and Sushi multiple domains 1 [Source:HGNC Symb... [more]
csmd27.029e-2524.30CUB and Sushi multiple domains 2 [Source:ZFIN;Acc:... [more]
csmd3a1.463e-2225.84CUB and Sushi multiple domains 3a [Source:ZFIN;Acc... [more]
back to top
BLAST of C4b binding protein beta chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003364.14.772e-2525.29pep scaffold:Pmarinus_7.0:GL476462:338772:355022:-... [more]
ENSPMAT00000001629.11.499e-2022.84pep scaffold:Pmarinus_7.0:GL476369:34656:293612:-1... [more]
ENSPMAT00000010323.12.078e-2024.52pep scaffold:Pmarinus_7.0:GL476365:125003:472029:-... [more]
ENSPMAT00000003453.16.458e-2025.60pep scaffold:Pmarinus_7.0:GL476692:191866:231388:-... [more]
ENSPMAT00000009096.11.157e-1125.32pep scaffold:Pmarinus_7.0:GL479728:66801:80742:-1 ... [more]
back to top
BLAST of C4b binding protein beta chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C4b binding protein beta chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO365036.149e-3130.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365043.429e-2828.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433373.814e-2425.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365283.264e-2327.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347017.271e-2326.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of C4b binding protein beta chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csmd29.858e-2625.74CUB and Sushi multiple domains 2 [Source:NCBI gene... [more]
CSMD11.248e-2524.61CUB and Sushi multiple domains 1 [Source:NCBI gene... [more]
csmd23.684e-2424.40CUB and Sushi multiple domains 2 [Source:NCBI gene... [more]
csmd3a6.995e-2324.06CUB and Sushi multiple domains 3 [Source:NCBI gene... [more]
svep11.133e-2225.64sushi, von Willebrand factor type A, EGF and pentr... [more]
back to top
BLAST of C4b binding protein beta chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000011729.10.000e+0100.00SMESG000011729.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032384 ID=SMED30032384|Name=C4b binding protein beta chain|organism=Schmidtea mediterranea sexual|type=transcript|length=2054bp
AGATTTTCTAGCACTGAATTAACTGAAACATTTTCTACACTTTCACTTTT
CAGATAAAGACGAAAATGAAGATCTTTTTACAATTGATATTTACAATTGT
TTTGATAAAAAACAGTTTAAATGAATTATTTCCGCAAAATCAAAATTACA
AATCGAGATTCCACAAAATACGTCACCAGAGACATCTTTTCTTAAATCTT
ATTAATCCAATGAAGTCGGCCCAGTATAAGCCAGAATGTCATGTTAAATC
TTTGGATAACGTGAAACATTTACCGAATGGATGTCCTTCCAAAGCTTGCA
CAGCTAACATAGATTGCTGGGTTGAATATGATAGAGCACAATTATGTGTA
TGTGACTCTTATTTGTGTGGCTTGGTATGTATGGAAATTGACCTTCAGTG
CCAACCACCAGTGCAGCCGGTCAATGGACACGCCAATCATTCAATATTGT
TGGTCGGTGACCAAGTCGAGTACACTTGCAAATCTGGTTATGCTCTCAAA
GGACCTCGGAAACGATATTGTCAAGCTAATTTACGATTATCAGGATCCGA
ACCCGAATGCACAGATCAAACAGACTTATGCTTCTCTGCTCCTTACATTC
CATATACACAGGTTCATGACAACAGTAACCGAGATGATTTTAAAAATGGA
GAAGATGTAAAGATCATCTGCCAAAATGGTTATGAAGACCCTTATAAGAG
TCATATAATCGCAAAATGCAACGGCAATGAATGGAAATATGATCCGATCA
AATGTGAAAAAAAGAGTTGTGGAAAACTTGAAGACCCCAAAAACGGTCGG
ACAATGTACAATAACAATTATACCTATCAATCCATTGCCATTCAGTTTTG
CAACGACGGCTTCAAGATCCAATGTACTACAGATCAGTTTGAGGACAAAA
ATTGTAGAAGACAATGTCAAGCTGATGGGAAATGGTCTGGAGATACGGCA
ATTTGCACTGCTATTCTTTGTCCTGAACTTTCACCTCCTGAAAATGGAGA
AGTAATGGGAGTCTGGAATACAGTGAACAGTATTAAAACATTCAAATGCA
AAGAAGGTTATCAACTTCACGGTTCACATTTACGCAAATGTACCCGCGAG
GGTAACTGGGATGGTTCAAATTCAACTTGCATAGTAAGGAATTGTGGGCC
ACCCCCTGAGATTGTCTTTGCGAAAGTGGCCTACGAAGCAACTACACACG
GTGCCCAAGCAGAATACAAATGCAAATCTCGATCAACTCTGATTGGAGAA
ACTTCATTTTTAACATGTGGAGAAGTCGACAATAAAAGCGGATGGCTACC
GAAACCGGAGCCCAAATGTTTGCTTCATTGCAAACCATTTCAAGTTGACT
CTGCCAAAGTATATATTCATGAGAATAACAAAACAACGAATTTCATAATG
CATGACGAGGTCACTCATGGGACACATGTTAGGGCTAAATGCAACTTTGG
ATATGAACTCAACAGCGATATTTTGCCTGCTTGTTACAATGGTTCCTGGA
ACTTTATACCGAGATGTGTTGAAGCTGCCTGTTCAGCTAGACCTCCTTCA
ATGAAATATAGCACCGTAAGATTTCTCAGCTTAAAACATGACTCTCTTGC
TCGATATTACTGTCATTTTGGGTATTACATTGCCCTAAGAAAGGATGGTA
TGGAAACTTTGAGTACAATATTCGATATAAAATGCAATAAGGGAAATTGG
ACAAAAATGCCAACTGAAGGATGCCAACCAAAGAAATGCACTAAACCGCC
GACACCGAAAAATGGAGAAATTTATCTACTGGGACAATCCGACAGGACAA
GATTGACTGATAAATCCATTAAGCCGATTCACAATCGTGTCGTTAAATAC
GAATGTCATCCGTTATATAGGCTGAAGGGTCCGAAGATTGCCGTTTGCCT
CAATGGCCATTGGAGTCCTCCTCAGATGCCAACTTGTGAATTTATCATGC
ATGACGAACTACCGATTTCATGGTTGTATTATCGCTCGGATGACAAGAAA
TAAGAAGATTATGTATTTTATCTCCATTTCTTTTTTGTATTTATGAAAGA
TCGG
back to top

protein sequence of SMED30032384-orf-1

>SMED30032384-orf-1 ID=SMED30032384-orf-1|Name=SMED30032384-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=646bp
MKIFLQLIFTIVLIKNSLNELFPQNQNYKSRFHKIRHQRHLFLNLINPMK
SAQYKPECHVKSLDNVKHLPNGCPSKACTANIDCWVEYDRAQLCVCDSYL
CGLVCMEIDLQCQPPVQPVNGHANHSILLVGDQVEYTCKSGYALKGPRKR
YCQANLRLSGSEPECTDQTDLCFSAPYIPYTQVHDNSNRDDFKNGEDVKI
ICQNGYEDPYKSHIIAKCNGNEWKYDPIKCEKKSCGKLEDPKNGRTMYNN
NYTYQSIAIQFCNDGFKIQCTTDQFEDKNCRRQCQADGKWSGDTAICTAI
LCPELSPPENGEVMGVWNTVNSIKTFKCKEGYQLHGSHLRKCTREGNWDG
SNSTCIVRNCGPPPEIVFAKVAYEATTHGAQAEYKCKSRSTLIGETSFLT
CGEVDNKSGWLPKPEPKCLLHCKPFQVDSAKVYIHENNKTTNFIMHDEVT
HGTHVRAKCNFGYELNSDILPACYNGSWNFIPRCVEAACSARPPSMKYST
VRFLSLKHDSLARYYCHFGYYIALRKDGMETLSTIFDIKCNKGNWTKMPT
EGCQPKKCTKPPTPKNGEIYLLGQSDRTRLTDKSIKPIHNRVVKYECHPL
YRLKGPKIAVCLNGHWSPPQMPTCEFIMHDELPISWLYYRSDDKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0005509calcium ion binding
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007155cell adhesion
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000030midline
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR035976Sushi/SCR/CCP_sf
IPR000436Sushi_SCR_CCP_dom
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005737cytoplasm
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000436Sushi/SCR/CCP domainSMARTSM00032CCP_2coord: 558..624
e-value: 3.1E-10
score: 50.0
coord: 112..165
e-value: 5.2E-12
score: 55.9
coord: 360..418
e-value: 2.0E-6
score: 37.4
coord: 489..553
e-value: 22.0
score: 2.2
coord: 235..297
e-value: 0.52
score: 18.8
coord: 172..230
e-value: 1.1
score: 15.6
coord: 302..355
e-value: 1.6E-7
score: 41.0
coord: 422..484
e-value: 2.5
score: 11.8
IPR000436Sushi/SCR/CCP domainPFAMPF00084Sushicoord: 112..165
e-value: 5.6E-10
score: 39.7
coord: 558..624
e-value: 9.5E-7
score: 29.3
coord: 302..355
e-value: 7.6E-7
score: 29.6
coord: 360..418
e-value: 5.6E-4
score: 20.4
IPR000436Sushi/SCR/CCP domainPROSITEPS50923SUSHIcoord: 556..626
score: 9.442
IPR000436Sushi/SCR/CCP domainPROSITEPS50923SUSHIcoord: 487..555
score: 6.687
IPR000436Sushi/SCR/CCP domainPROSITEPS50923SUSHIcoord: 170..232
score: 7.07
IPR000436Sushi/SCR/CCP domainPROSITEPS50923SUSHIcoord: 233..299
score: 7.919
IPR000436Sushi/SCR/CCP domainPROSITEPS50923SUSHIcoord: 358..420
score: 8.023
IPR000436Sushi/SCR/CCP domainPROSITEPS50923SUSHIcoord: 110..167
score: 9.111
IPR000436Sushi/SCR/CCP domainPROSITEPS50923SUSHIcoord: 427..486
score: 6.708
IPR000436Sushi/SCR/CCP domainPROSITEPS50923SUSHIcoord: 300..357
score: 8.966
IPR000436Sushi/SCR/CCP domainCDDcd00033CCPcoord: 235..297
e-value: 2.91188E-5
score: 40.1388
IPR000436Sushi/SCR/CCP domainCDDcd00033CCPcoord: 360..418
e-value: 0.00104914
score: 35.5164
IPR000436Sushi/SCR/CCP domainCDDcd00033CCPcoord: 112..165
e-value: 5.4397E-10
score: 53.2356
IPR000436Sushi/SCR/CCP domainCDDcd00033CCPcoord: 302..356
e-value: 3.4953E-9
score: 50.9244
IPR000436Sushi/SCR/CCP domainCDDcd00033CCPcoord: 558..625
e-value: 1.50461E-8
score: 49.3836
NoneNo IPR availableGENE3DG3DSA:2.10.70.10coord: 299..357
e-value: 3.2E-12
score: 48.5
coord: 550..626
e-value: 3.1E-13
score: 51.7
coord: 108..170
e-value: 2.7E-13
score: 52.0
coord: 232..298
e-value: 3.0E-10
score: 42.2
NoneNo IPR availableGENE3DG3DSA:2.10.70.10coord: 358..425
e-value: 2.1E-7
score: 33.1
NoneNo IPR availableGENE3DG3DSA:2.10.70.10coord: 430..490
e-value: 3.0E-5
score: 26.3
NoneNo IPR availableGENE3DG3DSA:2.10.70.10coord: 171..231
e-value: 8.4E-8
score: 34.5
NoneNo IPR availablePANTHERPTHR19325COMPLEMENT COMPONENT-RELATED SUSHI DOMAIN-CONTAININGcoord: 512..625
NoneNo IPR availablePANTHERPTHR19325:SF501FURROWED, ISOFORM Acoord: 262..491
NoneNo IPR availablePANTHERPTHR19325:SF501FURROWED, ISOFORM Acoord: 512..625
NoneNo IPR availablePANTHERPTHR19325COMPLEMENT COMPONENT-RELATED SUSHI DOMAIN-CONTAININGcoord: 262..491
NoneNo IPR availablePANTHERPTHR19325COMPLEMENT COMPONENT-RELATED SUSHI DOMAIN-CONTAININGcoord: 71..269
NoneNo IPR availablePANTHERPTHR19325COMPLEMENT COMPONENT-RELATED SUSHI DOMAIN-CONTAININGcoord: 184..396
NoneNo IPR availablePANTHERPTHR19325:SF501FURROWED, ISOFORM Acoord: 184..396
coord: 71..269
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.583
IPR035976Sushi/SCR/CCP superfamilySUPERFAMILYSSF57535Complement control module/SCR domaincoord: 553..626
IPR035976Sushi/SCR/CCP superfamilySUPERFAMILYSSF57535Complement control module/SCR domaincoord: 172..244
IPR035976Sushi/SCR/CCP superfamilySUPERFAMILYSSF57535Complement control module/SCR domaincoord: 437..490
IPR035976Sushi/SCR/CCP superfamilySUPERFAMILYSSF57535Complement control module/SCR domaincoord: 360..425
IPR035976Sushi/SCR/CCP superfamilySUPERFAMILYSSF57535Complement control module/SCR domaincoord: 234..311
IPR035976Sushi/SCR/CCP superfamilySUPERFAMILYSSF57535Complement control module/SCR domaincoord: 300..366
IPR035976Sushi/SCR/CCP superfamilySUPERFAMILYSSF57535Complement control module/SCR domaincoord: 110..166