Coiled-coil domain containing 40

Overview
NameCoiled-coil domain containing 40
Smed IDSMED30032372
Length (bp)2829
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Coiled-coil domain containing 40 (SMED30032372) t-SNE clustered cells

Violin plots show distribution of expression levels for Coiled-coil domain containing 40 (SMED30032372) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Coiled-coil domain containing 40 (SMED30032372) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Coiled-coil domain containing 40 (SMED30032372) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032372

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30032372SMESG000008312.1 SmedASXL_016100SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30032372SMESG000008312.1 dd_Smed_v4_6338_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30032372SMESG000008312.1 dd_Smed_v4_6338_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30032372SMESG000008312.1 dd_Smed_v4_6338_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30032372SMESG000008312.1 dd_Smed_v4_6338_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30032372SMESG000008312.1 dd_Smed_v4_6338_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30032372SMESG000008312.1 dd_Smed_v6_6338_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30032372SMESG000008312.1 dd_Smed_v4_6338_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30032372SMESG000008312.1 dd_Smed_v4_6338_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Coiled-coil domain containing 40 vs. Ensembl Human
Match: CCDC40 (coiled-coil domain containing 40 [Source:HGNC Symbol;Acc:HGNC:26090])

HSP 1 Score: 452.981 bits (1164), Expect = 9.163e-142
Identity = 302/880 (34.32%), Postives = 524/880 (59.55%), Query Frame = 3
Query:  147 TELVVLDPDHPLMKRFQDALKGMLTKQLNRIXXXXXXXXXXXXXXXXXXXXXGNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKAVENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGSIEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAEXXXXXXXXXXXXXXXXTRRQIMLWEKKIQLTQETREAVDSEIGEGEMKLMRCEIHRMXXXXXXXXXXXXXXXXDMEKSVSRREVIATRGEALQKVKTKVTSKGGIEREILDLKRKIKQILKSSQDYEENIKTLKLEKDNICEDIEKRKQTIDELQHQLDSLTLKLDEINNNRIGHIISLXXXXXXXXXXXXFKDKKYMRLCKTPTTGEKENDSFDKKISTLNTIIDRLCREYPQVIRDLGPIRNMVQKKLE 2786
            ++LVVLDPDHPLM RFQ ALK  L +Q+ +++L+ +E     K+ + +   LG +LY VQQ L   Q  LE+  D +     + ++ ++E    R  +        EE  KL  L+ EM+  AL LFY++   +D+R DI VM +  +KA     + E  K +QDL VD+L  +  +L+E+I L+EAQ +AQAE+ R +   + EA +EI  I  E+++++ QW S+L+G++ R+EA+  + +A++  + Q  S   E+E+++KS+ KE+E NEKL+ +LN+   +   ++KL T    K + L+ +++TY  TLQ+TE  L +   ++ I   E+  +R+ I+ E + R + +  I E+L+  +T NK  +Y N+L ++++ +  ++ T ++ +   ++   L I    S     +K ++ ++ ++++ N+ I+  +SEISR  I +ERKQG I+ LNK+LE+M++  GG E+GPLE+ I  L K I   + +    +  WLR QQ++VK+  ++ E + ++   K++L I+ QK++R+E  IE+EK+E+ +IE H++ L ND+ KLN L+ + +   E LE+ N +TE +F+RSLK  E E+I+++ +L+ +  EK   LN+LVEAE                   QIMLWEKKIQL +E R +VDSEIG+ E++ M+ EIHRM+VR  QLL+QQE +++ ME +V+RRE + T+ E  +K+  K  ++     + L+L+RKI+ + K++ +  + +  L+  + N+   + ++++ +  +Q   D+L   L  +   +  ++  +   Q   K+ Q  K+ +Y+ L ++  +   E    DK+++ + TI+DR+  EYPQ    L  +  M+  KLE
Sbjct:  276 SQLVVLDPDHPLMVRFQAALKNYLNRQIEKLKLDLQELVVATKQSRAQRQELGVNLYEVQQHLVHLQKLLEKSHDRHAMASSERRQKEEELQAARALYTKTCAAANEERKKLAALQTEMENLALHLFYMQNIDQDMRDDIRVMTQVVKKAETERIRAEIEKKKQDLYVDQLTTRAQQLEEDIALFEAQYLAQAEDTRILRKAVSEACTEIDAISVEKRRIMQQWASSLVGMKHRDEAHRAVLEALRGCQHQAKSTDGEIEAYKKSIMKEEEKNEKLASILNRTETEATLLQKLTTQCLTKQVALQSQFNTYRLTLQDTEDALSQDQLEQMILTEELQAIRQAIQGELELRRKTDAAIREKLQEHMTSNKTTKYFNQLILRLQKEKTNMMTHLSKINGDIAQTTLDITHTSSRLDAHQKTLVELDQDVKKVNELITNSQSEISRRTILIERKQGLINFLNKQLERMVSELGGEEVGPLELEIKRLSKLIDEHDGKAVQAQVTWLRLQQEMVKVTQEQEEQLASLDASKKELHIMEQKKLRVESKIEQEKKEQKEIEHHMKDLDNDLKKLNMLMNKNRCSSEELEQNNRVTENEFVRSLKASERETIKMQDKLNQLSEEKATLLNQLVEAE------------------HQIMLWEKKIQLAKEMRSSVDSEIGQTEIRAMKGEIHRMKVRLGQLLKQQEKMIRAMELAVARRETVTTQAEGQRKMDRKALTRTDFHHKQLELRRKIRDVRKATDECTKTVLELEETQRNVSSSLLEKQEKLSVIQADFDTLEADLTRLGALKRQNLSEIVALQTRLKHLQAVKEGRYVFLFRSKQSLVLERQRLDKRLALIATILDRVRDEYPQFQEALHKVSQMIANKLE 1137          
BLAST of Coiled-coil domain containing 40 vs. Ensembl Human
Match: CCDC40 (coiled-coil domain containing 40 [Source:HGNC Symbol;Acc:HGNC:26090])

HSP 1 Score: 402.905 bits (1034), Expect = 5.154e-124
Identity = 250/686 (36.44%), Postives = 418/686 (60.93%), Query Frame = 3
Query:  147 TELVVLDPDHPLMKRFQDALKGMLTKQLNRIXXXXXXXXXXXXXXXXXXXXXGNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKAVENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGSIEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAEXXXXXXXXXXXXXXXXTRRQIMLWEKKIQLTQETREAVDSEIGEGEMKLMRCEIHRM 2204
            ++LVVLDPDHPLM RFQ ALK  L +Q+ +++L+ +E     K+ + +   LG +LY VQQ L   Q  LE+  D +     + ++ ++E    R  +        EE  KL  L+ EM+  AL LFY++   +D+R DI VM +  +KA     + E  K +QDL VD+L  +  +L+E+I L+EAQ +AQAE+ R +   + EA +EI  I  E+++++ QW S+L+G++ R+EA+  + +A++  + Q  S   E+E+++KS+ KE+E NEKL+ +LN+   +   ++KL T    K + L+ +++TY  TLQ+TE  L +   ++ I   E+  +R+ I+ E + R + +  I E+L+  +T NK  +Y N+L ++++ +  ++ T ++ +   ++   L I    S     +K ++ ++ ++++ N+ I+  +SEISR  I +ERKQG I+ LNK+LE+M++  GG E+GPLE+ I  L K I   + +    +  WLR QQ++VK+  ++ E + ++   K++L I+ QK++R+E  IE+EK+E+ +IE H++ L ND+ KLN L+ + +   E LE+ N +TE +F+RSLK  E E+I+++ +L+ +  EK   LN+LVEAE                   QIMLWEKKIQL +E R +VDSEIG+ E++ M+ EIHRM
Sbjct:  276 SQLVVLDPDHPLMVRFQAALKNYLNRQIEKLKLDLQELVVATKQSRAQRQELGVNLYEVQQHLVHLQKLLEKSHDRHAMASSERRQKEEELQAARALYTKTCAAANEERKKLAALQTEMENLALHLFYMQNIDQDMRDDIRVMTQVVKKAETERIRAEIEKKKQDLYVDQLTTRAQQLEEDIALFEAQYLAQAEDTRILRKAVSEACTEIDAISVEKRRIMQQWASSLVGMKHRDEAHRAVLEALRGCQHQAKSTDGEIEAYKKSIMKEEEKNEKLASILNRTETEATLLQKLTTQCLTKQVALQSQFNTYRLTLQDTEDALSQDQLEQMILTEELQAIRQAIQGELELRRKTDAAIREKLQEHMTSNKTTKYFNQLILRLQKEKTNMMTHLSKINGDIAQTTLDITHTSSRLDAHQKTLVELDQDVKKVNELITNSQSEISRRTILIERKQGLINFLNKQLERMVSELGGEEVGPLELEIKRLSKLIDEHDGKAVQAQVTWLRLQQEMVKVTQEQEEQLASLDASKKELHIMEQKKLRVESKIEQEKKEQKEIEHHMKDLDNDLKKLNMLMNKNRCSSEELEQNNRVTENEFVRSLKASERETIKMQDKLNQLSEEKATLLNQLVEAE------------------HQIMLWEKKIQLAKEMRSSVDSEIGQTEIRAMKGEIHRM 943          
BLAST of Coiled-coil domain containing 40 vs. Ensembl Human
Match: CCDC40 (coiled-coil domain containing 40 [Source:HGNC Symbol;Acc:HGNC:26090])

HSP 1 Score: 141.739 bits (356), Expect = 1.765e-34
Identity = 91/245 (37.14%), Postives = 147/245 (60.00%), Query Frame = 3
Query:  147 TELVVLDPDHPLMKRFQDALKGMLTKQLNRIXXXXXXXXXXXXXXXXXXXXXGNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKAVENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAV 881
            ++LVVLDPDHPLM RFQ ALK  L +Q+ +++L+ +E     K+ + +   LG +LY VQQ L   Q  LE+  D +     + ++ ++E    R  +        EE  KL  L+ EM+  AL LFY++   +D+R DI VM +  +KA     + E  K +QDL VD+L  +  +L+E+I L+EAQ +AQAE+ R +   + EA +EI  I  E+++++ QW S+L+G++ R+EA+  + +A+
Sbjct:  276 SQLVVLDPDHPLMVRFQAALKNYLNRQIEKLKLDLQELVVATKQSRAQRQELGVNLYEVQQHLVHLQKLLEKSHDRHAMASSERRQKEEELQAARALYTKTCAAANEERKKLAALQTEMENLALHLFYMQNIDQDMRDDIRVMTQVVKKAETERIRAEIEKKKQDLYVDQLTTRAQQLEEDIALFEAQYLAQAEDTRILRKAVSEACTEIDAISVEKRRIMQQWASSLVGMKHRDEAHRAVLEAL 520          
BLAST of Coiled-coil domain containing 40 vs. Ensembl Human
Match: CCDC40 (coiled-coil domain containing 40 [Source:HGNC Symbol;Acc:HGNC:26090])

HSP 1 Score: 79.7221 bits (195), Expect = 8.708e-15
Identity = 56/150 (37.33%), Postives = 85/150 (56.67%), Query Frame = 3
Query:  147 TELVVLDPDHPLMKRFQDALKGMLTKQLNRIXXXXXXXXXXXXXXXXXXXXXGNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKA 596
            ++LVVLDPDHPLM RFQ ALK  L +Q+ +++L+ +E     K+ + +   LG +LY VQQ L   Q  LE+  D +     + ++ ++E    R  +        EE  KL  L+ EM+  AL LFY++   +D+R DI VM +  +KA
Sbjct:  276 SQLVVLDPDHPLMVRFQAALKNYLNRQIEKLKLDLQELVVATKQSRAQRQELGVNLYEVQQHLVHLQKLLEKSHDRHAMASSERRQKEEELQAARALYTKTCAAANEERKKLAALQTEMENLALHLFYMQNIDQDMRDDIRVMTQVVKKA 425          
BLAST of Coiled-coil domain containing 40 vs. Ensembl Fly
Match: l(2)41Ab (gene:FBgn0262123 transcript:FBtr0114030)

HSP 1 Score: 130.183 bits (326), Expect = 1.797e-30
Identity = 180/748 (24.06%), Postives = 361/748 (48.26%), Query Frame = 3
Query:  150 ELVVLDPDHPLMKRFQDALKGMLTKQLNRIXXXXXXXXXXXXXXXXXXXXXGNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKYKKV-TEESIKLEQLRKEMDKAALRLFYLKIAK----KDIRGDIAVMRRAAEKAVENLYK--EEDGKLQ---------QDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVD----NLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGSIEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAEXXXXXXXXXXXXXXXXTRRQIMLWEKKIQLTQETREAVDSEIG-EGEMKLMRCEIHRMXXXXXXXXXXXXXXXXDMEKSVSRREVIATRGEALQKVKTKV 2330
            EL +L P+HPL+ +FQ  LKG L +    IE E  E +  +K R++     G  LY +QQ++ KFQ   E+   E   + +KH +  Q++     EF  K  K   EE IKL + +K        L++ ++A+    + +  +I     + E  V+N  +    D +LQ          D+L  RL  ++ K + E+      I  +    + V++    ++  A ++++ ++ E K+L   WN  +I +Q R++    + DA ++ R+ +    + +E+ +K + KE E N+KL     +   + +++++         + ++ +       L  TE +L     + +    EV  L   ++K    +   EE I+   ++ L  +KA  Y  KL  + ++K R+++  ++ ++N+LS+  L + K++        +    + +++   +  S LE+ + + +I +E K    + +N K+E+M    G     P ++ I  L K+I   E +V + +Q W+  Q   V L  ++N+ +N + + +++L+I+ QK ++ +  +E   R+  +++  ++   + +  LN  I++++ + +  E E    + +  + LK  ELE ++L+ ++ +++NE E   + +++                    R+ + WE K ++ +ET +    E   +GE+ LM+ EIHRM +RY QL R QE LV D+E  V  RE I       + ++ K 
Sbjct:   27 ELALLPPNHPLLSKFQVCLKGHLIRTKREIENEIAEIKHHVKLREQRREEQGLTLYDMQQKM-KFQ---EKQIMELSAVIEKHLKNRQDE-----EFNTKTLKAENEEKIKLTKSQK-------TLYHERMAELGDMQSLGSNIKKWACSVEDEVKNAKRIVSRDAQLQDQLSQEKRKSDILFYRLDIEIKKRENEL----LSICEEEATMKEVINILNMSIANANTDLEVLQNEHKRLTQAWNEVIIAIQLRDKILFQVQDAARKHREAMKHNIAGIEAIKKQIGKEMELNKKLDSFKQRLADETSSLRRECQDESESLLKMQAKLDDLPEFLNTTETDLQDALREGSHLFTEVRKLDIALDKYLTQKFRTEETILRLAQDHLITDKATAYRLKLLGKSQEKRRNVDLSLSKVQNQLSLSMLEVEKLRCVVFNERAYNDSTKTKLKSAENKSSTLENGLKKIHIQIEIKMKLYEKINCKIEEMDHLFGDASGNPTDLKIKQLEKSIHIGELQVREHQQFWIMLQNHFVNLSQKRNDQLNEIQVTRKQLSIIRQKSLKSDQELEISHRKAKELQIFIKKFTSKLELLNDKIYKKRIHHDVEETEFDHEQAEQTQKLKIAELEILKLEGKIVELQNEIELHKDYVIDK------------------HRETLSWETKYKMIEETIKWAKLERSVKGEIGLMKTEIHRMNIRYSQLKRAQESLVLDLEHCVMHREQIFVNASVKEHLQAKF 736          
BLAST of Coiled-coil domain containing 40 vs. Ensembl Fly
Match: l(2)41Ab (gene:FBgn0262123 transcript:FBtr0114029)

HSP 1 Score: 108.997 bits (271), Expect = 7.463e-24
Identity = 121/524 (23.09%), Postives = 259/524 (49.43%), Query Frame = 3
Query:  762 AQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGSIEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAEXXXXXXXXXXXXXXXXTRRQIMLWEKKIQLTQETREAVDSEIG-EGEMKLMRCEIHRMXXXXXXXXXXXXXXXXDMEKSVSRREVIATRGEALQKVKTKV 2330
            A ++++ ++ E K+L   WN  +I +Q R++    + DA ++ R+ +    + +E+ +K + KE E N+KL     +   + +++++         + ++ +       L  TE +L     + +    EV  L   ++K    +   EE I+   ++ L  +KA  Y  KL  + ++K R+++  ++ ++N+LS+  L + K++        +    + +++   +  S LE+ + + +I +E K    + +N K+E+M    G     P ++ I  L K+I   E +V + +Q W+  Q   V L  ++N+ +N + + +++L+I+ QK ++ +  +E   R+  +++  ++   + +  LN  I++++ + +  E E    + +  + LK  ELE ++L+ ++ +++NE E   + +++                    R+ + WE K ++ +ET +    E   +GE+ LM+ EIHRM +RY QL R QE LV D+E  V  RE I       + ++ K 
Sbjct:  148 ANTDLEVLQNEHKRLTQAWNEVIIAIQLRDKILFQVQDAARKHREAMKHNIAGIEAIKKQIGKEMELNKKLDSFKQRLADETSSLRRECQDESESLLKMQAKLDDLPEFLNTTETDLQDALREGSHLFTEVRKLDIALDKYLTQKFRTEETILRLAQDHLITDKATAYRLKLLGKSQEKRRNVDLSLSKVQNQLSLSMLEVEKLRCVVFNERAYNDSTKTKLKSAENKSSTLENGLKKIHIQIEIKMKLYEKINCKIEEMDHLFGDASGNPTDLKIKQLEKSIHIGELQVREHQQFWIMLQNHFVNLSQKRNDQLNEIQVTRKQLSIIRQKSLKSDQELEISHRKAKELQIFIKKFTSKLELLNDKIYKKRIHHDVEETEFDHEQAEQTQKLKIAELEILKLEGKIVELQNEIELHKDYVIDK------------------HRETLSWETKYKMIEETIKWAKLERSVKGEIGLMKTEIHRMNIRYSQLKRAQESLVLDLEHCVMHREQIFVNASVKEHLQAKF 653          
BLAST of Coiled-coil domain containing 40 vs. Ensembl Zebrafish
Match: ccdc40 (coiled-coil domain containing 40 [Source:NCBI gene;Acc:568590])

HSP 1 Score: 412.92 bits (1060), Expect = 8.426e-129
Identity = 290/862 (33.64%), Postives = 497/862 (57.66%), Query Frame = 3
Query:  153 LVVLDPDHPLMKRFQDALKGMLTKQLNRIXXXXXXXXXXXXXXXXXXXXXGNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKAVENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGSIEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAEXXXXXXXXXXXXXXXXTRRQIMLWEKKIQLTQETREAVDSEIGEGEMKLMRCEIHRMXXXXXXXXXXXXXXXXDMEKSVSRREVIATRGEALQKVKT-KVTSKGGIEREILDLKRKIKQILKSSQDYEENIKTLKLEKDNICEDIEKRKQTIDELQHQLDSLTLKLDEINNNRIGHIISLXXXXXXXXXXXXFKDKKYMRLCKTPTTGEKENDSFDKKISTLNTIIDRLCREYPQ 2735
            +VVLDP+HPLMKRFQ ALK   T QL R+ L+  E     K   +   +L  ++Y VQ+ LA+ Q+ LE  Q+       +H++ +     V+ ++Q+   +   + +++ +L+ ++D  AL+L Y++ AK D+  DI  +  A+ KA +   + E+ K QQD+ V+RL  +V+KL E+I LY+ Q+++Q E+ R+  D+L EAQ E+  +  E ++L+ QW S+L+ ++RR+EAY  + + +++  DQ+LSL +E+ES++KS+ +E+E NE L+L LN+   D  T +KL+T +QN    L+ + STYTR LQETE  L   + +  + Q  +  LRK +EK    R++LE QI+ +L+ +LT N A +Y  +L  +     R  E ++   EN  +   L   ++ ++   L      +E +  +++  +S  E EI +   ++ERKQ TI + NKK++ ++++ G  +LGPLEI    L K ++    ++ + +Q WL QQ +LV+   +K    ++V +L+ +LTIL Q +IR E  +E+++ E +D+++ ++ L  DM+KLN L+ +  D    L++ + L ET+F + LK  E +S E + +L+ +  EKER +N LVEAE                  RQ+MLW K+ QL QET  A+DS+IG+G+++ MR EIHRMEVRY QL++QQE L++DME  V++ E IA   EA  + +  K  +       I  L+RKI Q  K +++ +  I  L+    ++   ++ ++  ++ +Q+    L+  L  +   +  ++  L   Q  AK+    K+ +Y  +    T  E      ++++  ++  + RL +EYPQ
Sbjct:   74 IVVLDPEHPLMKRFQTALKNNFTNQLERLNLDLCEKVVVEKAEAQRRHDLAEEVYMVQEMLARLQASLEVCQETNSEAAAQHRQAEDHLYVVKNQYQDTASQTNVQRLQVLELQSKVDNLALKLLYMQEAKSDLCSDIKAIINASNKAQKERTQTEEQKHQQDIYVERLTNRVEKLLEQISLYDLQLISQTEQTRAAKDSLSEAQLELDSVIVEHRQLLQQWKSSLLMMKRRDEAYTAMQEELRQANDQMLSLDTEIESYKKSITQEEEQNECLTLRLNRGQTDCTTSRKLITHSQNLQEVLQAQLSTYTRILQETENTLSTLHGNLEMHQSALKALRKQMEKVSAVRLDLESQIMNKLQEQLTHNNAAKYSRRLNDKTAVYRREKEAQLIKFENDFNTVTLEGQELATHLDSLLAFQAELEQKSTQRHLLLSSREEEIVKQITDIERKQATISIYNKKIKDIVSSTGHEDLGPLEIHAATLSKELEEVGAKIKECQQLWLWQQGELVRFTQEKQAHSSSVQILQTQLTILQQGKIRRESEMEQDQSELADLDKQIKVLMADMVKLNSLLNKNSDLNHALQQSSNLMETEFRQRLKEAEKDSAETQLKLERLNEEKERLINSLVEAE------------------RQVMLWGKRTQLMQETCSAIDSDIGQGDIRTMRAEIHRMEVRYAQLMKQQERLLRDMESVVAKSETIAVWSEAQARTQAHKQPTHNDYHNTIQSLRRKILQTKKQTEECDGVIAQLEERLGSMTSRLQDKQMHLNNIQNTEAFLSQDLRRLQEIKERNLYRLPVLQTRAKHLHAVKEGRYTPMATGVTALELGTHKQEERLKMVSLTLQRLAQEYPQ 917          
BLAST of Coiled-coil domain containing 40 vs. Ensembl Zebrafish
Match: ccdc40 (coiled-coil domain containing 40 [Source:NCBI gene;Acc:568590])

HSP 1 Score: 410.609 bits (1054), Expect = 6.403e-128
Identity = 292/866 (33.72%), Postives = 499/866 (57.62%), Query Frame = 3
Query:  153 LVVLDPDHPLMKRFQDALKGMLTKQLNRIXXXXXXXXXXXXXXXXXXXXXGNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKAVENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKT----RHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGSIEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAEXXXXXXXXXXXXXXXXTRRQIMLWEKKIQLTQETREAVDSEIGEGEMKLMRCEIHRMXXXXXXXXXXXXXXXXDMEKSVSRREVIATRGEALQKVKT-KVTSKGGIEREILDLKRKIKQILKSSQDYEENIKTLKLEKDNICEDIEKRKQTIDELQHQLDSLTLKLDEINNNRIGHIISLXXXXXXXXXXXXFKDKKYMRLCKTPTTGEKENDSFDKKISTLNTIIDRLCREYPQ 2735
            +VVLDP+HPLMKRFQ ALK   T QL R+ L+  E     K   +   +L  ++Y VQ+ LA+ Q+ LE  Q+       +H++ +     V+ ++Q+   +   + +++ +L+ ++D  AL+L Y++ AK D+  DI  +  A+ KA +   + E+ K QQD+ V+RL  +V+KL E+I LY+ Q+++Q E+ R+  D+L EAQ E+  +  E ++L+ QW S+L+ ++RR+EAY  + + +++  DQ+LSL +E+ES++KS+ +E+E NE L+L LN+   D  T +KL+T +QN    L+ + STYTR LQETE  L   + +  + Q  +  LRK +EK    R++LE QI+ +L+ +LT N A +Y  +    M DKT    R  E ++   EN  +   L   ++ ++   L      +E +  +++  +S  E EI +   ++ERKQ TI + NKK++ ++++ G  +LGPLEI    L K ++    ++ + +Q WL QQ +LV+   +K    ++V +L+ +LTIL Q +IR E  +E+++ E +D+++ ++ L  DM+KLN L+ +  D    L++ + L ET+F + LK  E +S E + +L+ +  EKER +N LVEAE                  RQ+MLW K+ QL QET  A+DS+IG+G+++ MR EIHRMEVRY QL++QQE L++DME  V++ + IA   EA  + +  K  +       I  L+RKI Q  K +++ +  I  L+    ++   ++ ++  ++ +Q+    L+  L  +   +  ++  L   Q  AK+    K+ +Y  +    T  E      ++++  ++  + RL +EYPQ
Sbjct:   74 IVVLDPEHPLMKRFQTALKNNFTNQLERLNLDLCEKVVVEKAEAQRRHDLAEEVYMVQEMLARLQASLEVCQETNSEAAAQHRQAEDHLYVVKNQYQDTASQTNVQRLQVLELQSKVDNLALKLLYMQEAKSDLCSDIKAIINASNKAQKERTQTEEQKHQQDIYVERLTNRVEKLLEQISLYDLQLISQTEQTRAAKDSLSEAQLELDSVIVEHRQLLQQWKSSLLMMKRRDEAYTAMQEELRQANDQMLSLDTEIESYKKSITQEEEQNECLTLRLNRGQTDCTTSRKLITHSQNLQEVLQAQLSTYTRILQETENTLSTLHGNLEMHQSALKALRKQMEKVSAVRLDLESQIMNKLQEQLTHNNAAKYSRR----MNDKTAVYRREKEAQLIKFENDFNTVTLEGQELATHLDSLLAFQAELEQKSTQRHLLLSSREEEIVKQITDIERKQATISIYNKKIKDIVSSTGHEDLGPLEIHAATLSKELEEVGAKIKECQQLWLWQQGELVRFTQEKQAHSSSVQILQTQLTILQQGKIRRESEMEQDQSELADLDKQIKVLMADMVKLNSLLNKNSDLNHALQQSSNLMETEFRQRLKEAEKDSAETQLKLERLNEEKERLINSLVEAE------------------RQVMLWGKRTQLMQETCSAIDSDIGQGDIRTMRAEIHRMEVRYAQLMKQQERLLRDMESVVAKSKTIAVWSEAQARTQAHKQPTHNDYHNTIQSLRRKILQTKKQTEECDGVIAQLEERLGSMTSRLQDKQMHLNNIQNTEAFLSQDLRRLQEIKERNLYRLPVLQTRAKHLHAVKEGRYTPMATGVTALELGTHKQEERLKMVSLTLQRLAQEYPQ 917          
BLAST of Coiled-coil domain containing 40 vs. Ensembl Xenopus
Match: grwd1 (glutamate-rich WD repeat containing 1 [Source:Xenbase;Acc:XB-GENE-986093])

HSP 1 Score: 452.981 bits (1164), Expect = 1.039e-145
Identity = 298/817 (36.47%), Postives = 478/817 (58.51%), Query Frame = 3
Query:  303 GNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKAVENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGS-IEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAEXXXXXXXXXXXXXXXXTRRQIMLWEKKIQLTQETREAVDSEIGEGEMKLMRCEIHRMXXXXXXXXXXXXXXXXDMEKSVSRREVIATRGEALQKVKTKVTSKGGIEREILDLKRKIKQILKSSQDYEENIKTLKLEKDNICEDIEKRKQTIDELQHQLDSLTLKLDEINNNRIGHIISLXXXXXXXXXXXXFKDKKYMRLCKTPTTGEKENDSFDKKISTLNTIIDRLCREYPQVIRDL 2750
            G  LYGVQQELA+ Q  LE+  D++  +  + ++ + E   +R  ++  ++    E  K+  ++ E++  ALRLFY++   +D+R DI VM+RA +KA     + E  K +QD+ VDRL  +VD+L+E+I LYEAQ+ AQ E+ ++  + + EA  EI+ I  E+K+LI QWNS+LIG+ RR+EAY  I +A    R ++LS+ +E+E  +K++ KE+E NE+L+ +LN+   D A  KK +  +  K   L++E+STY RTLQETE  + R                         +V LE QI+ +L+ K+T +KA +Y + L  +++ +T  LE   + +EN+ +  +L I    S  K L+K ++ ++  I++ ND IS+ ++EI++  + +ERKQ TI+L +K++E  IA  GG E+GPLEI I  L K I     E+  L+Q WLR Q ++  LYN                       I      IE+EK E+ DIE H+R+L+NDM++LN L+ +    +E L++ N L E++F+RSL+ E  ESIE++  L +++ EKER L+ LVE E                   QIMLWEKKIQL +E R AVDSEIG+G+++ M+ EIHRM++R+ QL++QQE ++ DME  VSRRE IA RG+   +   K  +     R++ DL++KIK+I K++++  + I  L+  ++++   I +++  I  ++    S   +++++   +  +++ +   Q   K+ Q  KD KY  LC T    E E    + +I T++TII ++ +EYPQ   DL
Sbjct:   19 GMFLYGVQQELARLQMGLEKQHDKHSHVSVQRRQKEDELETIRNLYKKTHQITDTERKKVSSMQTEVENLALRLFYMENMNRDVRSDINVMKRAVQKAEMERLQAEVEKKKQDIFVDRLTCEVDRLREQIALYEAQVSAQREDTKAARETVAEACMEIEAIAVEKKQLIQQWNSSLIGMTRRDEAYAAIQEAF---RYELLSIDAEIEGCKKTITKEEERNEQLNFMLNRAESDAAMSKKQVAQSLTKQEALRLEFSTYARTLQETEQAINRV----------------------AVKVNLEAQILAKLQEKMTSDKAAKYSSLLAAKLQKQTLELEINCSKVENETAQISLEINHSLSRMKALQKTLVDLDKNIEDTNDLISQSQNEITKRTLAIERKQATINLFSKQIEATIAQTGGKEVGPLEIQITALTKQIDECNSEIMSLQQYWLRLQTEM--LYN-----------------------IHFSADEIEQEKNEQKDIEHHMRNLKNDMVRLNMLLSKNSSTKEQLQQNNQLMESEFMRSLRAER-ESIEMQENLRNLQEEKERILHSLVETE------------------HQIMLWEKKIQLAKEMRNAVDSEIGQGDIQAMKAEIHRMQIRHSQLMKQQEKMICDMEAVVSRRETIARRGQGQSEKNKKQLTVSDFRRKLQDLRKKIKEIQKNTEECTDTIADLEDTQESLTAAIAEKQHNISTMKQDFSSTAAEIEQLQEKKRQNLLQIVSYQTRLKHLQAVKDGKYKPLCSTWQALEAEQHKQESRIHTISTIIHQIQQEYPQFQSDL 766          
BLAST of Coiled-coil domain containing 40 vs. Ensembl Xenopus
Match: grwd1 (glutamate-rich WD repeat containing 1 [Source:Xenbase;Acc:XB-GENE-986093])

HSP 1 Score: 447.973 bits (1151), Expect = 8.321e-144
Identity = 298/821 (36.30%), Postives = 477/821 (58.10%), Query Frame = 3
Query:  303 GNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKAVENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGS-IEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCE-ELESIELKSRLDDIRNEKERFLNELVEAEXXXXXXXXXXXXXXXXTRRQIMLWEKKIQLTQETREAVDSEIGEGEMKLMRCEIHRMXXXXXXXXXXXXXXXXDMEKSVSRREVIATRGEALQKVKTKVTSKGGIEREILDLKRKIKQILKSSQDYEENIKTLKLEKDNICEDIEKRKQTIDELQHQLDSLTLKLDEINNNRIGHIISLXXXXXXXXXXXXFKDKKYMRLCKTPTTGEKENDSFDKKISTLNTIIDRLCREYPQVIRDLGPI 2759
            G  LYGVQQELA+ Q  LE+  D++  +  + ++ + E   +R  ++  ++    E  K+  ++ E++  ALRLFY++   +D+R DI VM+RA +KA     + E  K +QD+ VDRL  +VD+L+E+I LYEAQ+ AQ E+ ++  +    A  EI+ I  E+K+LI QWNS+LIG+ RR+EAY  I +A    R ++LS+ +E+E  +K++ KE+E NE+L+ +LN+   D A  KK +  +  K   L++E+STY RTLQETE  + R                         +V LE QI+ +L+ K+T +KA +Y + L  +++ +T  LE   + +EN+ +  +L I    S  K L+K ++ ++  I++ ND IS+ ++EI++  + +ERKQ TI+L +K++E  IA  GG E+GPLEI I  L K I     E+  L+Q WLR Q ++  LYN                       I      IE+EK E+ DIE H+R+L+NDM++LN L+ +    +E L++ N L E++F+RSL+   E ESIE++  L +++ EKER L+ LVE E                   QIMLWEKKIQL +E R AVDSEIG+G+++ M+ EIHRM++R+ QL++QQE ++ DME  VSRRE IA RG+   +   K  +     R++ DL++KIK+I K++++  + I  L+  ++++   I +++  I  ++    S   +++++   +  +++ +   Q   K+ Q  KD KY  LC T    E E    + +I T++TII ++ +EYPQ   DL  I
Sbjct:   12 GMFLYGVQQELARLQMGLEKQHDKHSHVSVQRRQKEDELETIRNLYKKTHQITDTERKKVSSMQTEVENLALRLFYMENMNRDVRSDINVMKRAVQKAEMERLQAEVEKKKQDIFVDRLTCEVDRLREQIALYEAQVSAQREDTKAARET---ACMEIEAIAVEKKQLIQQWNSSLIGMTRRDEAYAAIQEAF---RYELLSIDAEIEGCKKTITKEEERNEQLNFMLNRAESDAAMSKKQVAQSLTKQEALRLEFSTYARTLQETEQAINRVAV-------------------VSVKVNLEAQILAKLQEKMTSDKAAKYSSLLAAKLQKQTLELEINCSKVENETAQISLEINHSLSRMKALQKTLVDLDKNIEDTNDLISQSQNEITKRTLAIERKQATINLFSKQIEATIAQTGGKEVGPLEIQITALTKQIDECNSEIMSLQQYWLRLQTEM--LYN-----------------------IHFSADEIEQEKNEQKDIEHHMRNLKNDMVRLNMLLSKNSSTKEQLQQNNQLMESEFMRSLRVSAERESIEMQENLRNLQEEKERILHSLVETE------------------HQIMLWEKKIQLAKEMRNAVDSEIGQGDIQAMKAEIHRMQIRHSQLMKQQEKMICDMEAVVSRRETIARRGQGQSEKNKKQLTVSDFRRKLQDLRKKIKEIQKNTEECTDTIADLEDTQESLTAAIAEKQHNISTMKQDFSSTAAEIEQLQEKKRQNLLQIVSYQTRLKHLQAVKDGKYKPLCSTWQALEAEQHKQESRIHTISTIIHQIQQEYPQFQSDLHSI 764          
BLAST of Coiled-coil domain containing 40 vs. Ensembl Xenopus
Match: ENSXETT00000022729.1 (coiled-coil domain containing 40 [Source:NCBI gene;Acc:100486955])

HSP 1 Score: 380.178 bits (975), Expect = 4.074e-120
Identity = 228/577 (39.51%), Postives = 362/577 (62.74%), Query Frame = 3
Query:  303 GNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKAVENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGSIEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAE 2033
            G  LYGVQQELA+ Q  LE+  D++  +  + ++ + E   +R  ++  ++    E  K+  ++ E++  ALRLFY++   +D+R DI VM+RA +KA     + E  K +QD+ VDRL  +VD L+E+I LYEAQ+ AQ E+ ++  + + EA  EI+ I  E+K+LI QWNS+LIG+ RR+EAY  I +A    R ++LS+ +E+E  +K++ KE+E NE+L+ +LN+   D A  KK +  +  K   L++E+STY RTLQETE  + R    K+                 + +V LE QI+ +L+ K+T +KA +Y + L  +++ +T  LE   + +EN+ +  +L I    S  K L+K ++ ++  I++ ND IS+ ++EI++  + +ERKQ TI+L +K++E  IA  GG E+GPLEI I  L K I     E+  L+Q WLR Q ++V L  Q+ E   +V +L+++LTIL QK+IR E  IE+EK E+ DIE H+R+L+NDM++LN L+ +    +E L++ N L E++F+RSL+  E ESIE++  L +++ EKER L+ LVE E
Sbjct:   51 GMFLYGVQQELARLQMGLEKQHDKHSHVSVQRRQKEDELETIRNLYKKTHQITDTERKKVSSMQTEVENLALRLFYMENMNRDVRSDINVMKRAVQKAEMERLQAEVEKKKQDIFVDRLTCEVDHLREQIALYEAQVSAQREDTKAARETVAEACMEIEAIAVEKKQLIQQWNSSLIGMTRRDEAYAAIQEAF---RYELLSIDAEIEGCKKTITKEEERNEQLNFMLNRAESDAAMSKKQVAQSLTKQEALRLEFSTYARTLQETEQAINRVAVVKS-----------------QVKVNLEAQILAKLQEKMTSDKAAKYSSLLAAKLQKQTLELEINCSKVENETAQISLEINHSLSRMKALQKTLVDLDKNIEDTNDLISQSQNEITKRTLAIERKQATINLFSKQIEATIAQTGGKEVGPLEIQITALTKQIDECNSEIMSLQQYWLRLQTEMVNLTKQREEQDASVEMLRRELTILQQKKIRTENEIEQEKNEQKDIEHHMRNLKNDMVRLNMLLSKNSSTKEQLQQNNQLMESEFMRSLREAERESIEMQENLRNLQEEKERILHSLVETE 607          
BLAST of Coiled-coil domain containing 40 vs. Ensembl Xenopus
Match: grwd1 (glutamate-rich WD repeat containing 1 [Source:Xenbase;Acc:XB-GENE-986093])

HSP 1 Score: 345.895 bits (886), Expect = 2.351e-107
Identity = 217/578 (37.54%), Postives = 345/578 (59.69%), Query Frame = 3
Query:  303 GNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKAVENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGS-IEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAE 2033
            G  LYGVQQELA+ Q  LE+  D++  +  + ++ + E   +R  ++  ++    E  K+  ++ E++  ALRLFY++   +D+R DI VM+RA +KA     + E  K +QD+ VDRL  +VD+L+E+I LYEAQ+ AQ E+ ++  + + EA  EI+ I  E+K+LI QWNS+LIG+ RR+EAY  I +A    R ++LS+ +E+E  +K++ KE+E NE+L+ +LN+   D A  KK +  +  K   L++E+STY RTLQETE  + R    K+                 + +V LE QI+ +L+ K+T +KA +Y + L  +++ +T  LE   + +EN+ +  +L I    S  K L+K ++ ++  I++ ND IS+ ++EI++  + +ERKQ TI+L +K++E  IA  GG E+GPLEI I  L K I     E+  L+Q WLR Q ++  LYN                       I      IE+EK E+ DIE H+R+L+NDM++LN L+ +    +E L++ N L E++F+RSL+  E ESIE++  L +++ EKER L+ LVE E
Sbjct:   51 GMFLYGVQQELARLQMGLEKQHDKHSHVSVQRRQKEDELETIRNLYKKTHQITDTERKKVSSMQTEVENLALRLFYMENMNRDVRSDINVMKRAVQKAEMERLQAEVEKKKQDIFVDRLTCEVDRLREQIALYEAQVSAQREDTKAARETVAEACMEIEAIAVEKKQLIQQWNSSLIGMTRRDEAYAAIQEAF---RYELLSIDAEIEGCKKTITKEEERNEQLNFMLNRAESDAAMSKKQVAQSLTKQEALRLEFSTYARTLQETEQAINRVAVVKS-----------------QVKVNLEAQILAKLQEKMTSDKAAKYSSLLAAKLQKQTLELEINCSKVENETAQISLEINHSLSRMKALQKTLVDLDKNIEDTNDLISQSQNEITKRTLAIERKQATINLFSKQIEATIAQTGGKEVGPLEIQITALTKQIDECNSEIMSLQQYWLRLQTEM--LYN-----------------------IHFSADEIEQEKNEQKDIEHHMRNLKNDMVRLNMLLSKNSSTKEQLQQNNQLMESEFMRSLREAERESIEMQENLRNLQEEKERILHSLVETE 583          
BLAST of Coiled-coil domain containing 40 vs. Ensembl Xenopus
Match: ENSXETT00000022711.1 (coiled-coil domain containing 40 [Source:NCBI gene;Acc:100486955])

HSP 1 Score: 322.783 bits (826), Expect = 4.850e-99
Identity = 205/537 (38.18%), Postives = 332/537 (61.82%), Query Frame = 3
Query: 1149 EVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGSIEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAEXXXXXXXXXXXXXXXXTRRQIMLWEKKIQLTQETREAVDSEIGEGEMKLMRCEIHRMXXXXXXXXXXXXXXXXDMEKSVSRREVIATRGEALQKVKTKVTSKGGIEREILDLKRKIKQILKSSQDYEENIKTLKLEKDNICEDIEKRKQTIDELQHQLDSLTLKLDEINNNRIGHIISLXXXXXXXXXXXXFKDKKYMRLCKTPTTGEKENDSFDKKISTLNTIIDRLCREYPQVIRDLGPI 2759
            E+  ++K IEKE + +V LE QI+ +L+ K+T +KA +Y + L  +++ +T  LE   + +EN+ +  +L I    S  K L+K ++ ++  I++ ND IS+ ++EI++  + +ERKQ TI+L +K++E  IA  GG E+GPLEI I  L K I     E+  L+Q WLR Q ++V L  Q+ E   +V +L+++LTIL QK+IR E  IE+EK E+ DIE H+R+L+NDM++LN L+ +    +E L++ N L E++F+RSL+  E ESIE++  L +++ EKER L+ LVE E                   QIMLWEKKIQL +E R AVDSEIG+G+++ M+ EIHRM++R+ QL++QQE ++ DME  VSRRE IA RG+   +   K  +     R++ DL++KIK+I K++++  + I  L+  ++++   I +++  I  ++    S   +++++   +  +++ +   Q   K+ Q  KD KY  LC T    E E    + +I T++TII ++ +EYPQ   DL  I
Sbjct:   11 EITAMQKKIEKESQVKVNLEAQILAKLQEKMTSDKAAKYSSLLAAKLQKQTLELEINCSKVENETAQISLEINHSLSRMKALQKTLVDLDKNIEDTNDLISQSQNEITKRTLAIERKQATINLFSKQIEATIAQTGGKEVGPLEIQITALTKQIDECNSEIMSLQQYWLRLQTEMVNLTKQREEQDASVEMLRRELTILQQKKIRTENEIEQEKNEQKDIEHHMRNLKNDMVRLNMLLSKNSSTKEQLQQNNQLMESEFMRSLREAERESIEMQENLRNLQEEKERILHSLVETE------------------HQIMLWEKKIQLAKEMRNAVDSEIGQGDIQAMKAEIHRMQIRHSQLMKQQEKMICDMEAVVSRRETIARRGQGQSEKNKKQLTVSDFRRKLQDLRKKIKEIQKNTEECTDTIADLEDTQESLTAAIAEKQHNISTMKQDFSSTAAEIEQLQEKKRQNLLQIVSYQTRLKHLQAVKDGKYKPLCSTWQALEAEQHKQESRIHTISTIIHQIQQEYPQFQSDLHSI 529          
BLAST of Coiled-coil domain containing 40 vs. Ensembl Mouse
Match: Ccdc40 (coiled-coil domain containing 40 [Source:MGI Symbol;Acc:MGI:2443893])

HSP 1 Score: 440.269 bits (1131), Expect = 3.472e-136
Identity = 300/884 (33.94%), Postives = 524/884 (59.28%), Query Frame = 3
Query:  147 TELVVLDPDHPLMKRFQDALKGMLTKQLNRIXXXXXXXXXXXXXXXXXXXXXGNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKA-VENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGSIEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAEXXXXXXXXXXXXXXXXTRRQIMLWEKKIQLTQETREAVDSEIGEGEMKLMRCEIHRMXXXXXXXXXXXXXXXXDMEKSVSRREVIATRGEALQKVKTKVTSKGGIEREILDLKRKIKQILKSSQDYEENIKTLKLEKDNICEDIEKRKQTIDELQHQLDSLTLKLDEINNNRIGHIISLXXXXXXXXXXXXFKDKKYMRLCKTPTTGEKENDSFDKKISTLNTIIDRLCREYPQVIRDLGPIRNMVQKKLEITD 2795
            ++L+VLDPDHPLM RFQ+ALKG L +Q+++++L+ +E +   K+ + +   LG +LYGVQQ LA+ Q +LE+  D +  +  + +  ++E    R  +    +   EE  KL  L+ E++  AL LFY++  ++D+R DI VM++   K   E ++ E + K +QDL VD+L E+  +L+E I L+EAQ ++QAE+ R +   + EA +EI  I  E+K+++ QW ++L+G++ RNEAY  + DA++E + Q+ S  SE+E  +KS+ +E+E NEKL+ LLN+   +   ++K+     +K   L+ E++TY   LQ+TE  L +   + +    E+   R+   +E + R +++  +V++L+ + T +K  +Y ++L  +++ +  +L T ++ ++  ++   L I          +K +  M+ E++  ND I+  ESEI+R  I +ERKQ  I+  NK+LEQM++  GG E GPLE+ I  L K  +     V + +  WLR QQ+LV++ +++ E + +V  LK+++ I+ QK++RIE  I  EK+E+  + RH+R L ND+ KLN L+ + +   E LE+ NI TET+F+R+LK  E E+I+++ +L ++  EK   LN  +EAE                   QIMLWEKKIQL +E R +VDSE G+ E++ M+ EIHRM+VR+ QLL+QQE +++DME +V+RRE I  + E   K+  KV +K     +  +L++K++++ K++ D    I  L+  +  +   +++++Q + E+Q   D L  +++++   +  +++ +   Q   K+ Q   + KY+ L +   +   E      ++S LN ++  +  +YPQ    L  I+  +  KLE  +
Sbjct:  396 SQLIVLDPDHPLMIRFQEALKGYLNRQMDKLKLDVQELDVATKQTRSQRQELGVNLYGVQQHLARLQMQLEKSHDRHSLVACERRRKEEELQCARSVYNKTCQTANEERKKLAALQTEVESLALHLFYMQNIEQDVRDDIQVMKQVVRKTETEKMHAEVEKK-KQDLFVDQLTERSHQLEENIALFEAQYLSQAEDTRVLKKAVTEAITEIDTIAVEKKRILQQWTTSLVGMKHRNEAYKTVMDALRECQHQVKSTDSEIEVCKKSIMQEEEKNEKLARLLNRAETEATLVQKMTAQCLSKQEALQTEFNTYQLALQDTEEMLNKGYVEHSAVLSELQATRQAFHQEQELRQKMDMSMVDKLQEQGTSSKMTKYFHQLLRKLQKENTNLVTHLSKIDGDIAQATLDITNTNCKIDMHKKTLAEMDKEVKRFNDLITNSESEIARRTILIERKQSLINFFNKQLEQMVSELGGEEAGPLELEIKRLSKLTEEYNTGVAEAQMTWLRLQQELVQVTHEREEQLVSVDQLKKEVHIMEQKKLRIESKIAHEKKEQKIVSRHMRDLDNDLSKLNMLLDKNRCSSEELEQNNIATETEFLRTLKDSERETIQMQEKLMELSEEKATLLNSFMEAE------------------HQIMLWEKKIQLAKEMRSSVDSETGQTEIRAMKAEIHRMKVRHGQLLKQQEKMIRDMELAVARRETIVVQAEGQSKIDKKVITKTEFHYQQRELQKKVREMHKATDDCTNTISELEETQKFLSSSLQEKQQLLSEMQATTDVLEEEINQLTALKRQNLLEIVTLQTRGKHLQAAIEGKYVFLHRNSRSQLMERKRLSVRLSQLNKVLSSVQEDYPQYQEVLQSIQQKIATKLETPE 1260          
BLAST of Coiled-coil domain containing 40 vs. Ensembl Mouse
Match: Ccdc40 (coiled-coil domain containing 40 [Source:MGI Symbol;Acc:MGI:2443893])

HSP 1 Score: 421.394 bits (1082), Expect = 4.563e-130
Identity = 274/751 (36.48%), Postives = 462/751 (61.52%), Query Frame = 3
Query:  147 TELVVLDPDHPLMKRFQDALKGMLTKQLNRIXXXXXXXXXXXXXXXXXXXXXGNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKA-VENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGSIEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAEXXXXXXXXXXXXXXXXTRRQIMLWEKKIQLTQETREAVDSEIGEGEMKLMRCEIHRMXXXXXXXXXXXXXXXXDMEKSVSRREVIATRGEALQKVKTKVTSKGGIEREILDLKRKIKQILK 2396
            ++L+VLDPDHPLM RFQ+ALKG L +Q+++++L+ +E +   K+ + +   LG +LYGVQQ LA+ Q +LE+  D +  +  + +  ++E    R  +    +   EE  KL  L+ E++  AL LFY++  ++D+R DI VM++   K   E ++ E + K +QDL VD+L E+  +L+E I L+EAQ ++QAE+ R +   + EA +EI  I  E+K+++ QW ++L+G++ RNEAY  + DA++E + Q+ S  SE+E  +KS+ +E+E NEKL+ LLN+   +   ++K+     +K   L+ E++TY   LQ+TE  L +   + +    E+   R+   +E + R +++  +V++L+ + T +K  +Y ++L  +++ +  +L T ++ ++  ++   L I          +K +  M+ E++  ND I+  ESEI+R  I +ERKQ  I+  NK+LEQM++  GG E GPLE+ I  L K  +     V + +  WLR QQ+LV++ +++ E + +V  LK+++ I+ QK++RIE  I  EK+E+  + RH+R L ND+ KLN L+ + +   E LE+ NI TET+F+R+LK  E E+I+++ +L ++  EK   LN  +EAE                   QIMLWEKKIQL +E R +VDSE G+ E++ M+ EIHRM+VR+ QLL+QQE +++DME +V+RRE I  + E   K+  KV +K     +  +L++K++++ K
Sbjct:  396 SQLIVLDPDHPLMIRFQEALKGYLNRQMDKLKLDVQELDVATKQTRSQRQELGVNLYGVQQHLARLQMQLEKSHDRHSLVACERRRKEEELQCARSVYNKTCQTANEERKKLAALQTEVESLALHLFYMQNIEQDVRDDIQVMKQVVRKTETEKMHAEVEKK-KQDLFVDQLTERSHQLEENIALFEAQYLSQAEDTRVLKKAVTEAITEIDTIAVEKKRILQQWTTSLVGMKHRNEAYKTVMDALRECQHQVKSTDSEIEVCKKSIMQEEEKNEKLARLLNRAETEATLVQKMTAQCLSKQEALQTEFNTYQLALQDTEEMLNKGYVEHSAVLSELQATRQAFHQEQELRQKMDMSMVDKLQEQGTSSKMTKYFHQLLRKLQKENTNLVTHLSKIDGDIAQATLDITNTNCKIDMHKKTLAEMDKEVKRFNDLITNSESEIARRTILIERKQSLINFFNKQLEQMVSELGGEEAGPLELEIKRLSKLTEEYNTGVAEAQMTWLRLQQELVQVTHEREEQLVSVDQLKKEVHIMEQKKLRIESKIAHEKKEQKIVSRHMRDLDNDLSKLNMLLDKNRCSSEELEQNNIATETEFLRTLKDSERETIQMQEKLMELSEEKATLLNSFMEAE------------------HQIMLWEKKIQLAKEMRSSVDSETGQTEIRAMKAEIHRMKVRHGQLLKQQEKMIRDMELAVARRETIVVQAEGQSKIDKKVITKTEFHYQQRELQKKVREMHK 1127          
BLAST of Coiled-coil domain containing 40 vs. UniProt/SwissProt
Match: sp|Q4G0X9|CCD40_HUMAN (Coiled-coil domain-containing protein 40 OS=Homo sapiens OX=9606 GN=CCDC40 PE=1 SV=2)

HSP 1 Score: 452.981 bits (1164), Expect = 4.401e-141
Identity = 302/880 (34.32%), Postives = 524/880 (59.55%), Query Frame = 3
Query:  147 TELVVLDPDHPLMKRFQDALKGMLTKQLNRIXXXXXXXXXXXXXXXXXXXXXGNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKAVENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGSIEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAEXXXXXXXXXXXXXXXXTRRQIMLWEKKIQLTQETREAVDSEIGEGEMKLMRCEIHRMXXXXXXXXXXXXXXXXDMEKSVSRREVIATRGEALQKVKTKVTSKGGIEREILDLKRKIKQILKSSQDYEENIKTLKLEKDNICEDIEKRKQTIDELQHQLDSLTLKLDEINNNRIGHIISLXXXXXXXXXXXXFKDKKYMRLCKTPTTGEKENDSFDKKISTLNTIIDRLCREYPQVIRDLGPIRNMVQKKLE 2786
            ++LVVLDPDHPLM RFQ ALK  L +Q+ +++L+ +E     K+ + +   LG +LY VQQ L   Q  LE+  D +     + ++ ++E    R  +        EE  KL  L+ EM+  AL LFY++   +D+R DI VM +  +KA     + E  K +QDL VD+L  +  +L+E+I L+EAQ +AQAE+ R +   + EA +EI  I  E+++++ QW S+L+G++ R+EA+  + +A++  + Q  S   E+E+++KS+ KE+E NEKL+ +LN+   +   ++KL T    K + L+ +++TY  TLQ+TE  L +   ++ I   E+  +R+ I+ E + R + +  I E+L+  +T NK  +Y N+L ++++ +  ++ T ++ +   ++   L I    S     +K ++ ++ ++++ N+ I+  +SEISR  I +ERKQG I+ LNK+LE+M++  GG E+GPLE+ I  L K I   + +    +  WLR QQ++VK+  ++ E + ++   K++L I+ QK++R+E  IE+EK+E+ +IE H++ L ND+ KLN L+ + +   E LE+ N +TE +F+RSLK  E E+I+++ +L+ +  EK   LN+LVEAE                   QIMLWEKKIQL +E R +VDSEIG+ E++ M+ EIHRM+VR  QLL+QQE +++ ME +V+RRE + T+ E  +K+  K  ++     + L+L+RKI+ + K++ +  + +  L+  + N+   + ++++ +  +Q   D+L   L  +   +  ++  +   Q   K+ Q  K+ +Y+ L ++  +   E    DK+++ + TI+DR+  EYPQ    L  +  M+  KLE
Sbjct:  276 SQLVVLDPDHPLMVRFQAALKNYLNRQIEKLKLDLQELVVATKQSRAQRQELGVNLYEVQQHLVHLQKLLEKSHDRHAMASSERRQKEEELQAARALYTKTCAAANEERKKLAALQTEMENLALHLFYMQNIDQDMRDDIRVMTQVVKKAETERIRAEIEKKKQDLYVDQLTTRAQQLEEDIALFEAQYLAQAEDTRILRKAVSEACTEIDAISVEKRRIMQQWASSLVGMKHRDEAHRAVLEALRGCQHQAKSTDGEIEAYKKSIMKEEEKNEKLASILNRTETEATLLQKLTTQCLTKQVALQSQFNTYRLTLQDTEDALSQDQLEQMILTEELQAIRQAIQGELELRRKTDAAIREKLQEHMTSNKTTKYFNQLILRLQKEKTNMMTHLSKINGDIAQTTLDITHTSSRLDAHQKTLVELDQDVKKVNELITNSQSEISRRTILIERKQGLINFLNKQLERMVSELGGEEVGPLELEIKRLSKLIDEHDGKAVQAQVTWLRLQQEMVKVTQEQEEQLASLDASKKELHIMEQKKLRVESKIEQEKKEQKEIEHHMKDLDNDLKKLNMLMNKNRCSSEELEQNNRVTENEFVRSLKASERETIKMQDKLNQLSEEKATLLNQLVEAE------------------HQIMLWEKKIQLAKEMRSSVDSEIGQTEIRAMKGEIHRMKVRLGQLLKQQEKMIRAMELAVARRETVTTQAEGQRKMDRKALTRTDFHHKQLELRRKIRDVRKATDECTKTVLELEETQRNVSSSLLEKQEKLSVIQADFDTLEADLTRLGALKRQNLSEIVALQTRLKHLQAVKEGRYVFLFRSKQSLVLERQRLDKRLALIATILDRVRDEYPQFQEALHKVSQMIANKLE 1137          
BLAST of Coiled-coil domain containing 40 vs. UniProt/SwissProt
Match: sp|Q8BI79|CCD40_MOUSE (Coiled-coil domain-containing protein 40 OS=Mus musculus OX=10090 GN=Ccdc40 PE=1 SV=1)

HSP 1 Score: 442.195 bits (1136), Expect = 1.629e-136
Identity = 300/884 (33.94%), Postives = 524/884 (59.28%), Query Frame = 3
Query:  147 TELVVLDPDHPLMKRFQDALKGMLTKQLNRIXXXXXXXXXXXXXXXXXXXXXGNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKA-VENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGSIEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAEXXXXXXXXXXXXXXXXTRRQIMLWEKKIQLTQETREAVDSEIGEGEMKLMRCEIHRMXXXXXXXXXXXXXXXXDMEKSVSRREVIATRGEALQKVKTKVTSKGGIEREILDLKRKIKQILKSSQDYEENIKTLKLEKDNICEDIEKRKQTIDELQHQLDSLTLKLDEINNNRIGHIISLXXXXXXXXXXXXFKDKKYMRLCKTPTTGEKENDSFDKKISTLNTIIDRLCREYPQVIRDLGPIRNMVQKKLEITD 2795
            ++L+VLDPDHPLM RFQ+ALKG L +Q+++++L+ +E +   K+ + +   LG +LYGVQQ LA+ Q +LE+  D +  +  + +  ++E    R  +    +   EE  KL  L+ E++  AL LFY++  ++D+R DI VM++   K   E ++ E + K +QDL VD+L E+  +L+E I L+EAQ ++QAE+ R +   + EA +EI  I  E+K+++ QW ++L+G++ RNEAY  + DA++E + Q+ S  SE+E  +KS+ +E+E NEKL+ LLN+   +   ++K+     +K   L+ E++TY   LQ+TE  L +   + +    E+   R+   +E + R +++  +V++L+ + T +K  +Y ++L  +++ +  +L T ++ ++  ++   L I          +K +  M+ E++  ND I+  ESEI+R  I +ERKQ  I+  NK+LEQM++  GG E GPLE+ I  L K  +     V + +  WLR QQ+LV++ +++ E + +V  LK+++ I+ QK++RIE  I  EK+E+  + RH+R L ND+ KLN L+ + +   E LE+ NI TET+F+R+LK  E E+I+++ +L ++  EK   LN  +EAE                   QIMLWEKKIQL +E R +VDSE G+ E++ M+ EIHRM+VR+ QLL+QQE +++DME +V+RRE I  + E   K+  KV +K     +  +L++K++++ K++ D    I  L+  +  +   +++++Q + E+Q   D L  +++++   +  +++ +   Q   K+ Q   + KY+ L +   +   E      ++S LN ++  +  +YPQ    L  I+  +  KLE  +
Sbjct:  326 SQLIVLDPDHPLMIRFQEALKGYLNRQMDKLKLDVQELDVATKQTRSQRQELGVNLYGVQQHLARLQMQLEKSHDRHSLVACERRRKEEELQCARSVYNKTCQTANEERKKLAALQTEVESLALHLFYMQNIEQDVRDDIQVMKQVVRKTETEKMHAEVEKK-KQDLFVDQLTERSHQLEENIALFEAQYLSQAEDTRVLKKAVTEAITEIDTIAVEKKRILQQWTTSLVGMKHRNEAYKTVMDALRECQHQVKSTDSEIEVCKKSIMQEEEKNEKLARLLNRAETEATLVQKMTAQCLSKQEALQTEFNTYQLALQDTEEMLNKGYVEHSAVLSELQATRQAFHQEQELRQKMDMSMVDKLQEQGTSSKMTKYFHQLLRKLQKENTNLVTHLSKIDGDIAQATLDITNTNCKIDMHKKTLAEMDKEVKRFNDLITNSESEIARRTILIERKQSLINFFNKQLEQMVSELGGEEAGPLELEIKRLSKLTEEYNTGVAEAQMTWLRLQQELVQVTHEREEQLVSVDQLKKEVHIMEQKKLRIESKIAHEKKEQKIVSRHMRDLDNDLSKLNMLLDKNRCSSEELEQNNIATETEFLRTLKDSERETIQMQEKLMELSEEKATLLNSFMEAE------------------HQIMLWEKKIQLAKEMRSSVDSETGQTEIRAMKAEIHRMKVRHGQLLKQQEKMIRDMELAVARRETIVVQAEGQSKIDKKVITKTEFHYQQRELQKKVREMHKATDDCTNTISELEETQKFLSSSLQEKQQLLSEMQATTDVLEEEINQLTALKRQNLLEIVTLQTRGKHLQAAIEGKYVFLHRNSRSQLMERKRLSVRLSQLNKVLSSVQEDYPQYQEVLQSIQQKIATKLETPE 1190          
BLAST of Coiled-coil domain containing 40 vs. UniProt/SwissProt
Match: sp|Q56A40|CCD40_DANRE (Coiled-coil domain-containing protein 40 OS=Danio rerio OX=7955 GN=ccdc40 PE=2 SV=2)

HSP 1 Score: 410.609 bits (1054), Expect = 4.833e-127
Identity = 292/866 (33.72%), Postives = 499/866 (57.62%), Query Frame = 3
Query:  153 LVVLDPDHPLMKRFQDALKGMLTKQLNRIXXXXXXXXXXXXXXXXXXXXXGNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKAVENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKT----RHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGSIEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAEXXXXXXXXXXXXXXXXTRRQIMLWEKKIQLTQETREAVDSEIGEGEMKLMRCEIHRMXXXXXXXXXXXXXXXXDMEKSVSRREVIATRGEALQKVKT-KVTSKGGIEREILDLKRKIKQILKSSQDYEENIKTLKLEKDNICEDIEKRKQTIDELQHQLDSLTLKLDEINNNRIGHIISLXXXXXXXXXXXXFKDKKYMRLCKTPTTGEKENDSFDKKISTLNTIIDRLCREYPQ 2735
            +VVLDP+HPLMKRFQ ALK   T QL R+ L+  E     K   +   +L  ++Y VQ+ LA+ Q+ LE  Q+       +H++ +     V+ ++Q+   +   + +++ +L+ ++D  AL+L Y++ AK D+  DI  +  A+ KA +   + E+ K QQD+ V+RL  +V+KL E+I LY+ Q+++Q E+ R+  D+L EAQ E+  +  E ++L+ QW S+L+ ++RR+EAY  + + +++  DQ+LSL +E+ES++KS+ +E+E NE L+L LN+   D  T +KL+T +QN    L+ + STYTR LQETE  L   + +  + Q  +  LRK +EK    R++LE QI+ +L+ +LT N A +Y  +    M DKT    R  E ++   EN  +   L   ++ ++   L      +E +  +++  +S  E EI +   ++ERKQ TI + NKK++ ++++ G  +LGPLEI    L K ++    ++ + +Q WL QQ +LV+   +K    ++V +L+ +LTIL Q +IR E  +E+++ E +D+++ ++ L  DM+KLN L+ +  D    L++ + L ET+F + LK  E +S E + +L+ +  EKER +N LVEAE                  RQ+MLW K+ QL QET  A+DS+IG+G+++ MR EIHRMEVRY QL++QQE L++DME  V++ + IA   EA  + +  K  +       I  L+RKI Q  K +++ +  I  L+    ++   ++ ++  ++ +Q+    L+  L  +   +  ++  L   Q  AK+    K+ +Y  +    T  E      ++++  ++  + RL +EYPQ
Sbjct:   74 IVVLDPEHPLMKRFQTALKNNFTNQLERLNLDLCEKVVVEKAEAQRRHDLAEEVYMVQEMLARLQASLEVCQETNSEAAAQHRQAEDHLYVVKNQYQDTASQTNVQRLQVLELQSKVDNLALKLLYMQEAKSDLCSDIKAIINASNKAQKERTQTEEQKHQQDIYVERLTNRVEKLLEQISLYDLQLISQTEQTRAAKDSLSEAQLELDSVIVEHRQLLQQWKSSLLMMKRRDEAYTAMQEELRQANDQMLSLDTEIESYKKSITQEEEQNECLTLRLNRGQTDCTTSRKLITHSQNLQEVLQAQLSTYTRILQETENTLSTLHGNLEMHQSALKALRKQMEKVSAVRLDLESQIMNKLQEQLTHNNAAKYSRR----MNDKTAVYRREKEAQLIKFENDFNTVTLEGQELATHLDSLLAFQAELEQKSTQRHLLLSSREEEIVKQITDIERKQATISIYNKKIKDIVSSTGHEDLGPLEIHAATLSKELEEVGAKIKECQQLWLWQQGELVRFTQEKQAHSSSVQILQTQLTILQQGKIRRESEMEQDQSELADLDKQIKVLMADMVKLNSLLNKNSDLNHALQQSSNLMETEFRQRLKEAEKDSAETQLKLERLNEEKERLINSLVEAE------------------RQVMLWGKRTQLMQETCSAIDSDIGQGDIRTMRAEIHRMEVRYAQLMKQQERLLRDMESVVAKSKTIAVWSEAQARTQAHKQPTHNDYHNTIQSLRRKILQTKKQTEECDGVIAQLEERLGSMTSRLQDKQMHLNNIQNTEAFLSQDLRRLQEIKERNLYRLPVLQTRAKHLHAVKEGRYTPMATGVTALELGTHKQEERLKMVSLTLQRLAQEYPQ 917          
BLAST of Coiled-coil domain containing 40 vs. UniProt/SwissProt
Match: sp|A8IQT2|CCD40_CHLRE (Coiled-coil domain-containing protein 40 homolog OS=Chlamydomonas reinhardtii OX=3055 GN=CCDC40 PE=1 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 1.099e-18
Identity = 118/456 (25.88%), Postives = 202/456 (44.30%), Query Frame = 3
Query:  162 LDPDHPLMKRFQDALKGMLTKQLNRIXXXXXXXXXXXXXXXXXXXXXGNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKAVENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKK 1529
            L PDHPL++R Q+ALK        R++ E +E    LK+ K     LG +LYG QQ LAK Q  LE         +Q +Q  DQ                      L QL+++          L + + D +G             E   +      +    +D L + +   ++++ L  AQ+ AQ  E R+ ++ L EA+                     +G   R+EA   I D ++E++ Q LSL  E+E ++K + +EQ  +E L+ ++ K  GD   ++K +   Q +   L+   +   ++L+ TEA            + E D + + I K       +EE+++  L ++ T  KA       T ++R + R  E  V   EN+L+   + I   +++   L + + L++ E+++K  TI K E EI R N  +E+K   ID+LN++
Sbjct:   25 LRPDHPLLRRAQEALKVQFEANRTRLQEELREKANALKQAKARREALGVELYGFQQNLAKLQLNLET-------THQNYQCEDQ----------------------LNQLKQQ----------LSLEEGDTKG-------------ERSRRVCVCVCRVCCRIDTLQDNLKGTQQQLALVSAQLEAQKRETRAALETLAEAE---------------------VGGCVRDEALSAIQDGMREQQQQELSLVLEIEGYKKDVVREQLKHESLTAVVRKVEGDAVFVQKQIEGAQERQARLQEILAKLAKSLEHTEA------------EGEADAVDRAITKVAAEGRAIEEEMLSALSDQTTAEKATSKTAADTQELRKRIRAEELAVVETENELAKLQVDILNTEAHNSRLGETLGLLDEELRDKGRTIEKYELEIKRRNDEIEKKTREIDILNRR 395          
BLAST of Coiled-coil domain containing 40 vs. TrEMBL
Match: A0A267G6B6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020612g4 PE=4 SV=1)

HSP 1 Score: 703.36 bits (1814), Expect = 0.000e+0
Identity = 419/881 (47.56%), Postives = 613/881 (69.58%), Query Frame = 3
Query:  141 DLTELVVLDPDHPLMKRFQDALKGMLTKQLNRIXXXXXXXXXXXXXXXXXXXXXGNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKAVENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGSIEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAEXXXXXXXXXXXXXXXXTRRQIMLWEKKIQLTQETREAVDSEIGEGEMKLMRCEIHRMXXXXXXXXXXXXXXXXDMEKSVSRREVIATRGEALQKVKTKVTSKGGIEREILDLKRKIKQILKSSQDYEENIKTLKLEKDNICEDIEKRKQTIDELQHQLDSLTLKLDEINNNRIGHIISLXXXXXXXXXXXXFKDKKYMRLCKTPTTGEKENDSFDKKISTLNTIIDRLCREYPQVIRDLGPIRNMVQKKL 2783
            D  EL+VLDPDHPLM+RFQ  LK +L +Q+ R+++  +E +E LKK++++HL LGN+LY +QQELAK Q  +E+  D+Y    +  Q+ +      R  F+       +E  K   LR+E+D  ALRLFY++ A++D+ GDIAVM+RAAEKA  +L K ED K++QD LVDRLVEQ D+L+E+I LY+AQ+ AQ +E ++  D L +AQSEIQ I  E K+L+SQWNS+LIGL RRNEA+  + +A+ ++ +QI SL +E E++ KS++KEQE NEKL+L+LNK   D   +K+ L +++NK   LK E+S  TR L ETE++L R NA    R+ E+D LRK IE+E   +V L E+I E++R++LTM KA EY  KLT ++RD+TR +ET++A++EN++S D L  A V++  +  +  +  ++ EI  KN  I+K E + SRNNI++ERKQG IDL NK+LEQ+IA+AGGVELGPLEITIN L K+I A+++E+  LEQ WLR+Q +LVK+ N+++++   V+ LK++L IL QK++RIEG IE+E++EK  +ER L HLQ DM +LN LI++E D  E L K N L ETDF+R+LK EE  S++L+ +L+ ++ EK R L  L++AE                  ++IMLWEKKIQL QETR AVDS++G+ E+K MR EIHRMEVR  QL+RQQE L+Q+MEKSVSRR+ IATRGEA  + K KV +KG ++RE+ +L+++IKQ +K++ + +E+I+ L+ ++  +  +I +R +  ++LQ + D L   L  + + +   I  LQ +QQ A+YYQQ ++ KY  L K     E+E     ++   L+ +I+R+  E+PQV+R +GP R+M+  +L
Sbjct:   49 DENELIVLDPDHPLMERFQQRLKNLLERQVERLQVTKREQDETLKKKRQQHLELGNELYNLQQELAKAQMHIEKAHDDYTEAKRGRQQKEMALDDTRRMFKEMSNAYNQEKRKEADLRQEVDNLALRLFYMRNAREDVLGDIAVMKRAAEKADGDLSKAEDAKMRQDHLVDRLVEQTDRLREDIALYDAQMAAQGDEIKAAKDGLADAQSEIQTIAVERKQLMSQWNSSLIGLTRRNEAHSTMLEALNQRNEQIRSLGTEAEAYAKSISKEQEQNEKLTLILNKTEKDFDMVKRQLMLSRNKHDQLKQEFSVKTRQLHETESHLERANAQIRERKTELDALRKQIERENLEKVRLTEEITEQIRSRLTMKKAAEYTQKLTGKVRDRTREVETQIALVENEISKDQLEAAHVRARLRHNQTVVESLDKEIAAKNTVITKSEQDQSRNNIDIERKQGEIDLHNKRLEQLIASAGGVELGPLEITINSLGKSIAAKQEEIAGLEQMWLREQHELVKIVNERSDLTATVNRLKKQLMILGQKKLRIEGDIEREQKEKQTVERSLNHLQTDMQRLNGLIYRETDAAEQLRKHNALLETDFVRALKEEEKVSLQLREKLEQLKEEKNRLLTALIDAE------------------QRIMLWEKKIQLAQETRAAVDSDVGQAEIKAMRSEIHRMEVRLGQLMRQQEQLIQEMEKSVSRRDTIATRGEAQARAKVKVVTKGAMQRELNELRKRIKQTIKTTNECDEDIEDLRQKQSLLESEIAERNERCNQLQQEADRLNETLASLTDMKQMQIFDLQSRQQTARYYQQVREGKYKPLYKDSARLEEERQRQQERTQALSLVIERVSSEHPQVLRAIGPCRSMINTRL 911          
BLAST of Coiled-coil domain containing 40 vs. TrEMBL
Match: A0A267F5J2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020612g1 PE=4 SV=1)

HSP 1 Score: 703.36 bits (1814), Expect = 0.000e+0
Identity = 424/885 (47.91%), Postives = 617/885 (69.72%), Query Frame = 3
Query:  141 DLTELVVLDPDHPLMKRFQDALKGMLTKQLNRIXXXXXXXXXXXXXXXXXXXXXGNDLYGVQQELAKFQSELERLQDEYY----GIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKAVENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGSIEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAEXXXXXXXXXXXXXXXXTRRQIMLWEKKIQLTQETREAVDSEIGEGEMKLMRCEIHRMXXXXXXXXXXXXXXXXDMEKSVSRREVIATRGEALQKVKTKVTSKGGIEREILDLKRKIKQILKSSQDYEENIKTLKLEKDNICEDIEKRKQTIDELQHQLDSLTLKLDEINNNRIGHIISLXXXXXXXXXXXXFKDKKYMRLCKTPTTGEKENDSFDKKISTLNTIIDRLCREYPQVIRDLGPIRNMVQKKL 2783
            D  EL+VLDPDHPLM+RFQ  LK +L +Q+ R+++  +E +E LKK++++HL LGN+LY +QQELAK Q  +E+  D+Y     G  QK   +D  +   + E  N Y    +E  K   LR+E+D  ALRLFY++ A++D+ GDIAVM+RAAEKA  +L K ED K++QD LVDRLVEQ D+L+E+I LY+AQ+ AQ +E ++  D L +AQSEIQ I  E K+L+SQWNS+LIGL RRNEA+  + +A+ ++ +QI SL +E E++ KS++KEQE NEKL+L+LNK   D   +K+ L +++NK   LK E+S  TR L ETE++L R NA    R+ E+D LRK IE+E   +V L E+I E++R++LTM KA EY  KLT ++RD+TR +ET++A++EN++S D L  A V++  +  +  +  ++ EI  KN  I+K E + SRNNI++ERKQG IDL NK+LEQ+IA+AGGVELGPLEITIN L K+I A+++E+  LEQ WLR+Q +LVK+ N+++++   V+ LK++L IL QK++RIEG+IE+E++EK  +ER L HLQ DM +LN LI++E D  E L K N L ETDF+R+LK EE  S++L+ +L+ ++ EK R L  L++AE                  ++IMLWEKKIQL QETR AVDS+IG+ E+K MR EIHRMEVR  QL+RQQE L+Q+MEKSVSRR+ IATRGEA  + K KV +KG ++RE+ +L+++IKQ +K++ + +E+I+ L+ ++  +  +I +R +  ++LQ + D L   L  + + +   I  LQ +QQ A+YYQQ ++ KY  L K     E+E     ++   L+ +I+R+  E+PQV+R +GP R+M+  +L
Sbjct:   49 DENELIVLDPDHPLMERFQQRLKNLLERQVERLQVTKREQDETLKKKRQQHLELGNELYNLQQELAKAQMHIEKAHDDYTEAKRGRQQKEMALDDTRRMFK-EMSNAY---NQEKRKEADLRQEVDNLALRLFYMRNAREDVLGDIAVMKRAAEKADGDLSKAEDAKMRQDHLVDRLVEQTDRLREDIALYDAQMAAQGDEIKAAKDGLADAQSEIQTIAVERKQLMSQWNSSLIGLTRRNEAHSTMLEALNQRNEQIRSLGTEAEAYAKSISKEQEQNEKLTLILNKTEKDFDMVKRQLMLSRNKHDQLKQEFSVKTRQLHETESHLERANAQIRERKTELDALRKQIERENLEKVRLTEEITEQIRSRLTMKKAAEYTQKLTGKVRDRTREVETQIALVENEISKDQLEAAHVRARLRHNQTVVESLDKEIAAKNTVITKSEQDQSRNNIDIERKQGEIDLHNKRLEQLIASAGGVELGPLEITINSLGKSIAAKQEEIAGLEQMWLREQHELVKIVNERSDLTATVNRLKKQLMILGQKKLRIEGNIEREQKEKQTVERSLNHLQTDMQRLNGLIYRETDAAEQLRKHNALLETDFVRALKEEEKVSLQLREKLEQLKEEKNRLLTALIDAE------------------QRIMLWEKKIQLAQETRAAVDSDIGQAEIKAMRSEIHRMEVRLGQLMRQQEQLIQEMEKSVSRRDTIATRGEAQARAKVKVVTKGAMQRELNELRKRIKQTIKTTNECDEDIEDLRQKQSLLESEIAERNERCNQLQQEADRLNETLASLTDMKQMQIFDLQSRQQTARYYQQVREGKYKPLYKDSARLEEERQRQQERTQALSLVIERVSSEHPQVLRAIGPCRSMINTRL 911          
BLAST of Coiled-coil domain containing 40 vs. TrEMBL
Match: A0A1I8IC11 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 696.427 bits (1796), Expect = 0.000e+0
Identity = 421/885 (47.57%), Postives = 614/885 (69.38%), Query Frame = 3
Query:  141 DLTELVVLDPDHPLMKRFQDALKGMLTKQLNRIXXXXXXXXXXXXXXXXXXXXXGNDLYGVQQELAKFQSELERLQDEYY----GIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKAVENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGSIEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAEXXXXXXXXXXXXXXXXTRRQIMLWEKKIQLTQETREAVDSEIGEGEMKLMRCEIHRMXXXXXXXXXXXXXXXXDMEKSVSRREVIATRGEALQKVKTKVTSKGGIEREILDLKRKIKQILKSSQDYEENIKTLKLEKDNICEDIEKRKQTIDELQHQLDSLTLKLDEINNNRIGHIISLXXXXXXXXXXXXFKDKKYMRLCKTPTTGEKENDSFDKKISTLNTIIDRLCREYPQVIRDLGPIRNMVQKKL 2783
            D  EL+VLDPDHPLM+RFQ  LK +L +Q+ R+++  +E +E LKK++++HL LGN+LY +QQELAK Q  +E+  D+Y     G  QK   +D  +   + E  N Y    +E  K   LR+E+D  ALRLFY++ A++D+ GDIAVM+RAAEKA  +L K ED K++QD LVDRLVEQ D+L+E+I LY+AQ+ AQ +E ++  D L +AQSEIQ I  E K+L+SQWNS+LIGL RRNEA+  + +A+ ++ +QI SL +E E++ KS++KEQE NEKL+L+LNK   D   +K+ L +++NK   LK E+S  TR L ETE++L R NA    R+ E+D LRK IE+E   +V L E+I E++R++LTM KA EY  KLT ++RD+TR +ET++A++EN++S D L  A V++  +  +  +  ++ EI  KN  I+K E + SRNNI++ERKQG IDL NK+LEQ+IA+AGGVELGPLEITIN L K+I A+++E+  LEQ WLR+Q +LVK+ N+++++   V+ LK++L IL QK++RIEG+IE+E++EK  +ER L HLQ DM +LN LI++E D  E L K N L ETDF+R+LK EE  S++L+ +L+ ++ EK R L  L++AE                  ++IMLWEKKIQL QETR AVDS+IG+ E+K MR EIHRMEVR  QL+RQQE L+Q+MEKSVSRR+ IATRGEA  + K KV +KG ++RE+ +L+++IKQ +K++ + +E+I+ L+ ++  +  +I +R +  ++LQ + D L   L  + +      +    +QQ A+YYQQ ++ KY  L K     E+E     ++   L+ +I+R+  E+PQV+R +GP R+M+  +L
Sbjct:   49 DENELIVLDPDHPLMERFQQRLKNLLERQVERLQVTKREQDETLKKKRQQHLELGNELYNLQQELAKAQMHIEKAHDDYTEAKRGRQQKEMALDDTRRMFK-EMSNAY---NQEKRKEADLRQEVDNLALRLFYMRNAREDVLGDIAVMKRAAEKADGDLSKAEDAKMRQDHLVDRLVEQTDRLREDIALYDAQMAAQGDEIKAAKDGLADAQSEIQTIAVERKQLMSQWNSSLIGLTRRNEAHSTMLEALNQRNEQIRSLGTEAEAYAKSISKEQEQNEKLTLILNKTEKDFDMVKRQLMLSRNKHDQLKQEFSVKTRQLHETESHLERANAQIRERKTELDALRKQIERENLEKVRLTEEITEQIRSRLTMKKAAEYTQKLTGKVRDRTREVETQIALVENEISKDQLEAAHVRARLRHNQTVVESLDKEIAAKNTVITKSEQDQSRNNIDIERKQGEIDLHNKRLEQLIASAGGVELGPLEITINSLGKSIAAKQEEIAGLEQMWLREQHELVKIVNERSDLTATVNRLKKQLMILGQKKLRIEGNIEREQKEKQTVERSLNHLQTDMQRLNGLIYRETDAAEQLRKHNALLETDFVRALKEEEKVSLQLREKLEQLKEEKNRLLTALIDAE------------------QRIMLWEKKIQLAQETRAAVDSDIGQAEIKAMRSEIHRMEVRLGQLMRQQEQLIQEMEKSVSRRDTIATRGEAQARAKVKVVTKGAMQRELNELRKRIKQTIKTTNECDEDIEDLRQKQSLLESEIAERNERCNQLQQEADRLNETLASLTD------MKQMSRQQTARYYQQVREGKYKPLYKDSARLEEERQRQQERTQALSLVIERVSSEHPQVLRAIGPCRSMINTRL 905          
BLAST of Coiled-coil domain containing 40 vs. TrEMBL
Match: K1Q3F2 (Coiled-coil domain-containing protein 40 OS=Crassostrea gigas OX=29159 GN=CGI_10024996 PE=4 SV=1)

HSP 1 Score: 683.33 bits (1762), Expect = 0.000e+0
Identity = 416/864 (48.15%), Postives = 595/864 (68.87%), Query Frame = 3
Query:  147 TELVVLDPDHPLMKRFQDALKGMLTKQLNRIXXXXXXXXXXXXXXXXXXXXXGNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKAVENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGSIEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAEXXXXXXXXXXXXXXXXTRRQIMLWEKKIQLTQETREAVDSEIGEGEMKLMRCEIHRMXXXXXXXXXXXXXXXXDMEKSVSRREVIATRGEALQKVKTKVTSKGGIEREILDLKRKIKQILKSSQDYEENIKTLKLEKDNICEDIEKRKQTIDELQHQLDSLTLKLDEINNNRIGHIISLXXXXXXXXXXXXFKDKKYMRLCKTPTTGEKENDSFDKKISTLNTIIDRLCREYPQV 2738
            T++VVLDPDHPLMKRFQ+ALK  LT Q  ++ LE +E  E L+ RK+E  +LG DLYG+QQELA+FQ  LE+  DE+  + Q  Q+ + +   VR  ++     V +E  K  +L+ E++  ALRLFY++ AK+D+R DIA+MRRAAEKA   + K E  K +QDL VDRLVE VDKLKEEI ++EAQI AQ EE ++  + L EA  EI+ I  E+K+L  QWNS+LIG++RR+EA+  + +A+  +  ++LSL++ELE  +KS+ +EQE NEKL+L+LNK   D+ T+KK L+  Q K   LK EY+TYTR L ETE  L R   DK +R  E++ LRK IE+E+  +VELE++I+E++R +LTM+KA +Y  KLT + RD T+ LET+ A +EN +S D+L I+ V++  + L K +  ++ EI +KN+ IS+ E EI + N  +ERKQ  ID  NK+LE +I+ AGGVELGPLEITIN L K+I+A++ E+ +L+Q WLRQQ +LV+L   K+    +V  LK++LTILSQK+IR EG I++++RE  DIER + ++QNDMIKLN L+ +EK   +NL ++NIL E DFI +LK  E+ESI+L+  LD I+ EKER LN LVEAE                  RQIMLWEKK QL +ETR AVDSE+G+GE+K M  EIHRM+VRY QL++QQE ++Q+MEK+VSRR+ I TRG+A QK+  KV +KG  ER++ +L++KIK  ++ +   ++ I+ L+  +  + + +E ++  +  LQ   D+L   ++ +  N+  ++  L  KQQ AKY+QQ KD KY  LCK+ ++ E E+     ++  L+ I+DRL +E+P V
Sbjct:  228 TDMVVLDPDHPLMKRFQNALKSHLTSQNEKVTLELRELTEALRNRKKEREDLGVDLYGIQQELARFQMLLEKNHDEFANLNQGRQQEEAQLDDVRNTYKETQVIVNKEKKKCAELQGEVENLALRLFYMQNAKEDVRSDIAIMRRAAEKADTEVSKAEVEKQRQDLFVDRLVETVDKLKEEIAMFEAQIAAQTEETKAAKEALMEAHMEIEAIHLEKKQLFQQWNSSLIGMRRRDEAHSAMQEALNTQEQKVLSLETELEGFKKSIWQEQEQNEKLTLILNKTERDIETVKKQLSQCQAKHDALKAEYATYTRMLHETEQALNRAVTDKTLRLNELNALRKQIEREYLEKVELEDEIMEKMRTQLTMDKASQYTKKLTTKQRDLTKSLETQTAEVENTISRDSLEISNVQTRIERLGKIMDQLDEEIAQKNEIISRSEQEIVKRNAIIERKQNIIDQYNKRLETLISKAGGVELGPLEITINSLQKSIEARQQEIAELQQMWLRQQSELVQLTKDKDMQSVDVRKLKKQLTILSQKKIRTEGDIDEQRRETYDIERSISNMQNDMIKLNTLLNKEKGTHDNLHQDNILLENDFIMALKEAEMESIQLQENLDGIKEEKERLLNSLVEAE------------------RQIMLWEKKTQLARETRAAVDSEVGQGEIKAMNAEIHRMQVRYTQLMKQQEKMIQEMEKAVSRRDTIVTRGDAQQKINKKVLTKGTFERQMGELRKKIKVTIQEANGCDDEIQDLRGHQVELSQQLEDKQVNVQHLQGNSDTLDGDIERLFENKQKNMSELLGKQQKAKYFQQAKDGKYTMLCKSESSLENESTKQVDRMQALSAIVDRLNQEFPHV 1073          
BLAST of Coiled-coil domain containing 40 vs. TrEMBL
Match: R7VJU3 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_177430 PE=4 SV=1)

HSP 1 Score: 677.167 bits (1746), Expect = 0.000e+0
Identity = 402/862 (46.64%), Postives = 588/862 (68.21%), Query Frame = 3
Query:  153 LVVLDPDHPLMKRFQDALKGMLTKQLNRIXXXXXXXXXXXXXXXXXXXXXGNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKAVENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGSIEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAEXXXXXXXXXXXXXXXXTRRQIMLWEKKIQLTQETREAVDSEIGEGEMKLMRCEIHRMXXXXXXXXXXXXXXXXDMEKSVSRREVIATRGEALQKVKTKVTSKGGIEREILDLKRKIKQILKSSQDYEENIKTLKLEKDNICEDIEKRKQTIDELQHQLDSLTLKLDEINNNRIGHIISLXXXXXXXXXXXXFKDKKYMRLCKTPTTGEKENDSFDKKISTLNTIIDRLCREYPQV 2738
            +VVLDPDHPLMKRFQ ALK  L KQ  ++ +E +E  E  K + +E  + G DLYGVQQELA+ Q  LE+  DE+    Q   +V+QE   VR  +++   KV +E  K  +L +E++  ALRLFY++ AK+D+R DIAVM+RAAEKA   + K E  K +QD+ V+RLVE+VD+L+E++ +YEAQ+ AQ EE ++  + L EA  E++ I  E+K+L  QWNS+LIG++RR+EA+  + +A+  +  +I SL +E+E ++KS+ KEQE NEKL L+  K   D+AT+KKLL   Q K   LK EYSTYTR L ETE  L R   DK +R  EV+ LRK IE E++ARVELE+ I+E++R +LT++K  +Y NKLT +MR+ TR LE+++A +EN +S   L ++  ++ +  ++K    ++++I+ KND ISK E+EI + N  VERKQG ID  NKKLE MI+ AGGVELGPLEITIN L K+I+A+E E+ +L+Q WLR Q +LV+L   K++   +V  LK++LTILSQK++RIEG I ++  + ++IER + +++ND+IKLN L+ +E   Q+ LE+ N+L E DF+  LK  E+ESI+++  LD +  EKER LN LVEAE                  RQIMLWEKK QL +ETR AVDSE+G+GEM+ M+ EIHRM+VR+ QL++QQE ++Q+MEK+VSRR+ I TRG+A  K+  KV +KG  +R++++LK+K+K  ++ +   ++ I+ L+  + ++   IE+R+  + +LQ   D+L   LD + +N+  ++  L  KQQ  KYY Q KD +Y RLCKT +  E E+    +++  L+ I+DRL ++YP  
Sbjct:    1 MVVLDPDHPLMKRFQTALKNHLDKQNEKVSMELRELMESCKSKHKEREDAGIDLYGVQQELARHQMMLEKEHDEFSKTKQIRSQVEQELNDVRNMYKDNQTKVNDERKKGSELMQEVENLALRLFYMEAAKEDVRSDIAVMKRAAEKADVEVTKAESEKQKQDIFVNRLVERVDRLREDMAMYEAQLNAQTEETKAAKEALSEAFMEVENITLEKKQLFQQWNSSLIGMKRRDEAHSAMQEALNLQNQKIRSLLTEIEGYKKSITKEQEQNEKLMLIFAKTDADIATMKKLLAQCQAKQEALKNEYSTYTRMLHETEQALNRATTDKTLRTNEVNALRKQIEHEYQARVELEDMILEKMRTQLTIDKGSKYTNKLTKKMREITRDLESQMANVENDISKSMLEVSHTRTRSDRMKKIAEALDDDIKSKNDIISKSETEIVKRNAIVERKQGVIDQYNKKLELMISQAGGVELGPLEITINSLQKSIEAEEQEITELQQMWLRDQSELVRLSKDKDKQSGDVVNLKKQLTILSQKKLRIEGDINRQTTDTAEIERSICNMRNDIIKLNILLHKESGIQQELEQGNVLIEGDFVGVLKEAEMESIQMQESLDSLNEEKERLLNSLVEAE------------------RQIMLWEKKTQLARETRAAVDSEVGQGEMRSMKAEIHRMQVRHSQLMKQQERMIQEMEKAVSRRDTIVTRGDAQSKMNKKVITKGTFKRQMVELKKKVKATIQEANSCDQEIQVLREHQQDLSRQIEERQMNVQQLQETSDALDGDLDRMVDNKNKNMADLLAKQQKTKYYIQAKDNRYTRLCKTNSALEAESQKQVERMQNLSAIVDRLIQDYPHA 844          
BLAST of Coiled-coil domain containing 40 vs. Ensembl Cavefish
Match: ccdc40 (coiled-coil domain containing 40 [Source:NCBI gene;Acc:568590])

HSP 1 Score: 371.318 bits (952), Expect = 3.612e-114
Identity = 291/855 (34.04%), Postives = 488/855 (57.08%), Query Frame = 3
Query:  183 MKRFQDALKGMLTKQLNRIXXXXXXXXXXXXXXXXXXXXXGNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIK----LEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKAVENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGSIEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAEXXXXXXXXXXXXXXXXTRRQIMLWEKKIQLTQETREAVDSEIGEGEMKLMRCEIHRMXXXXXXXXXXXXXXXXDMEKSVSRREVIATRGEALQKVKTKVTSKGGIEREILDLKRKIKQILKSSQDYEENIKTLKLEKDNICEDIEKRKQTIDELQHQLDSLTLKLDEINNNRIGHIISLXXXXXXXXXXXXFKDKKYMRLCKTPTTGEKENDSFDKKISTLNTIIDRLCREYPQ 2735
            MKRFQ AL+  LT QL R++ E +E E + K ++ +  +L  +L+  QQ LAK Q+ LE  +D         ++  QEQL+   + +N+Y  V E++ K    + +L+ E DK A  L Y++    D+R DI VM+ A  KA     + E  K +QDL V+RLV+Q +KLKE+I LYE Q +AQAEE ++  D L EAQ  +  +  E K+L+ QWNS+L+   +R+EA+  + +A+++   Q+ +L +E E +++ + KEQE NE L++ LN+   + AT +KL+T + ++   L++ YST +RTLQETE +L   N + +  Q E+  LRK + +    R++LEE+I+++++ +LT + A +Y  +L+ +     R  E + + LE++L+   L + +V    + L      +E EI  ++  ++  E+E ++  I +ERKQ TI+  NKK++Q++A+ G  +L PLEI +++L++ ++    E  + ++  L QQ +LVKL  ++    + V  L  +LTIL QK+I+IE   E+ +R  +++ER  + L+ DM KL  L+ Q     + L++  ILTE  FI  LK  E ES+ ++   + ++ EKER LN L+EAE                  RQI+LWEKKIQL +ETR  VD+E+G+G++  M+ EIHRME+RY +L +Q+E L+++ME +V+RRE I  R EA  +   K  +   +   +  L+R I    K    +   +  + L  D        ++  I  + +   SL+ KL ++   R G++  L   Q  AK+ Q  K+ +Y          E+      +++ +++ I+ R  +++PQ
Sbjct:    1 MKRFQSALEKHLTDQLKRLDHEFREKEAQEKAKRSQKESLAVELHSAQQGLAKMQAALEVRRDASAQASAWRRDA-QEQLE---DTRNQYSTVAEQTSKQRAEVSELQSEEDKLAQNLLYMQDVTSDLRSDITVMKNATRKAQSEKLQAEQQKQKQDLYVERLVKQEEKLKEQINLYEVQTLAQAEETQAAKDALAEAQLGMDSLAVERKQLLQQWNSSLMETNKRDEAFTAMQEALRQANLQMRALDTEAEGYKRLIVKEQEQNELLTIRLNRAQLNSATCRKLITHSNSQQEALQVMYSTCSRTLQETEKSL---NREYSTCQSELAVLRKRLAEASSVRLDLEEKIMKKMQEQLTHDNAAKYSKQLSNKTVSHQREREAQHSKLESELAAVTLEVNQVTLRLEALAGLQADLEKEICHRHQLLTAREAEAAKYVIAIERKQATINEYNKKIQQIVASTGLEDLSPLEIQVSNLNEQLKEVGAETKEKQRILLWQQGELVKLSQERQAQNSAVLTLHTQLTILQQKKIKIESEYEQNQRGLAELERFSKSLRLDMQKLQSLVNQNSQLSQELQQSLILTEKSFIHELKDAERESVGMQLHWEKLQEEKERLLNSLMEAE------------------RQILLWEKKIQLVRETRSTVDTEVGKGDICTMKAEIHRMELRYGKLSKQKEQLMREMEAAVARRESIVVRIEAQGRSDRKQPTHSSLHHTLQGLRRSILHTHKVGVTFTLTV-YVYLSTD--------KQLHISAIHNTCTSLSTKLQDLQETREGNLTRLVALQSRAKHLQAVKEGRYSATASGEAALEQAMQKQHERLHSVSGILRRAMQDFPQ 821          
BLAST of Coiled-coil domain containing 40 vs. Ensembl Medaka
Match: ccdc40 (coiled-coil domain containing 40 [Source:NCBI gene;Acc:101158665])

HSP 1 Score: 253.062 bits (645), Expect = 1.916e-70
Identity = 212/776 (27.32%), Postives = 418/776 (53.87%), Query Frame = 3
Query:  150 ELVVLDPDHPLMKRFQDALKGMLTKQLNRIXXXXXXXXXXXXXXXXXXXXXGNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQ---NKYKKVT----EESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKAVENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHII-------LMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGSIEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAEXXXXXXXXXXXXXXXXTRRQIMLWEKKIQLTQETREAVDSEIGEGEMKLMRCEIHRMXXXXXXXXXXXXXXXXDMEKSVSRREVIATRGEALQKVKTKVTSKGGIEREILDLKRKIKQILKSSQDYEENIKTLK 2435
            E ++LD +HPL+ R+  AL   L  QL RI L   E     K++      +   +Y +Q++LA+ Q+ LE         +Q   E +  +LQ + + Q   ++Y  V+    + + K+ +L+ E+D+A   L + +   +++   +  M     KA       E+  L QDL +DRL +++ +L E   +++    AQAEE  +  + L EA+++++ +  + K+L+ QWNS+L  + R++EA C + +A +  +++++ ++ E+E ++KS ++EQE NEKL++ LN    D  T +K ++  + +   ++  YS   RTL ET   L     + ++ + E+   RK +EK+   R+ELE+++  +++ KLT ++  ++  +L  +M    +    +V +LEN+L    LA   V+  ++ LE+H+         + ++I + N T++  ++++S    ++E+    ++  NKK+ Q++ N    +L PL++ I  +   I+     +   +Q W++QQ   +++  + +     +  L+ + T L Q++IR++  +   +RE ++ E HL  L+ D++ L  L+ + +   + +E EN L E DFI +L+  E ESI  ++ L++ + E +  +N L+EAE                  R+I+LW+KK Q+ +ETR A++  + + E++  + +IH +E+R  QL +QQE L+++ E  V +RE I  R EA+     K  ++G ++R I  L+ K ++  K   ++E  ++ L+
Sbjct:   87 EFIILDYEHPLISRYAAALSRQLQNQLERINLTLNEKVAAEKEQDSGKNEVCIQMYKIQEQLARGQNRLE-------AGHQARAEAEARRLQAQDQLQETESRYSNVSGLNSQATAKVSKLQTELDRAMQDLIFTQRVSEELNSKVKTMNNVRHKAGAKKAHAEEELLNQDLYIDRLTKEMFRLTERNTMHQLYTEAQAEETLTGREALCEAEADMELLLIKHKQLLQQWNSSLRTIMRQSEALCAMQEAARSVKNEVIVMKREMEGYKKSNSEEQEKNEKLTMQLNWFEIDCTTSEKQISQKRAQKEAIQAHYSACLRTLDETTRTLDILTKESHLYESELSEQRKQLEKQSALRLELEDKVTTKMQQKLTNDRTAKHYQQLNTKMTALKKEKMHQVHLLENEL----LA---VRLESQNLEEHLTSLAFTQKALNDKIADYNKTLTLNQAKLSSLLQDIEQNWAAVNHCNKKIAQIMLNTEREDLSPLQVKIKDVQSEIETIAAHIQKEQQLWMKQQSTFLEMIQENDAKAREIRKLQTEQTGLEQRRIRLQSQVNVAEREVAEQEEHLNSLRRDLLSLICLLGRNQHLSQAVEYENTLMEADFIHALREAERESITTQTMLEEAQEETQMLINSLLEAE------------------RRILLWDKKTQILKETRTALELLMKDDEIQKTKDDIHHLELRATQLRKQQERLIRESEAIVDKRESIVRRREAVAHAPPKQNTEGELQRSIKFLRSKCQEAQKHLVEFEHTVRELQ 830          
BLAST of Coiled-coil domain containing 40 vs. Planmine SMEST
Match: SMESG000008312.1 (SMESG000008312.1)

HSP 1 Score: 1633.23 bits (4228), Expect = 0.000e+0
Identity = 908/927 (97.95%), Postives = 909/927 (98.06%), Query Frame = 3
Query:   15 MSSGDPDENNLNEILGDDDLYGXXXXXXXXXXXXXXXXXXXRDLTELVVLDPDHPLMKRFQDALKGMLTKQLNRIXXXXXXXXXXXXXXXXXXXXXGNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKAVENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGSIEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAEXXXXXXXXXXXXXXXXTRRQIMLWEKKIQLTQETREAVDSEIGEGEMKLMRCEIHRMXXXXXXXXXXXXXXXXDMEKSVSRREVIATRGEALQKVKTKVTSKGGIEREILDLKRKIKQILKSSQDYEENIKTLKLEKDNICEDIEKRKQTIDELQHQLDSLTLKLDEINNNRIGHIISLXXXXXXXXXXXXFKDKKYMRLCKTPTTGEKENDSFDKKISTLNTIIDRLCREYPQVIRDLGPIRNMVQKKLEITD 2795
            MSSGDPDENNLNEILGDDDLYGNMEENLNNYNNENLDEMEERDLTELVVLDPDHPLMKRFQDALKGMLTKQLNRIELEDKETEEELKKRKEEHLNLGNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKAVENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGSIEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAE                  RQIMLWEKKIQLTQETREAVDSEIGEGEMKLMRCEIHRMEVRYQQLLRQQELLVQDMEKSVSRREVIATRGEALQKVKTKVT+KGGIEREILDLKRKIKQILKSSQDYEENIKTLKLEKDNICEDIEKRKQTIDELQHQLDSLTLKLDEINNNRIGHIISLQQKQQIAKYYQQFKDKKYMRLCKTPTTGEKENDSFDKKISTLNTIIDRLCREYPQVIRDLGPIRNMVQKKLEITD
Sbjct:    1 MSSGDPDENNLNEILGDDDLYGNMEENLNNYNNENLDEMEERDLTELVVLDPDHPLMKRFQDALKGMLTKQLNRIELEDKETEEELKKRKEEHLNLGNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKAVENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGSIEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAE------------------RQIMLWEKKIQLTQETREAVDSEIGEGEMKLMRCEIHRMEVRYQQLLRQQELLVQDMEKSVSRREVIATRGEALQKVKTKVTTKGGIEREILDLKRKIKQILKSSQDYEENIKTLKLEKDNICEDIEKRKQTIDELQHQLDSLTLKLDEINNNRIGHIISLQQKQQIAKYYQQFKDKKYMRLCKTPTTGEKENDSFDKKISTLNTIIDRLCREYPQVIRDLGPIRNMVQKKLEITD 909          
BLAST of Coiled-coil domain containing 40 vs. Planmine SMEST
Match: SMESG000044048.1 (SMESG000044048.1)

HSP 1 Score: 652.129 bits (1681), Expect = 0.000e+0
Identity = 404/883 (45.75%), Postives = 605/883 (68.52%), Query Frame = 3
Query:  141 DLTELVVLDPDHPLMKRFQDALKGMLTKQLNRIXXXXXXXXXXXXXXXXXXXXXGNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKAVENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGSIEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAEXXXXXXXXXXXXXXXXTRRQIMLWEKKIQLTQETREAVDSEIGEGEMKLMRCEIHRMXXXXXXXXXXXXXXXXDMEKSVSRREVIATRGEALQKVKTKVTSKGGIEREILDLKRKIKQILKSSQDYEENIKTLKLEKDNICEDIEKRKQTIDELQH-QLDSLTLKLDEINNNRIGHIISLXXXXXXXXXXXXFKDKKYMRLCKTPTTGEKENDSFDKKISTLNTIIDRLCREYPQVIRDLGPIRNMVQKKLE 2786
            ++TELVVLDPDHPLMKRFQD+L  ML KQL RI+LED+ET E+L+K + EHL  GN+L+ VQQELAKFQ+ LE L +EY       +  +      + E++    +V  E+ K+ ++R+EMD  ALRL+YLK A++DI+GDIAVM+RAAEKAVE+L + E  K+ QD ++D LV +V +LKE+IGLYEAQ+VAQ +E+ +    L EA+ EIQ I  E K L+++WNS LI L RRNEA+C + +A+ EK++QIL LQ+E+E ++++  KEQ+ NE+++L+  K   D+  +KK++   + K+  +K  Y      L +TE  L +   DK  +       +K IE  +K + ELE+++ EELR K+TM    + ++K   ++RD++R LE++V +L N  S +AL +A++KS    +E++  + E EI EKNDTI+KLE E+ R+   +ER+QGTID LNK+LE ++ + GG+E+GPLEITINHL+KNIQ   +E++DLEQQWLR+Q ++VKL+N+K  +  ++S LKQ+  +L QK+IR+E  I KE  +K  IE+ L  +QN M+ +N  IF+E+  +ENLEK N L ETDF+R LK EE+E+ +L+S++D+I ++K+R+L E+VE                   + Q M++EKKIQL QE ++ + S++G+GE+K M+ EIHRME+R++QL  QQE L+QDMEKSV +R++I  RGEAL+K++ KVT+KG +E+ I  +KRK +QI K++ D EE   T +  +  I  D  K ++ I+ +Q+ ++ ++ + LDEI+  +   ++ LQ KQQ+ KYY + +DKKY+R+CKT T   +E  +  +K+++   IIDR+  EYPQ    L P R +VQK LE
Sbjct:   39 NITELVVLDPDHPLMKRFQDSLNAMLIKQLERIQLEDRETSEDLRKHRTEHLEAGNELFTVQQELAKFQTILEGLNEEYNTAKFTRENTEAFLNSSKDEYKKVRYEVDFETAKMREMRQEMDNIALRLYYLKSAEEDIKGDIAVMKRAAEKAVEDLQRAEKEKMHQDFILDTLVNEVARLKEDIGLYEAQLVAQNDEKCAAKLTLHEAEDEIQRIILERKHLMNKWNSCLIDLTRRNEAFCALNEALSEKKEQILVLQNEIEGYKRNTRKEQDLNERMTLIFKKSEYDIVNLKKIIEDHKAKYAAMKSNYGNSVNILHQTETVLAQIIRDKKEQLAITGEYQKSIESLYKLKNELEDKMDEELRKKMTMKSLAQCLDKGIKRIRDQSRQLESQVVLLANNESNNALKLAELKSEIYEIERYFKITEEEINEKNDTINKLEVEMGRSKTFIERRQGTIDRLNKQLELLLQSRGGIEVGPLEITINHLNKNIQTVYEEISDLEQQWLRKQHEIVKLFNEKEALNEDISRLKQQSFLLVQKKIRLESYIAKENCDKRVIEKELLQIQNKMVNINNSIFKERFTKENLEKINNLAETDFVRELKEEEMEATKLQSKIDEIESKKDRYLKEIVE------------------NQWQAMMYEKKIQLIQEAQQTILSDLGQGEIKAMKIEIHRMEIRFKQLALQQEYLIQDMEKSVVKRDIITKRGEALEKIQNKVTTKGALEKTIAQIKRKTEQIKKNAIDCEEKTITYR-SQLKILVDKLKEQEEINSVQNREIINMVIHLDEISILKYSQLMELQYKQQMFKYYSEVRDKKYVRICKTSTALGREKKTQSEKMNSFIVIIDRIISEYPQTQSSLNPTRQLVQKYLE 902          
BLAST of Coiled-coil domain containing 40 vs. Planmine SMEST
Match: SMESG000044048.1 (SMESG000044048.1)

HSP 1 Score: 651.744 bits (1680), Expect = 0.000e+0
Identity = 404/883 (45.75%), Postives = 605/883 (68.52%), Query Frame = 3
Query:  141 DLTELVVLDPDHPLMKRFQDALKGMLTKQLNRIXXXXXXXXXXXXXXXXXXXXXGNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKAVENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGSIEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAEXXXXXXXXXXXXXXXXTRRQIMLWEKKIQLTQETREAVDSEIGEGEMKLMRCEIHRMXXXXXXXXXXXXXXXXDMEKSVSRREVIATRGEALQKVKTKVTSKGGIEREILDLKRKIKQILKSSQDYEENIKTLKLEKDNICEDIEKRKQTIDELQH-QLDSLTLKLDEINNNRIGHIISLXXXXXXXXXXXXFKDKKYMRLCKTPTTGEKENDSFDKKISTLNTIIDRLCREYPQVIRDLGPIRNMVQKKLE 2786
            ++TELVVLDPDHPLMKRFQD+L  ML KQL RI+LED+ET E+L+K + EHL  GN+L+ VQQELAKFQ+ LE L +EY       +  +      + E++    +V  E+ K+ ++R+EMD  ALRL+YLK A++DI+GDIAVM+RAAEKAVE+L + E  K+ QD ++D LV +V +LKE+IGLYEAQ+VAQ +E+ +    L EA+ EIQ I  E K L+++WNS LI L RRNEA+C + +A+ EK++QIL LQ+E+E ++++  KEQ+ NE+++L+  K   D+  +KK++   + K+  +K  Y      L +TE  L +   DK  +       +K IE  +K + ELE+++ EELR K+TM    + ++K   ++RD++R LE++V +L N  S +AL +A++KS    +E++  + E EI EKNDTI+KLE E+ R+   +ER+QGTID LNK+LE ++ + GG+E+GPLEITINHL+KNIQ   +E++DLEQQWLR+Q ++VKL+N+K  +  ++S LKQ+  +L QK+IR+E  I KE  +K  IE+ L  +QN M+ +N  IF+E+  +ENLEK N L ETDF+R LK EE+E+ +L+S++D+I ++K+R+L E+VE                   + Q M++EKKIQL QE ++ + S++G+GE+K M+ EIHRME+R++QL  QQE L+QDMEKSV +R++I  RGEAL+K++ KVT+KG +E+ I  +KRK +QI K++ D EE   T +  +  I  D  K ++ I+ +Q+ ++ ++ + LDEI+  +   ++ LQ KQQ+ KYY + +DKKY+R+CKT T   +E  +  +K+++   IIDR+  EYPQ    L P R +VQK LE
Sbjct:   36 NITELVVLDPDHPLMKRFQDSLNAMLIKQLERIQLEDRETSEDLRKHRTEHLEAGNELFTVQQELAKFQTILEGLNEEYNTAKFTRENTEAFLNSSKDEYKKVRYEVDFETAKMREMRQEMDNIALRLYYLKSAEEDIKGDIAVMKRAAEKAVEDLQRAEKEKMHQDFILDTLVNEVARLKEDIGLYEAQLVAQNDEKCAAKLTLHEAEDEIQRIILERKHLMNKWNSCLIDLTRRNEAFCALNEALSEKKEQILVLQNEIEGYKRNTRKEQDLNERMTLIFKKSEYDIVNLKKIIEDHKAKYAAMKSNYGNSVNILHQTETVLAQIIRDKKEQLAITGEYQKSIESLYKLKNELEDKMDEELRKKMTMKSLAQCLDKGIKRIRDQSRQLESQVVLLANNESNNALKLAELKSEIYEIERYFKITEEEINEKNDTINKLEVEMGRSKTFIERRQGTIDRLNKQLELLLQSRGGIEVGPLEITINHLNKNIQTVYEEISDLEQQWLRKQHEIVKLFNEKEALNEDISRLKQQSFLLVQKKIRLESYIAKENCDKRVIEKELLQIQNKMVNINNSIFKERFTKENLEKINNLAETDFVRELKEEEMEATKLQSKIDEIESKKDRYLKEIVE------------------NQWQAMMYEKKIQLIQEAQQTILSDLGQGEIKAMKIEIHRMEIRFKQLALQQEYLIQDMEKSVVKRDIITKRGEALEKIQNKVTTKGALEKTIAQIKRKTEQIKKNAIDCEEKTITYR-SQLKILVDKLKEQEEINSVQNREIINMVIHLDEISILKYSQLMELQYKQQMFKYYSEVRDKKYVRICKTSTALGREKKTQSEKMNSFIVIIDRIISEYPQTQSSLNPTRQLVQKYLE 899          
BLAST of Coiled-coil domain containing 40 vs. Planmine SMEST
Match: SMESG000044048.1 (SMESG000044048.1)

HSP 1 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 369/801 (46.07%), Postives = 554/801 (69.16%), Query Frame = 3
Query:  141 DLTELVVLDPDHPLMKRFQDALKGMLTKQLNRIXXXXXXXXXXXXXXXXXXXXXGNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKAVENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGSIEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAEXXXXXXXXXXXXXXXXTRRQIMLWEKKIQLTQETREAVDSEIGEGEMKLMRCEIHRMXXXXXXXXXXXXXXXXDMEKSVSRREVIATRGEALQKVKTKVTSKGGIEREILDLKRKIKQILKSSQDYEENIKTLKLEKDNICEDIEKRKQTIDELQH-QLDSLTLKLDEIN 2540
            ++TELVVLDPDHPLMKRFQD+L  ML KQL RI+LED+ET E+L+K + EHL  GN+L+ VQQELAKFQ+ LE L +EY       +  +      + E++    +V  E+ K+ ++R+EMD  ALRL+YLK A++DI+GDIAVM+RAAEKAVE+L + E  K+ QD ++D LV +V +LKE+IGLYEAQ+VAQ +E+ +    L EA+ EIQ I  E K L+++WNS LI L RRNEA+C + +A+ EK++QIL LQ+E+E ++++  KEQ+ NE+++L+  K   D+  +KK++   + K+  +K  Y      L +TE  L +   DK  +       +K IE  +K + ELE+++ EELR K+TM    + ++K   ++RD++R LE++V +L N  S +AL +A++KS    +E++  + E EI EKNDTI+KLE E+ R+   +ER+QGTID LNK+LE ++ + GG+E+GPLEITINHL+KNIQ   +E++DLEQQWLR+Q ++VKL+N+K  +  ++S LKQ+  +L QK+IR+E  I KE  +K  IE+ L  +QN M+ +N  IF+E+  +ENLEK N L ETDF+R LK EE+E+ +L+S++D+I ++K+R+L E+VE                   + Q M++EKKIQL QE ++ + S++G+GE+K M+ EIHRME+R++QL  QQE L+QDMEKSV +R++I  RGEAL+K++ KVT+KG +E+ I  +KRK +QI K++ D EE   T +  +  I  D  K ++ I+ +Q+ ++ ++ + LDEI+
Sbjct:   39 NITELVVLDPDHPLMKRFQDSLNAMLIKQLERIQLEDRETSEDLRKHRTEHLEAGNELFTVQQELAKFQTILEGLNEEYNTAKFTRENTEAFLNSSKDEYKKVRYEVDFETAKMREMRQEMDNIALRLYYLKSAEEDIKGDIAVMKRAAEKAVEDLQRAEKEKMHQDFILDTLVNEVARLKEDIGLYEAQLVAQNDEKCAAKLTLHEAEDEIQRIILERKHLMNKWNSCLIDLTRRNEAFCALNEALSEKKEQILVLQNEIEGYKRNTRKEQDLNERMTLIFKKSEYDIVNLKKIIEDHKAKYAAMKSNYGNSVNILHQTETVLAQIIRDKKEQLAITGEYQKSIESLYKLKNELEDKMDEELRKKMTMKSLAQCLDKGIKRIRDQSRQLESQVVLLANNESNNALKLAELKSEIYEIERYFKITEEEINEKNDTINKLEVEMGRSKTFIERRQGTIDRLNKQLELLLQSRGGIEVGPLEITINHLNKNIQTVYEEISDLEQQWLRKQHEIVKLFNEKEALNEDISRLKQQSFLLVQKKIRLESYIAKENCDKRVIEKELLQIQNKMVNINNSIFKERFTKENLEKINNLAETDFVRELKEEEMEATKLQSKIDEIESKKDRYLKEIVE------------------NQWQAMMYEKKIQLIQEAQQTILSDLGQGEIKAMKIEIHRMEIRFKQLALQQEYLIQDMEKSVVKRDIITKRGEALEKIQNKVTTKGALEKTIAQIKRKTEQIKKNAIDCEEKTITYR-SQLKILVDKLKEQEEINSVQNREIINMVIHLDEIS 820          
BLAST of Coiled-coil domain containing 40 vs. Planmine SMEST
Match: SMESG000044048.1 (SMESG000044048.1)

HSP 1 Score: 600.512 bits (1547), Expect = 0.000e+0
Identity = 369/801 (46.07%), Postives = 554/801 (69.16%), Query Frame = 3
Query:  141 DLTELVVLDPDHPLMKRFQDALKGMLTKQLNRIXXXXXXXXXXXXXXXXXXXXXGNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKYKKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKAVENLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDNLREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQILSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFMTLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVELEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVDALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQGTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQWLRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGSIEKEKREKSDIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEELESIELKSRLDDIRNEKERFLNELVEAEXXXXXXXXXXXXXXXXTRRQIMLWEKKIQLTQETREAVDSEIGEGEMKLMRCEIHRMXXXXXXXXXXXXXXXXDMEKSVSRREVIATRGEALQKVKTKVTSKGGIEREILDLKRKIKQILKSSQDYEENIKTLKLEKDNICEDIEKRKQTIDELQH-QLDSLTLKLDEIN 2540
            ++TELVVLDPDHPLMKRFQD+L  ML KQL RI+LED+ET E+L+K + EHL  GN+L+ VQQELAKFQ+ LE L +EY       +  +      + E++    +V  E+ K+ ++R+EMD  ALRL+YLK A++DI+GDIAVM+RAAEKAVE+L + E  K+ QD ++D LV +V +LKE+IGLYEAQ+VAQ +E+ +    L EA+ EIQ I  E K L+++WNS LI L RRNEA+C + +A+ EK++QIL LQ+E+E ++++  KEQ+ NE+++L+  K   D+  +KK++   + K+  +K  Y      L +TE  L +   DK  +       +K IE  +K + ELE+++ EELR K+TM    + ++K   ++RD++R LE++V +L N  S +AL +A++KS    +E++  + E EI EKNDTI+KLE E+ R+   +ER+QGTID LNK+LE ++ + GG+E+GPLEITINHL+KNIQ   +E++DLEQQWLR+Q ++VKL+N+K  +  ++S LKQ+  +L QK+IR+E  I KE  +K  IE+ L  +QN M+ +N  IF+E+  +ENLEK N L ETDF+R LK EE+E+ +L+S++D+I ++K+R+L E+VE                   + Q M++EKKIQL QE ++ + S++G+GE+K M+ EIHRME+R++QL  QQE L+QDMEKSV +R++I  RGEAL+K++ KVT+KG +E+ I  +KRK +QI K++ D EE   T +  +  I  D  K ++ I+ +Q+ ++ ++ + LDEI+
Sbjct:   36 NITELVVLDPDHPLMKRFQDSLNAMLIKQLERIQLEDRETSEDLRKHRTEHLEAGNELFTVQQELAKFQTILEGLNEEYNTAKFTRENTEAFLNSSKDEYKKVRYEVDFETAKMREMRQEMDNIALRLYYLKSAEEDIKGDIAVMKRAAEKAVEDLQRAEKEKMHQDFILDTLVNEVARLKEDIGLYEAQLVAQNDEKCAAKLTLHEAEDEIQRIILERKHLMNKWNSCLIDLTRRNEAFCALNEALSEKKEQILVLQNEIEGYKRNTRKEQDLNERMTLIFKKSEYDIVNLKKIIEDHKAKYAAMKSNYGNSVNILHQTETVLAQIIRDKKEQLAITGEYQKSIESLYKLKNELEDKMDEELRKKMTMKSLAQCLDKGIKRIRDQSRQLESQVVLLANNESNNALKLAELKSEIYEIERYFKITEEEINEKNDTINKLEVEMGRSKTFIERRQGTIDRLNKQLELLLQSRGGIEVGPLEITINHLNKNIQTVYEEISDLEQQWLRKQHEIVKLFNEKEALNEDISRLKQQSFLLVQKKIRLESYIAKENCDKRVIEKELLQIQNKMVNINNSIFKERFTKENLEKINNLAETDFVRELKEEEMEATKLQSKIDEIESKKDRYLKEIVE------------------NQWQAMMYEKKIQLIQEAQQTILSDLGQGEIKAMKIEIHRMEIRFKQLALQQEYLIQDMEKSVVKRDIITKRGEALEKIQNKVTTKGALEKTIAQIKRKTEQIKKNAIDCEEKTITYR-SQLKILVDKLKEQEEINSVQNREIINMVIHLDEIS 817          
The following BLAST results are available for this feature:
BLAST of Coiled-coil domain containing 40 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CCDC409.163e-14234.32coiled-coil domain containing 40 [Source:HGNC Symb... [more]
CCDC405.154e-12436.44coiled-coil domain containing 40 [Source:HGNC Symb... [more]
CCDC401.765e-3437.14coiled-coil domain containing 40 [Source:HGNC Symb... [more]
CCDC408.708e-1537.33coiled-coil domain containing 40 [Source:HGNC Symb... [more]
back to top
BLAST of Coiled-coil domain containing 40 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 40 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
l(2)41Ab1.797e-3024.06gene:FBgn0262123 transcript:FBtr0114030[more]
l(2)41Ab7.463e-2423.09gene:FBgn0262123 transcript:FBtr0114029[more]
back to top
BLAST of Coiled-coil domain containing 40 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ccdc408.426e-12933.64coiled-coil domain containing 40 [Source:NCBI gene... [more]
ccdc406.403e-12833.72coiled-coil domain containing 40 [Source:NCBI gene... [more]
back to top
BLAST of Coiled-coil domain containing 40 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grwd11.039e-14536.47glutamate-rich WD repeat containing 1 [Source:Xenb... [more]
grwd18.321e-14436.30glutamate-rich WD repeat containing 1 [Source:Xenb... [more]
ENSXETT00000022729.14.074e-12039.51coiled-coil domain containing 40 [Source:NCBI gene... [more]
grwd12.351e-10737.54glutamate-rich WD repeat containing 1 [Source:Xenb... [more]
ENSXETT00000022711.14.850e-9938.18coiled-coil domain containing 40 [Source:NCBI gene... [more]
back to top
BLAST of Coiled-coil domain containing 40 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ccdc403.472e-13633.94coiled-coil domain containing 40 [Source:MGI Symbo... [more]
Ccdc404.563e-13036.48coiled-coil domain containing 40 [Source:MGI Symbo... [more]
back to top
BLAST of Coiled-coil domain containing 40 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q4G0X9|CCD40_HUMAN4.401e-14134.32Coiled-coil domain-containing protein 40 OS=Homo s... [more]
sp|Q8BI79|CCD40_MOUSE1.629e-13633.94Coiled-coil domain-containing protein 40 OS=Mus mu... [more]
sp|Q56A40|CCD40_DANRE4.833e-12733.72Coiled-coil domain-containing protein 40 OS=Danio ... [more]
sp|A8IQT2|CCD40_CHLRE1.099e-1825.88Coiled-coil domain-containing protein 40 homolog O... [more]
back to top
BLAST of Coiled-coil domain containing 40 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267G6B60.000e+047.56Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F5J20.000e+047.91Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IC110.000e+047.57Uncharacterized protein OS=Macrostomum lignano OX=... [more]
K1Q3F20.000e+048.15Coiled-coil domain-containing protein 40 OS=Crasso... [more]
R7VJU30.000e+046.64Uncharacterized protein OS=Capitella teleta OX=283... [more]
back to top
BLAST of Coiled-coil domain containing 40 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc403.612e-11434.04coiled-coil domain containing 40 [Source:NCBI gene... [more]
back to top
BLAST of Coiled-coil domain containing 40 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 40 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 40 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 40 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc401.916e-7027.32coiled-coil domain containing 40 [Source:NCBI gene... [more]
back to top
BLAST of Coiled-coil domain containing 40 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008312.10.000e+097.95SMESG000008312.1[more]
SMESG000044048.10.000e+045.75SMESG000044048.1[more]
SMESG000044048.10.000e+045.75SMESG000044048.1[more]
SMESG000044048.10.000e+046.07SMESG000044048.1[more]
SMESG000044048.10.000e+046.07SMESG000044048.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032372 ID=SMED30032372|Name=Coiled-coil domain containing 40|organism=Schmidtea mediterranea sexual|type=transcript|length=2829bp
ATAAATCTTATATGATGTCATCCGGAGATCCAGATGAAAATAATCTTAAC
GAAATTTTGGGTGACGATGATCTATATGGAAATATGGAAGAAAATTTAAA
TAATTATAATAATGAAAACTTAGATGAAATGGAAGAGAGAGACTTAACTG
AATTAGTAGTTTTAGACCCAGATCATCCTCTAATGAAACGATTCCAAGAT
GCTTTAAAAGGAATGCTAACTAAACAATTGAATAGAATTGAGCTGGAAGA
TAAAGAAACGGAAGAAGAACTAAAGAAAAGAAAAGAAGAACATTTAAATC
TCGGAAATGATCTATATGGAGTTCAACAAGAATTAGCTAAGTTTCAATCC
GAACTTGAGAGATTACAAGATGAATATTATGGAATATACCAAAAGCATCA
AGAAGTGGATCAAGAACAACTACAGGTTCGAGGCGAATTTCAAAACAAGT
ATAAAAAGGTCACCGAAGAAAGTATAAAATTAGAACAACTACGAAAAGAA
ATGGATAAAGCTGCACTGAGATTGTTTTATTTAAAAATAGCAAAAAAAGA
TATTCGAGGAGACATAGCTGTTATGCGTAGGGCAGCTGAAAAAGCTGTAG
AAAATTTATATAAAGAAGAAGATGGGAAGCTGCAGCAAGATTTGCTAGTC
GACAGATTAGTAGAACAAGTTGATAAATTAAAAGAAGAAATAGGTCTATA
TGAAGCTCAAATCGTAGCACAAGCTGAAGAAAGAAGATCTGTTGTTGACA
ATCTTCGAGAAGCGCAATCAGAAATTCAAGGAATAAAGCAAGAAGAAAAG
AAATTAATTAGTCAATGGAATTCGACTTTAATTGGTCTTCAAAGACGAAA
TGAAGCTTATTGTGTGATTACCGATGCTGTGAAAGAAAAACGGGATCAAA
TTTTATCTCTTCAAAGTGAATTGGAAAGTCACCAGAAGTCAATGGCTAAA
GAACAAGAAACAAATGAAAAACTGTCTTTGTTGCTCAACAAAAAGCACGG
AGATTTAGCAACAATAAAGAAACTATTAACAATTACTCAAAATAAATTCA
TGACTTTGAAAATAGAATATTCAACGTATACTCGAACATTACAGGAGACG
GAAGCCAACCTTTTTCGAACCAATGCTGATAAAAATATTCGTCAAATAGA
AGTTGATAATCTGAGAAAAGATATCGAAAAAGAATTCAAAGCTCGCGTGG
AATTGGAAGAGCAAATTGTTGAAGAATTACGAAATAAACTTACCATGAAT
AAAGCAAAAGAATACGTTAACAAACTCACTGTGCAAATGAGAGACAAAAC
TCGACATTTGGAAACCGAAGTTGCCATTCTCGAAAATAAATTAAGCGTTG
ATGCGTTGGCCATAGCAAAAGTGAAATCTTACACAAAAGGACTGGAAAAA
CACATTATTCTGATGGAAAATGAAATACAGGAGAAAAATGACACTATTTC
TAAATTGGAATCGGAAATCAGCAGGAACAACATTAATGTGGAAAGGAAAC
AAGGAACGATAGATTTACTTAATAAAAAACTGGAGCAAATGATTGCAAAT
GCGGGAGGCGTTGAATTAGGGCCTTTAGAAATTACAATTAATCATTTACA
TAAAAATATCCAGGCCCAGGAGGATGAAGTAAATGACCTTGAACAACAAT
GGCTGAGACAGCAACAAGACTTAGTGAAGCTGTATAATCAGAAAAATGAA
ATTATTAATAATGTCAGTTTATTAAAACAAAAATTAACAATTCTTTCTCA
GAAGCAAATTCGAATAGAAGGTTCAATTGAAAAGGAGAAACGTGAGAAAT
CCGACATTGAACGTCATTTGAGACATTTACAAAACGACATGATTAAATTA
AATCGGTTGATTTTTCAGGAAAAAGATTATCAGGAAAATTTGGAAAAAGA
AAACATTTTGACTGAAACTGATTTTATTCGTTCTCTAAAATGTGAAGAAC
TTGAAAGCATAGAACTAAAAAGCAGATTAGATGACATTCGGAATGAAAAA
GAGCGATTTTTGAATGAATTAGTTGAAGCAGAGTTTATATAGATATATAA
ATATTACTTTTTCATTTACATATATATTATTACTAGACGACAGATAATGC
TATGGGAAAAGAAAATTCAATTGACTCAAGAAACAAGAGAAGCTGTTGAT
TCTGAAATTGGTGAAGGTGAAATGAAACTAATGAGATGTGAGATTCATAG
AATGGAGGTTCGTTATCAGCAATTATTAAGGCAGCAAGAACTGTTGGTAC
AAGATATGGAAAAGTCAGTATCTAGGCGAGAAGTTATAGCAACAAGAGGG
GAAGCTCTACAAAAAGTGAAAACCAAAGTTACGAGTAAAGGAGGAATTGA
AAGAGAGATTCTAGATCTCAAAAGAAAAATTAAACAGATATTGAAAAGTT
CTCAAGATTATGAAGAAAACATCAAAACTTTGAAGTTAGAGAAAGACAAT
ATTTGCGAAGACATTGAGAAACGAAAACAAACCATAGATGAATTGCAGCA
CCAATTAGACAGTTTAACCTTGAAATTAGATGAAATAAACAATAATCGCA
TTGGGCATATTATTTCCCTGCAACAAAAGCAGCAAATTGCGAAATACTAT
CAGCAGTTCAAGGATAAAAAGTATATGAGACTCTGTAAAACACCAACAAC
AGGAGAAAAGGAAAACGACTCCTTCGACAAGAAGATTTCTACATTGAATA
CAATAATTGATAGATTGTGCCGAGAATATCCCCAGGTGATCAGAGATTTG
GGACCCATCAGAAATATGGTTCAAAAGAAGTTAGAAATCACAGATTAGAA
GATTTAATAAAAAAGGATTTTTTTTTGAG
back to top

protein sequence of SMED30032372-orf-1

>SMED30032372-orf-1 ID=SMED30032372-orf-1|Name=SMED30032372-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=234bp
MLWEKKIQLTQETREAVDSEIGEGEMKLMRCEIHRMEVRYQQLLRQQELL
VQDMEKSVSRREVIATRGEALQKVKTKVTSKGGIEREILDLKRKIKQILK
SSQDYEENIKTLKLEKDNICEDIEKRKQTIDELQHQLDSLTLKLDEINNN
RIGHIISLQQKQQIAKYYQQFKDKKYMRLCKTPTTGEKENDSFDKKISTL
NTIIDRLCREYPQVIRDLGPIRNMVQKKLEITD*
back to top

protein sequence of SMED30032372-orf-2

>SMED30032372-orf-2 ID=SMED30032372-orf-2|Name=SMED30032372-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=680bp
KSYMMSSGDPDENNLNEILGDDDLYGNMEENLNNYNNENLDEMEERDLTE
LVVLDPDHPLMKRFQDALKGMLTKQLNRIELEDKETEEELKKRKEEHLNL
GNDLYGVQQELAKFQSELERLQDEYYGIYQKHQEVDQEQLQVRGEFQNKY
KKVTEESIKLEQLRKEMDKAALRLFYLKIAKKDIRGDIAVMRRAAEKAVE
NLYKEEDGKLQQDLLVDRLVEQVDKLKEEIGLYEAQIVAQAEERRSVVDN
LREAQSEIQGIKQEEKKLISQWNSTLIGLQRRNEAYCVITDAVKEKRDQI
LSLQSELESHQKSMAKEQETNEKLSLLLNKKHGDLATIKKLLTITQNKFM
TLKIEYSTYTRTLQETEANLFRTNADKNIRQIEVDNLRKDIEKEFKARVE
LEEQIVEELRNKLTMNKAKEYVNKLTVQMRDKTRHLETEVAILENKLSVD
ALAIAKVKSYTKGLEKHIILMENEIQEKNDTISKLESEISRNNINVERKQ
GTIDLLNKKLEQMIANAGGVELGPLEITINHLHKNIQAQEDEVNDLEQQW
LRQQQDLVKLYNQKNEIINNVSLLKQKLTILSQKQIRIEGSIEKEKREKS
DIERHLRHLQNDMIKLNRLIFQEKDYQENLEKENILTETDFIRSLKCEEL
ESIELKSRLDDIRNEKERFLNELVEAEFI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005737cytoplasm
GO:0005929cilium
GO:0005930axoneme
GO:0042995cell projection
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR037386CCDC40
IPR013956E3_ubiquit_lig_Bre1
Vocabulary: biological process
TermDefinition
GO:0001947heart looping
GO:0003341cilium movement
GO:0003351epithelial cilium movement
GO:0003356regulation of cilium beat frequency
GO:0030317flagellated sperm motility
GO:0030324lung development
GO:0035082axoneme assembly
GO:0035469determination of pancreatic left/right asymmetry
GO:0036159inner dynein arm assembly
GO:0044458motile cilium assembly
GO:0060287epithelial cilium movement involved in determination of left/right asymmetry
GO:0070286axonemal dynein complex assembly
GO:0071907determination of digestive tract left/right asymmetry
GO:0071910determination of liver left/right asymmetry
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 21..41
NoneNo IPR availableCOILSCoilCoilcoord: 380..408
NoneNo IPR availableCOILSCoilCoilcoord: 72..92
NoneNo IPR availableCOILSCoilCoilcoord: 289..316
NoneNo IPR availableCOILSCoilCoilcoord: 212..267
NoneNo IPR availableCOILSCoilCoilcoord: 588..615
NoneNo IPR availableCOILSCoilCoilcoord: 525..552
NoneNo IPR availableCOILSCoilCoilcoord: 100..120
NoneNo IPR availableCOILSCoilCoilcoord: 464..512
NoneNo IPR availableCOILSCoilCoilcoord: 149..169
NoneNo IPR availableCOILSCoilCoilcoord: 641..675
NoneNo IPR availablePFAMPF08647BRE1coord: 549..645
e-value: 1.5E-12
score: 47.4
IPR037386Coiled-coil domain-containing protein 40PANTHERPTHR16275COILED-COIL DOMAIN-CONTAINING PROTEIN 40coord: 26..673