Beta-1,3-glucosyltransferase

Overview
NameBeta-1,3-glucosyltransferase
Smed IDSMED30032370
Length (bp)1633
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Beta-1,3-glucosyltransferase (SMED30032370) t-SNE clustered cells

Violin plots show distribution of expression levels for Beta-1,3-glucosyltransferase (SMED30032370) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Beta-1,3-glucosyltransferase (SMED30032370) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Beta-1,3-glucosyltransferase (SMED30032370) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032370

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30032370SMESG000009947.1 dd_Smed_v6_6366_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
eyeSMED30032370SMESG000009947.1 Contig40970newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30032370SMESG000009947.1 Contig40970newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
eyeSMED30032370SMESG000009947.1 Contig40970uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30032370SMESG000009947.1 Contig40970uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Human
Match: B3GLCT (beta 3-glucosyltransferase [Source:HGNC Symbol;Acc:HGNC:20207])

HSP 1 Score: 227.254 bits (578), Expect = 2.468e-67
Identity = 156/427 (36.53%), Postives = 220/427 (51.52%), Query Frame = 1
Query:  169 YHNTRFSLFKRHLVSQLP--TNQPPKLIYSENDTTSVLFHLILP-----AIRFYRNEIIKFKWIIFAQEETRLELKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFA---KPHSLLYPHREVGFILSINLCKLILEELDREFLAPEKYDTHIDPQYEMVKFIREKLISDFQMSNNSEFCLKSEPDEYCAVWITQFSYLPNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRR-ISKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLNHSN 1416
            +H  R    K+ ++ Q    T + P ++             ILP     ++ + RN      WI F +EETR+++ +L   L   D  +   LG AL D + +IIHH+A    P    YP    G+ LSI L   + + L  E L   K D  ID ++E+  +I +K      ++   EFC  ++ D YCA   T  S+LP C   + + +  VAVKTCKKF   RI  +K TW      I Y+++  +  +PTV  G+ NT+ GHC K  +IL       + ++  +LVIVDDDTL+S+ RL+ LL CY   E + LGERY Y      GY Y+TGG G+V S   VRR ++    C SND PDDM LGM        + HS LFHQARP DY    +  +  ISFHK W   P+++Y  +L  S+
Sbjct:   69 FHAKRAEQLKKSILKQAADLTQELPSVLLLHQLAKQEGAWTILPLLPHFSVTYSRNS----SWIFFCEEETRIQIPKLLETLRRYDPSKEWFLGKALHDEEATIIHHYAFSENPTVFKYPDFAAGWALSIPLVNKLTKRLKSESL---KSDFTIDLKHEIALYIWDKG-GGPPLTPVPEFC-TNDVDFYCAT--TFHSFLPLCRKPVKKKDIFVAVKTCKKFHGDRIPIVKQTWESQASLIEYYSDYTENSIPTVDLGIPNTDRGHCGKTFAILERFLNRSQ-DKTAWLVIVDDDTLISISRLQHLLSCYDSGEPVFLGERYGYGL-GTGGYSYITGGGGMVFSREAVRRLLASKCRCYSNDAPDDMVLGMCFSGLGIPVTHSPLFHQARPVDYPKDYLSHQVPISFHKHWNIDPVKVYFTWLAPSD 482          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Celegans
Match: ZC250.2 (Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 [Source:UniProtKB/TrEMBL;Acc:O01878])

HSP 1 Score: 190.274 bits (482), Expect = 2.842e-54
Identity = 123/363 (33.88%), Postives = 194/363 (53.44%), Query Frame = 1
Query:  334 WIIFAQEETRLELKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFA--KPHSLLYPHREVGFILSINLCKLILEELDREFLAPEKYDT-HIDPQYEMVKFIREKLISDFQMSNNSEFCLKSEPDEYCAVWITQFSYLPNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAY-MSWFG-SGYDYLTGGSGIVLSMSVVRR-ISKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYL 1404
            WII A++ + + +  L               G+AL+D D +IIHHF    P +  YP    GFILS ++ ++I     R+    +++    ID +YE  +F+ +    + ++ ++ ++    +  + C V  +     P  ++ I  SE  V VKT +    +R+  +K+TW  DV  I Y ++  D  +PT++ GV NT+ GHC+K   I          N  K+LV+ DDDTL++  RL+Q+L  Y   + I +GERY Y  S  G SGYDY TGGSG++ + S V   +++   C +N  PDDMT+G+    A   ++H    HQARP DYA + I  +  ISFHKF +  P+ +Y++YL
Sbjct:   87 WIIIAEDTSEINISNLPKFFESEPSSDMVFSGFALQDRDPTIIHHFGMNAPENFQYPLFSAGFILSKSVVEII-----RKVDINDRWSGFAIDAKYEFAQFLHK--WENLRLHHHPDYFCCGDTIDSCIVKCS--IPFPKTSNSISDSEVHVMVKTFEGHHVNRLEVLKNTWASDVSRIEYCSDKEDPAIPTINLGVDNTDRGHCAKTWEIFRRFL-GSSGNGAKWLVVADDDTLMNFKRLKQMLELYDSGDKIIIGERYGYGFSLNGDSGYDYPTGGSGMIFTRSAVESLLAQCPSCIANTDPDDMTIGICALTAGIPIVHESRLHQARPLDYAPEYI--KYPISFHKFTDIDPISVYYEYL 437          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Celegans
Match: C02H6.1 (Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 [Source:UniProtKB/TrEMBL;Acc:O17053])

HSP 1 Score: 53.5286 bits (127), Expect = 1.795e-7
Identity = 50/187 (26.74%), Postives = 82/187 (43.85%), Query Frame = 1
Query:  763 QSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAE--VADRKVPTVSTGVLNTETGHCSKLKSIL-------TMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRISKLTFCNSN----DWPDDMTLGMWLDDANQSLLHS 1284
              +    V+T KK+F  R+ ++ STW P  +N  +F +  + D K+P  ST   N E  +    +  L       T I++D  W      +  DDD    +  L++ L      + + LG R   M  F  G  Y +GG+G +LS + VR   +  + +      DW +D  +   L  A+  +L S
Sbjct:   84 SGQLFCFVETSKKYFNDRVPSMASTWLPRCDNGRFFLKTPLVDEKIP-FSTVYRNLEDSYYDLFRKTLLSFYYSYTYISKDFDW-----YLKADDDNYFMIDHLKEYLDTLDASKPLFLGYR---MKPFLEG-GYNSGGAGYLLSNAAVRIFVEHLYHDEKRCPYDWAEDRGIARCL--ASMGILPS 258          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Celegans
Match: C16D9.6 (Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 [Source:UniProtKB/TrEMBL;Acc:Q22900])

HSP 1 Score: 51.2174 bits (121), Expect = 8.864e-7
Identity = 59/237 (24.89%), Postives = 96/237 (40.51%), Query Frame = 1
Query:  739 PNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFA--EVADRKVP--TVSTGVLNTETGHCSKLK----SILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRISKLTFCNSNDWPDDM-----------TLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELY 1392
            P    +  + +    V+T   +  +R + I  TW    ++   F      D ++P  TV  G+ +       K +     I T I+ +  W      +  DDDT + V  LR  L     DE   LG  Y    +  +GY+   GG+G +LS + ++  S+  + N+   PDD+             GM+ +D   SL  +  F+   P D   Q   T+  I + KF E K  E +
Sbjct:   87 PAAQRLPKKGKLFCWVQTSTIYHDTRSLAINETWIHRCDHGQLFTSERFNDTRIPYSTVFKGIPDDYYNLFFKSRYAFHHIYTNISSEFDW-----YLKADDDTFVIVENLRSFLSTLNPDEPHYLG--YVLKPYLKNGYN--AGGAGYILSRAALKIFSEQLYSNATLCPDDIYEDVGIARCLANAGMYPEDTRNSLGQNR-FNTFSPSDTFHQ---TKAGIDWVKFKENKGYEAF 310          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Fly
Match: CG9109 (gene:FBgn0031765 transcript:FBtr0079224)

HSP 1 Score: 213.001 bits (541), Expect = 7.320e-62
Identity = 131/398 (32.91%), Postives = 198/398 (49.75%), Query Frame = 1
Query:  325 KFKWIIFAQEETRLE-LKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFAK---PHSLLYPHREVGFILSINLCKLILEELDREFLAPEKY------DTHIDPQYEMVKFIREKLISDFQMS----------NNSEFC--------------LKSEPDEYCAVWITQFSYLPNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAED-PKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRISKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLNHS 1413
            + +WII+ Q  TR+  L+ L   L   +  +    G+AL D + +IIHHF+    P    YP    G + +  L + +      + +AP         D  ID  +E+ +FI + +  D  +S          + S  C              L ++P+E   +   +     N       S    A+KTC KF + RI  I+ TW  D  N  Y+++VAD  +P + TG+ N +TGHC+K  +IL +  +D  K  ++++L++VDDDTLLSVPR+  LL  +   E + LG+RY Y      G++Y TGG+GIVLS+ +VR I +   C S   PDDM LG  L       +H    HQARP+DYA + +     ++FHKFW T P   Y ++L  S
Sbjct:  101 RTEWIIWCQHNTRVSSLRGLLEQLRRQNPRELAFYGHALYDAEATIIHHFSNYKDPQRFPYPMLSAGVVFTGALLRRL-----ADLVAPSGQNITVHSDFSIDASHELARFIFDNVSPDPHISTPISGGILLKSASYICSTPTSVPNRKLPCLLHAQPEEPLTLGQRR-----NGCEHTTGSHIYFAIKTCAKFHKERIPIIERTWAADARNRRYYSDVADVGIPAIGTGIPNVQTGHCAKTMAILQLSLKDIGKQLDIRWLMLVDDDTLLSVPRVSALLCRHNATELVYLGQRYGYRLHAPDGFNYHTGGAGIVLSLPLVRLIVQRCSCPSASAPDDMILGYCLQALGVPAIHVAGMHQARPQDYAGELLQLHAPLTFHKFWNTDPEHTYRRWLGGS 488          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Fly
Match: CG9109 (gene:FBgn0031765 transcript:FBtr0343131)

HSP 1 Score: 204.912 bits (520), Expect = 1.073e-58
Identity = 131/409 (32.03%), Postives = 198/409 (48.41%), Query Frame = 1
Query:  325 KFKWIIFAQEETRLE-LKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFAK---PHSLLYPHREVGFILSINLCKLILEELDREFLAPEKY------DTHIDPQYEMVKFIREKLISDFQMS----------NNSEFC--------------LKSEPDEYCAVWITQFSYLPNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAED-PKWNEVKFLVIVDDDTLLS-----------VPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRISKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLNHS 1413
            + +WII+ Q  TR+  L+ L   L   +  +    G+AL D + +IIHHF+    P    YP    G + +  L + +      + +AP         D  ID  +E+ +FI + +  D  +S          + S  C              L ++P+E   +   +     N       S    A+KTC KF + RI  I+ TW  D  N  Y+++VAD  +P + TG+ N +TGHC+K  +IL +  +D  K  ++++L++VDDDTLLS           VPR+  LL  +   E + LG+RY Y      G++Y TGG+GIVLS+ +VR I +   C S   PDDM LG  L       +H    HQARP+DYA + +     ++FHKFW T P   Y ++L  S
Sbjct:  101 RTEWIIWCQHNTRVSSLRGLLEQLRRQNPRELAFYGHALYDAEATIIHHFSNYKDPQRFPYPMLSAGVVFTGALLRRL-----ADLVAPSGQNITVHSDFSIDASHELARFIFDNVSPDPHISTPISGGILLKSASYICSTPTSVPNRKLPCLLHAQPEEPLTLGQRR-----NGCEHTTGSHIYFAIKTCAKFHKERIPIIERTWAADARNRRYYSDVADVGIPAIGTGIPNVQTGHCAKTMAILQLSLKDIGKQLDIRWLMLVDDDTLLSLHLIHTHLPTSVPRVSALLCRHNATELVYLGQRYGYRLHAPDGFNYHTGGAGIVLSLPLVRLIVQRCSCPSASAPDDMILGYCLQALGVPAIHVAGMHQARPQDYAGELLQLHAPLTFHKFWNTDPEHTYRRWLGGS 499          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Fly
Match: CG34056 (gene:FBgn0054056 transcript:FBtr0100833)

HSP 1 Score: 67.0106 bits (162), Expect = 1.169e-11
Identity = 47/178 (26.40%), Postives = 81/178 (45.51%), Query Frame = 1
Query:  760 DQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMI----AEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRISKLTFCNS-----NDWPDDMTLGMWLDDAN 1266
            +++  L  V T  K  +SR+  +K TW      +++ +   DR++  +  GV         K++  L  +     ED  W      +  DDDT + +  LR LLY Y  +  +  G R+   + F  G  Y++GG+G V+S   +RR++   F NS     N+  +D  +G  L +  
Sbjct:   59 NETRVLCMVLTLPKNHQSRVRRVKGTWGRRCNKLIFISSQEDRELGVIDVGVPEDRNNLYLKMRKALEYVYRNHGEDYDW-----FLKADDDTFVIMENLRFLLYPYDPEAALYFGHRFR--TTFPQG--YMSGGAGYVMSRDALRRLNLFAFNNSQFCPINNNSEDRQIGFCLQNVG 227          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Fly
Match: CG2975 (gene:FBgn0031468 transcript:FBtr0077619)

HSP 1 Score: 61.2326 bits (147), Expect = 8.839e-10
Identity = 39/158 (24.68%), Postives = 75/158 (47.47%), Query Frame = 1
Query:  745 CASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRISKLTFCNSN 1218
             A + +++  L  V T  K   +R + IK TW      +++ +  AD+++ +V+  V    +    K ++ L  + +   + +  + +  DDDT   +  LR  L+ +   E +  G ++      G    Y++GG+G VLS   + R+ KL F NS+
Sbjct:   77 AARLFNETRVLCMVLTSPKTHHTRAIHIKRTWGRRCNKLIFMSTKADKELGSVALNVREGYSNLWPKTRAALQYVYKH-HFQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFGNKFRQHVKEG----YMSGGAGYVLSKMALHRLIKLGFSNSS 229          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Fly
Match: tgy (gene:FBgn0030984 transcript:FBtr0290275)

HSP 1 Score: 56.9954 bits (136), Expect = 2.309e-8
Identity = 45/165 (27.27%), Postives = 71/165 (43.03%), Query Frame = 1
Query:  775 LVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVR----RISKLTFC-NSNDWPDDMTLGMWL 1254
            L  V T  K+ ++R + +  TW      I +     D ++PTV     +       K K     I E  + +E  + +  DDDT L +  LR +LY Y  +  I  G  Y  +        Y++GGSG VLS   +R     ++  T C   +D  +D+ +G  L
Sbjct:  100 LCWVLTTPKYHKTRAIHVLRTWGKRCNKIYFMTSEPDDELPTVVLTKPDRYEMLWGKTKEAFVHIHEQMR-HEADWFIKADDDTYLFLENLRYMLYPYSPETPIYFGFNYKMVGTHQKNESYMSGGSGYVLSREALRIFAEGVNDTTKCRQEDDHAEDVEMGKCL 263          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Zebrafish
Match: b3glctb (beta 3-glucosyltransferase b [Source:ZFIN;Acc:ZDB-GENE-091204-128])

HSP 1 Score: 257.684 bits (657), Expect = 2.204e-79
Identity = 156/402 (38.81%), Postives = 221/402 (54.98%), Query Frame = 1
Query:  286 ILPAI-RFYRNEIIKFKWIIFAQEETRLELKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFA---KPHSLLYPHREVGFILSINLCKLILEELDREFLAPEKYDTHIDPQYEMVKFIREKLISDFQMSNNSEFCLK---SEPDEYCAVWITQFSYLPNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRI-SKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLNHSNSHTQKYQPHSESDYHDE 1467
            ILPA+ R          WI+F QEET + L  L  +LS     +   LG +L D + +IIHH+A    P+S  YP    G+ +S  L K   E ++ E   P K D  ID Q+E+  +I E+       + N EFC +   S   + CA  +   +YL  C   + + +  VAVKTC++F R R+  +K TW  D  ++ Y+++V D  +PTV  GV NTE GHC K  +IL   A      +  +L+IVDDDTL+S+PRLR+LL CY   E +++GERYAY      GY Y+TGG G+V S   V+ I +    C S+D PDDM LGM L      + HS LFHQARP+DY  + +  +  ISFHK W  KP+ +Y ++L+  +      +P S +D  +E
Sbjct:   77 ILPALPRLALQYCQTSLWIMFLQEETIVNLHNLLQVLSRFSPGKEWFLGRSLHDDEPTIIHHYAFSEDPYSFAYPDFMAGWAISCPLAKRTAERVNYE---PPKSDFTIDLQHEIALYIWEEGRGPTLTAVN-EFCSELHGSSSAKCCATAVN--TYLSACGKPVLKEDVFVAVKTCQRFHRDRVPIVKQTWEKDAASLEYYSDVTDSIIPTVHLGVPNTERGHCEKTFAILRRFASGAV-TQAPWLLIVDDDTLISLPRLRRLLSCYDPTEAVSVGERYAY-GLSRDGYSYITGGGGMVFSRVAVQNILAGGCSCRSSDAPDDMVLGMCLTTLGLPVTHSPLFHQARPDDYVKELLARQSPISFHKHWNIKPVAVYQRWLSEPDQ-----RPQSHTDTREE 465          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Zebrafish
Match: b3glctb (beta 3-glucosyltransferase b [Source:ZFIN;Acc:ZDB-GENE-091204-128])

HSP 1 Score: 257.299 bits (656), Expect = 2.530e-79
Identity = 156/402 (38.81%), Postives = 221/402 (54.98%), Query Frame = 1
Query:  286 ILPAI-RFYRNEIIKFKWIIFAQEETRLELKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFA---KPHSLLYPHREVGFILSINLCKLILEELDREFLAPEKYDTHIDPQYEMVKFIREKLISDFQMSNNSEFCLK---SEPDEYCAVWITQFSYLPNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRI-SKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLNHSNSHTQKYQPHSESDYHDE 1467
            ILPA+ R          WI+F QEET + L  L  +LS     +   LG +L D + +IIHH+A    P+S  YP    G+ +S  L K   E ++ E   P K D  ID Q+E+  +I E+       + N EFC +   S   + CA  +   +YL  C   + + +  VAVKTC++F R R+  +K TW  D  ++ Y+++V D  +PTV  GV NTE GHC K  +IL   A      +  +L+IVDDDTL+S+PRLR+LL CY   E +++GERYAY      GY Y+TGG G+V S   V+ I +    C S+D PDDM LGM L      + HS LFHQARP+DY  + +  +  ISFHK W  KP+ +Y ++L+  +      +P S +D  +E
Sbjct:   77 ILPALPRLALQYCQTSLWIMFLQEETIVNLHNLLQVLSRFSPGKEWFLGRSLHDDEPTIIHHYAFSEDPYSFAYPDFMAGWAISCPLAKRTAERVNYE---PPKSDFTIDLQHEIALYIWEEGRGPTLTAVN-EFCSELHGSSSAKCCATAVN--TYLSACGKPVLKEDVFVAVKTCQRFHRDRVPIVKQTWEKDAASLEYYSDVTDSIIPTVHLGVPNTERGHCEKTFAILRRFASGAV-TQAPWLLIVDDDTLISLPRLRRLLSCYDPTEAVSVGERYAY-GLSRDGYSYITGGGGMVFSRVAVQNILAGGCSCRSSDAPDDMVLGMCLTTLGLPVTHSPLFHQARPDDYVKELLARQSPISFHKHWNIKPVAVYQRWLSEPDQ-----RPQSHTDTREE 465          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Zebrafish
Match: b3glctb (beta 3-glucosyltransferase b [Source:ZFIN;Acc:ZDB-GENE-091204-128])

HSP 1 Score: 255.373 bits (651), Expect = 1.792e-78
Identity = 155/402 (38.56%), Postives = 220/402 (54.73%), Query Frame = 1
Query:  286 ILPAI-RFYRNEIIKFKWIIFAQEETRLELKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFA---KPHSLLYPHREVGFILSINLCKLILEELDREFLAPEKYDTHIDPQYEMVKFIREKLISDFQMSNNSEFCLK---SEPDEYCAVWITQFSYLPNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRI-SKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLNHSNSHTQKYQPHSESDYHDE 1467
            ILPA+ R          WI+F QEET + L  L  +LS     +   LG +L D + +IIHH+A    P+S  YP    G+ +S  L K   E ++ E   P K D  ID Q+E+  +I E+       + N EFC +   S   + CA  +   +YL  C   + + +  VAVKTC++F R R+  +K TW  D  ++ Y+++V D  +PTV  GV NTE GHC K  +IL   A      +  +L+IVDDDTL+S+PRLR+LL CY   E +++GERY Y      GY Y+TGG G+V S   V+ I +    C S+D PDDM LGM L      + HS LFHQARP+DY  + +  +  ISFHK W  KP+ +Y ++L+  +      +PH  +D  +E
Sbjct:   78 ILPALPRLALQYCQTSLWIMFLQEETIVNLHNLLQVLSRFSPGKEWFLGRSLHDDEPTIIHHYAFSEDPYSFAYPDFMAGWAISCPLAKRTAERVNYE---PPKSDFTIDLQHEIALYIWEEGRGPTLTAVN-EFCSELHGSSSAKCCATAVN--TYLSACGKPVLKEDVFVAVKTCQRFHRDRVPIVKQTWEKDAASLEYYSDVTDSIIPTVHLGVPNTERGHCEKTFAILRRFASGAV-TQAPWLLIVDDDTLISLPRLRRLLSCYDPTEAVSVGERYGY-GLSRDGYSYITGGGGMVFSRVAVQNILAGGCSCRSSDAPDDMVLGMCLTTLGLPVTHSPLFHQARPDDYVKELLARQSPISFHKHWNIKPVAVYQRWLSEPDQ-----RPHWLTDTREE 466          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Zebrafish
Match: b3glctb (beta 3-glucosyltransferase b [Source:ZFIN;Acc:ZDB-GENE-091204-128])

HSP 1 Score: 254.988 bits (650), Expect = 4.133e-78
Identity = 155/402 (38.56%), Postives = 220/402 (54.73%), Query Frame = 1
Query:  286 ILPAI-RFYRNEIIKFKWIIFAQEETRLELKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFA---KPHSLLYPHREVGFILSINLCKLILEELDREFLAPEKYDTHIDPQYEMVKFIREKLISDFQMSNNSEFCLK---SEPDEYCAVWITQFSYLPNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRI-SKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLNHSNSHTQKYQPHSESDYHDE 1467
            ILPA+ R          WI+F QEET + L  L  +LS     +   LG +L D + +IIHH+A    P+S  YP    G+ +S  L K   E ++ E   P K D  ID Q+E+  +I E+       + N EFC +   S   + CA  +   +YL  C   + + +  VAVKTC++F R R+  +K TW  D  ++ Y+++V D  +PTV  GV NTE GHC K  +IL   A      +  +L+IVDDDTL+S+PRLR+LL CY   E +++GERY Y      GY Y+TGG G+V S   V+ I +    C S+D PDDM LGM L      + HS LFHQARP+DY  + +  +  ISFHK W  KP+ +Y ++L+  +      +PH  +D  +E
Sbjct:  104 ILPALPRLALQYCQTSLWIMFLQEETIVNLHNLLQVLSRFSPGKEWFLGRSLHDDEPTIIHHYAFSEDPYSFAYPDFMAGWAISCPLAKRTAERVNYE---PPKSDFTIDLQHEIALYIWEEGRGPTLTAVN-EFCSELHGSSSAKCCATAVN--TYLSACGKPVLKEDVFVAVKTCQRFHRDRVPIVKQTWEKDAASLEYYSDVTDSIIPTVHLGVPNTERGHCEKTFAILRRFASGAV-TQAPWLLIVDDDTLISLPRLRRLLSCYDPTEAVSVGERYGY-GLSRDGYSYITGGGGMVFSRVAVQNILAGGCSCRSSDAPDDMVLGMCLTTLGLPVTHSPLFHQARPDDYVKELLARQSPISFHKHWNIKPVAVYQRWLSEPDQ-----RPHWLTDTREE 492          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Zebrafish
Match: b3glcta (beta 3-glucosyltransferase a [Source:ZFIN;Acc:ZDB-GENE-110411-147])

HSP 1 Score: 230.72 bits (587), Expect = 8.032e-69
Identity = 159/439 (36.22%), Postives = 242/439 (55.13%), Query Frame = 1
Query:  169 YHNTRFSLFKRHLVSQLPTNQ--PPKLIY----SENDTT-SVLFHLILPAIRFYRNEIIKFKWIIFAQEETRLELKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFA---KPHSLLYPHREVGFILSINLCKLILEELDREFLAPEKYDTHIDPQYEMVKFIREKLISDFQMSNNSEFCLKSEPD---EYCAVWITQFSYLPNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILT--MIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSM-SVVRRISKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLNHSNSHTQKYQ 1437
            +H  +    ++ L+ Q  T Q  PP ++     S+N+   S+L  L   + +F +N      WI+F +E+TR++L++L+ +L + D  +   LG  L D + +IIHH+A    P +  YP    G+ LSI L   +  +++ E   P K D  ID ++E+  +I E      +++   E C  +E +   + CA  ++  S+ P C   +      VAVKTCKKF   R+  +K TW      + Y+++ AD  +PT++ GV NTE GHC K  +IL   + +  P+     +L+IVDDDTL+S+PRL+ LL CY   E + LGERY Y      GY Y+TGG G++ S  +VV+ +S    C SND PDDM LGM L+     + HS LFHQARPEDYA   +  +  ISFHK W   P+ +++K+L +   HT+  Q
Sbjct:   66 FHVRQAEKLRKDLLLQTQTLQESPPVILLLHTLSDNEGDWSILPLLPRLSSQFGKNS----SWIMFLEEDTRVKLQKLHEVLKKFDRRKEWFLGKPLHDEESTIIHHYAFSENPTAFEYPDFSAGWALSIPLINRLASKIEEE---PLKSDFTIDLKHEVALYIWEDGKGP-RLTGVPELCTLAEHNKRAQSCATTVS--SHSPLCGEPVKIENIFVAVKTCKKFHSDRVPVVKKTWGKQASLLEYYSDYADPSIPTINLGVPNTERGHCGKTFAILRRFLSSHVPR---TDWLLIVDDDTLISLPRLQALLSCYESSEPLCLGERYGYGL-GQGGYSYITGGGGMLFSREAVVQLLSSGCNCYSNDAPDDMVLGMCLNSLRVPVTHSPLFHQARPEDYARDFLSHQTPISFHKHWNIDPIAVFNKWLKNEK-HTEGLQ 489          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Xenopus
Match: fam131a (family with sequence similarity 131 member A [Source:Xenbase;Acc:XB-GENE-939986])

HSP 1 Score: 251.521 bits (641), Expect = 4.905e-77
Identity = 152/431 (35.27%), Postives = 229/431 (53.13%), Query Frame = 1
Query:  169 YHNTRFSLFKRHLVSQLP--TNQPPKLIYSENDTTSVLFHLILPAIRFYRNEIIK-FKWIIFAQEETRLELKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFA---KPHSLLYPHREVGFILSINLCKLILEELDREFLAPEKYDTHIDPQYEMVKFIREKLISDFQMSNNSEFCLKSEPDEYCAVWITQF-SYLPNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRI-SKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLNHSNSHTQKYQ 1437
            +H  R    K +++ Q    + + PK++  +    S     I PAI ++ +   +   WI F +EET + L +L   L + +  +   LG AL D + +IIHH+A    P    YP    G+ LS+ L + + + L R+   P   D  ID ++E+  +I +KL    ++++  +FC +       A   T F S LP C S + + +  VA+KTC+KF + R+  +K TW     +  Y+++ AD  +PT    + N E GHC K  +IL    E      + +L+IVDDDTL+S+PRL++LL CY   + + LGERY Y    G GY+Y+TGG G+V S   VRR+ +    C SND PDDM LGM       ++ HS LFHQARP DYA   +  +  ISFHK W   P+++Y+K+L       Q  Q
Sbjct:   28 FHKKRAEDLKENILKQAAVISKKLPKVLLIDELEPSESAWTIFPAIPYFSDTYGRNSSWIFFCEEETTISLPKLLMTLQKFEKSKNWFLGRALHDEESTIIHHYAFTENPSVFKYPDFAAGWALSMPLVRRLSDVLLRD---PPSSDFTIDLKHEIALYIWKKLDGQ-ELTHVKQFCSEDPTSSKAAECATAFNSALPVCGSPVQKEDMFVAIKTCRKFHKDRVPVVKKTWEKQATHYEYYSDYADNTIPTADLRIPNVERGHCGKTFAILERFME-LYVGRMSWLIIVDDDTLISLPRLQKLLGCYNPHQAVFLGERYGYGLQAG-GYNYITGGGGMVFSREAVRRLMNSKCRCYSNDAPDDMVLGMCFSSLGITITHSPLFHQARPTDYAKDYLAHQIPISFHKHWNIDPIKVYYKWLGQDEEKQQHGQ 452          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Xenopus
Match: fam131a (family with sequence similarity 131 member A [Source:Xenbase;Acc:XB-GENE-939986])

HSP 1 Score: 251.521 bits (641), Expect = 5.802e-77
Identity = 152/431 (35.27%), Postives = 229/431 (53.13%), Query Frame = 1
Query:  169 YHNTRFSLFKRHLVSQLP--TNQPPKLIYSENDTTSVLFHLILPAIRFYRNEIIK-FKWIIFAQEETRLELKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFA---KPHSLLYPHREVGFILSINLCKLILEELDREFLAPEKYDTHIDPQYEMVKFIREKLISDFQMSNNSEFCLKSEPDEYCAVWITQF-SYLPNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRI-SKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLNHSNSHTQKYQ 1437
            +H  R    K +++ Q    + + PK++  +    S     I PAI ++ +   +   WI F +EET + L +L   L + +  +   LG AL D + +IIHH+A    P    YP    G+ LS+ L + + + L R+   P   D  ID ++E+  +I +KL    ++++  +FC +       A   T F S LP C S + + +  VA+KTC+KF + R+  +K TW     +  Y+++ AD  +PT    + N E GHC K  +IL    E      + +L+IVDDDTL+S+PRL++LL CY   + + LGERY Y    G GY+Y+TGG G+V S   VRR+ +    C SND PDDM LGM       ++ HS LFHQARP DYA   +  +  ISFHK W   P+++Y+K+L       Q  Q
Sbjct:   24 FHKKRAEDLKENILKQAAVISKKLPKVLLIDELEPSESAWTIFPAIPYFSDTYGRNSSWIFFCEEETTISLPKLLMTLQKFEKSKNWFLGRALHDEESTIIHHYAFTENPSVFKYPDFAAGWALSMPLVRRLSDVLLRD---PPSSDFTIDLKHEIALYIWKKLDGQ-ELTHVKQFCSEDPTSSKAAECATAFNSALPVCGSPVQKEDMFVAIKTCRKFHKDRVPVVKKTWEKQATHYEYYSDYADNTIPTADLRIPNVERGHCGKTFAILERFME-LYVGRMSWLIIVDDDTLISLPRLQKLLGCYNPHQAVFLGERYGYGLQAG-GYNYITGGGGMVFSREAVRRLMNSKCRCYSNDAPDDMVLGMCFSSLGITITHSPLFHQARPTDYAKDYLAHQIPISFHKHWNIDPIKVYYKWLGQDEEKQQHGQ 448          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Xenopus
Match: fam131a (family with sequence similarity 131 member A [Source:Xenbase;Acc:XB-GENE-939986])

HSP 1 Score: 251.136 bits (640), Expect = 1.352e-76
Identity = 152/431 (35.27%), Postives = 229/431 (53.13%), Query Frame = 1
Query:  169 YHNTRFSLFKRHLVSQLP--TNQPPKLIYSENDTTSVLFHLILPAIRFYRNEIIK-FKWIIFAQEETRLELKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFA---KPHSLLYPHREVGFILSINLCKLILEELDREFLAPEKYDTHIDPQYEMVKFIREKLISDFQMSNNSEFCLKSEPDEYCAVWITQF-SYLPNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRI-SKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLNHSNSHTQKYQ 1437
            +H  R    K +++ Q    + + PK++  +    S     I PAI ++ +   +   WI F +EET + L +L   L + +  +   LG AL D + +IIHH+A    P    YP    G+ LS+ L + + + L R+   P   D  ID ++E+  +I +KL    ++++  +FC +       A   T F S LP C S + + +  VA+KTC+KF + R+  +K TW     +  Y+++ AD  +PT    + N E GHC K  +IL    E      + +L+IVDDDTL+S+PRL++LL CY   + + LGERY Y    G GY+Y+TGG G+V S   VRR+ +    C SND PDDM LGM       ++ HS LFHQARP DYA   +  +  ISFHK W   P+++Y+K+L       Q  Q
Sbjct:   43 FHKKRAEDLKENILKQAAVISKKLPKVLLIDELEPSESAWTIFPAIPYFSDTYGRNSSWIFFCEEETTISLPKLLMTLQKFEKSKNWFLGRALHDEESTIIHHYAFTENPSVFKYPDFAAGWALSMPLVRRLSDVLLRD---PPSSDFTIDLKHEIALYIWKKLDGQ-ELTHVKQFCSEDPTSSKAAECATAFNSALPVCGSPVQKEDMFVAIKTCRKFHKDRVPVVKKTWEKQATHYEYYSDYADNTIPTADLRIPNVERGHCGKTFAILERFME-LYVGRMSWLIIVDDDTLISLPRLQKLLGCYNPHQAVFLGERYGYGLQAG-GYNYITGGGGMVFSREAVRRLMNSKCRCYSNDAPDDMVLGMCFSSLGITITHSPLFHQARPTDYAKDYLAHQIPISFHKHWNIDPIKVYYKWLGQDEEKQQHGQ 467          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Xenopus
Match: fam131a (family with sequence similarity 131 member A [Source:Xenbase;Acc:XB-GENE-939986])

HSP 1 Score: 251.521 bits (641), Expect = 1.576e-76
Identity = 152/431 (35.27%), Postives = 229/431 (53.13%), Query Frame = 1
Query:  169 YHNTRFSLFKRHLVSQLP--TNQPPKLIYSENDTTSVLFHLILPAIRFYRNEIIK-FKWIIFAQEETRLELKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFA---KPHSLLYPHREVGFILSINLCKLILEELDREFLAPEKYDTHIDPQYEMVKFIREKLISDFQMSNNSEFCLKSEPDEYCAVWITQF-SYLPNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRI-SKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLNHSNSHTQKYQ 1437
            +H  R    K +++ Q    + + PK++  +    S     I PAI ++ +   +   WI F +EET + L +L   L + +  +   LG AL D + +IIHH+A    P    YP    G+ LS+ L + + + L R+   P   D  ID ++E+  +I +KL    ++++  +FC +       A   T F S LP C S + + +  VA+KTC+KF + R+  +K TW     +  Y+++ AD  +PT    + N E GHC K  +IL    E      + +L+IVDDDTL+S+PRL++LL CY   + + LGERY Y    G GY+Y+TGG G+V S   VRR+ +    C SND PDDM LGM       ++ HS LFHQARP DYA   +  +  ISFHK W   P+++Y+K+L       Q  Q
Sbjct:   66 FHKKRAEDLKENILKQAAVISKKLPKVLLIDELEPSESAWTIFPAIPYFSDTYGRNSSWIFFCEEETTISLPKLLMTLQKFEKSKNWFLGRALHDEESTIIHHYAFTENPSVFKYPDFAAGWALSMPLVRRLSDVLLRD---PPSSDFTIDLKHEIALYIWKKLDGQ-ELTHVKQFCSEDPTSSKAAECATAFNSALPVCGSPVQKEDMFVAIKTCRKFHKDRVPVVKKTWEKQATHYEYYSDYADNTIPTADLRIPNVERGHCGKTFAILERFME-LYVGRMSWLIIVDDDTLISLPRLQKLLGCYNPHQAVFLGERYGYGLQAG-GYNYITGGGGMVFSREAVRRLMNSKCRCYSNDAPDDMVLGMCFSSLGITITHSPLFHQARPTDYAKDYLAHQIPISFHKHWNIDPIKVYYKWLGQDEEKQQHGQ 490          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Xenopus
Match: fam131a (family with sequence similarity 131 member A [Source:Xenbase;Acc:XB-GENE-939986])

HSP 1 Score: 230.72 bits (587), Expect = 8.027e-69
Identity = 149/431 (34.57%), Postives = 220/431 (51.04%), Query Frame = 1
Query:  169 YHNTRFSLFKRHLVSQLP--TNQPPKLIYSENDTTSVLFHLILPAIRFYRNEIIK-FKWIIFAQEETRLELKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFA---KPHSLLYPHREVGFILSINLCKLILEELDREFLAPEKYDTHIDPQYEMVKFIREKLISDFQMSNNSEFCLKSEPDEYCAVWITQF-SYLPNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRI-SKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLNHSNSHTQKYQ 1437
            +H  R    K +++ Q    + + PK++  +    S     I PAI ++ +   +   WI F +EET + L +L   L + +  +   LG AL D + +IIHH+A    P    YP    G+ L I+L    L      F            QY +  +I +KL    ++++  +FC +       A   T F S LP C S + + +  VA+KTC+KF + R+  +K TW     +  Y+++ AD  +PT    + N E GHC K  +IL    E      + +L+IVDDDTL+S+PRL++LL CY   + + LGERY Y    G GY+Y+TGG G+V S   VRR+ +    C SND PDDM LGM       ++ HS LFHQARP DYA   +  +  ISFHK W   P+++Y+K+L       Q  Q
Sbjct:   57 FHKKRAEDLKENILKQAAVISKKLPKVLLIDELEPSESAWTIFPAIPYFSDTYGRNSSWIFFCEEETTISLPKLLMTLQKFEKSKNWFLGRALHDEESTIIHHYAFTENPSVFKYPDFAAGWAL-IHLIGTKL------FFT----------QY-IALYIWKKLDGQ-ELTHVKQFCSEDPTSSKAAECATAFNSALPVCGSPVQKEDMFVAIKTCRKFHKDRVPVVKKTWEKQATHYEYYSDYADNTIPTADLRIPNVERGHCGKTFAILERFME-LYVGRMSWLIIVDDDTLISLPRLQKLLGCYNPHQAVFLGERYGYGLQAG-GYNYITGGGGMVFSREAVRRLMNSKCRCYSNDAPDDMVLGMCFSSLGITITHSPLFHQARPTDYAKDYLAHQIPISFHKHWNIDPIKVYYKWLGQDEEKQQHGQ 466          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Mouse
Match: B3glct (beta-3-glucosyltransferase [Source:MGI Symbol;Acc:MGI:2685903])

HSP 1 Score: 226.868 bits (577), Expect = 2.258e-67
Identity = 149/375 (39.73%), Postives = 203/375 (54.13%), Query Frame = 1
Query:  334 WIIFAQEETRLELKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFA---KPHSLLYPHREVGFILSINLCKLILEELDREFLAPEKYDTHIDPQYEMVKFIREKLISDFQMSNNSEFCLKSEPDEYCAVWITQF-SYLPNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRR-ISKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLNHS--NSHTQKYQ 1437
            WI F +EETRL++ +L   L   D  +   LG AL D + +IIHH+A    P    YP    G+ LSI L   + + L  E L   K D  ID ++E+  +I +K      ++   EFC + + D  C   +T F S+LP C   + + E  VAVKTCKKF   RI  +K TW      I Y+++ A+  +PTV  G+ NT+ GHC K  +IL         N++ +LVIVDDDTL+S+ RLR LL CY   + + LGERY Y      GY Y+TGG G+V S   +RR +     C SND PDDM LGM        + HS LFHQARP DY    +  +  +SFHK W   P+++Y  +L  S  +  TQ+ Q
Sbjct:  118 WIFFCEEETRLQIPRLLDTLRRYDPSKEWFLGKALYDEESTIIHHYAFSENPTVFKYPDFAAGWALSIPLVNKLAKRLKSEAL---KSDFTIDLKHEIALYIWDKG-GGPALTPVPEFCTE-DVDPRC---VTTFHSFLPLCGVPVKKEEIFVAVKTCKKFHADRIPIVKKTWAAQASLIEYYSDYAETAIPTVDLGIPNTDRGHCGKTFAILEKFLNHSH-NKISWLVIVDDDTLISISRLRHLLSCYDSSDPVFLGERYGYGL-GTGGYSYVTGGGGMVFSREAIRRLLVSSCRCYSNDAPDDMVLGMCFSGLGVPVTHSPLFHQARPVDYPKDYLAHQIPVSFHKHWHIDPVKVYLTWLAPSEEDQATQETQ 482          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Mouse
Match: C1galt1 (core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1 [Source:MGI Symbol;Acc:MGI:2151071])

HSP 1 Score: 52.7582 bits (125), Expect = 6.829e-7
Identity = 49/203 (24.14%), Postives = 82/203 (40.39%), Query Frame = 1
Query:  751 SMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGH-------CSKLKSILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRIS---KLTFCNSNDWPDDMTLGMWLDDAN------QSLLHSHLFHQARPE 1311
            ++  + + L  V T  +    +   +K+TW      +L+ +   ++  PTV    L T+ G            + +     ED  W      +  DDDT + V  LR LL  Y  ++ I  G R+    +   GY  ++GG+G VLS   +RR     K   C  +   +D+ LG  ++  N      +  +    FH   PE
Sbjct:   82 NLYQKVKILCWVMTSPQNLEKKAKHVKATWAQRCNKVLFMSSEENQDFPTVG---LKTKEGREQLYWKTIKAFQYVHDHYLEDADW-----FMKADDDTYVIVDNLRWLLSKYNPEQPIYFGRRFK--PYVKQGY--MSGGAGYVLSKEALRRFVNAFKTEKCTHSSSIEDLALGRCMEIINVEAGDSRDTIGKETFHPFVPE 272          
BLAST of Beta-1,3-glucosyltransferase vs. UniProt/SwissProt
Match: sp|Q6Y288|B3GLT_HUMAN (Beta-1,3-glucosyltransferase OS=Homo sapiens OX=9606 GN=B3GLCT PE=1 SV=2)

HSP 1 Score: 227.254 bits (578), Expect = 1.185e-66
Identity = 156/427 (36.53%), Postives = 220/427 (51.52%), Query Frame = 1
Query:  169 YHNTRFSLFKRHLVSQLP--TNQPPKLIYSENDTTSVLFHLILP-----AIRFYRNEIIKFKWIIFAQEETRLELKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFA---KPHSLLYPHREVGFILSINLCKLILEELDREFLAPEKYDTHIDPQYEMVKFIREKLISDFQMSNNSEFCLKSEPDEYCAVWITQFSYLPNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRR-ISKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLNHSN 1416
            +H  R    K+ ++ Q    T + P ++             ILP     ++ + RN      WI F +EETR+++ +L   L   D  +   LG AL D + +IIHH+A    P    YP    G+ LSI L   + + L  E L   K D  ID ++E+  +I +K      ++   EFC  ++ D YCA   T  S+LP C   + + +  VAVKTCKKF   RI  +K TW      I Y+++  +  +PTV  G+ NT+ GHC K  +IL       + ++  +LVIVDDDTL+S+ RL+ LL CY   E + LGERY Y      GY Y+TGG G+V S   VRR ++    C SND PDDM LGM        + HS LFHQARP DY    +  +  ISFHK W   P+++Y  +L  S+
Sbjct:   69 FHAKRAEQLKKSILKQAADLTQELPSVLLLHQLAKQEGAWTILPLLPHFSVTYSRNS----SWIFFCEEETRIQIPKLLETLRRYDPSKEWFLGKALHDEEATIIHHYAFSENPTVFKYPDFAAGWALSIPLVNKLTKRLKSESL---KSDFTIDLKHEIALYIWDKG-GGPPLTPVPEFC-TNDVDFYCAT--TFHSFLPLCRKPVKKKDIFVAVKTCKKFHGDRIPIVKQTWESQASLIEYYSDYTENSIPTVDLGIPNTDRGHCGKTFAILERFLNRSQ-DKTAWLVIVDDDTLISISRLQHLLSCYDSGEPVFLGERYGYGL-GTGGYSYITGGGGMVFSREAVRRLLASKCRCYSNDAPDDMVLGMCFSGLGIPVTHSPLFHQARPVDYPKDYLSHQVPISFHKHWNIDPVKVYFTWLAPSD 482          
BLAST of Beta-1,3-glucosyltransferase vs. UniProt/SwissProt
Match: sp|Q8BHT6|B3GLT_MOUSE (Beta-1,3-glucosyltransferase OS=Mus musculus OX=10090 GN=B3glct PE=1 SV=3)

HSP 1 Score: 226.868 bits (577), Expect = 1.580e-66
Identity = 149/375 (39.73%), Postives = 203/375 (54.13%), Query Frame = 1
Query:  334 WIIFAQEETRLELKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFA---KPHSLLYPHREVGFILSINLCKLILEELDREFLAPEKYDTHIDPQYEMVKFIREKLISDFQMSNNSEFCLKSEPDEYCAVWITQF-SYLPNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRR-ISKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLNHS--NSHTQKYQ 1437
            WI F +EETRL++ +L   L   D  +   LG AL D + +IIHH+A    P    YP    G+ LSI L   + + L  E L   K D  ID ++E+  +I +K      ++   EFC + + D  C   +T F S+LP C   + + E  VAVKTCKKF   RI  +K TW      I Y+++ A+  +PTV  G+ NT+ GHC K  +IL         N++ +LVIVDDDTL+S+ RLR LL CY   + + LGERY Y      GY Y+TGG G+V S   +RR +     C SND PDDM LGM        + HS LFHQARP DY    +  +  +SFHK W   P+++Y  +L  S  +  TQ+ Q
Sbjct:  118 WIFFCEEETRLQIPRLLDTLRRYDPSKEWFLGKALYDEESTIIHHYAFSENPTVFKYPDFAAGWALSIPLVNKLAKRLKSEAL---KSDFTIDLKHEIALYIWDKG-GGPALTPVPEFCTE-DVDPRC---VTTFHSFLPLCGVPVKKEEIFVAVKTCKKFHADRIPIVKKTWAAQASLIEYYSDYAETAIPTVDLGIPNTDRGHCGKTFAILEKFLNHSH-NKISWLVIVDDDTLISISRLRHLLSCYDSSDPVFLGERYGYGL-GTGGYSYVTGGGGMVFSREAIRRLLVSSCRCYSNDAPDDMVLGMCFSGLGVPVTHSPLFHQARPVDYPKDYLAHQIPVSFHKHWHIDPVKVYLTWLAPSEEDQATQETQ 482          
BLAST of Beta-1,3-glucosyltransferase vs. UniProt/SwissProt
Match: sp|Q08BL3|C1GTA_DANRE (Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-A OS=Danio rerio OX=7955 GN=c1galt1a PE=2 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 9.713e-8
Identity = 51/204 (25.00%), Postives = 85/204 (41.67%), Query Frame = 1
Query:  754 MIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTM-IAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRISK---LTFCNSNDWPDDMTLGMWLDDAN------QSLLHSHLFHQARPEDYASQRID 1335
            +  +   L  V T     +S+   +K+TW+     +L+ +   DR  PTV  G    E       K+I     A     +E  + +  DDDT + V  LR +L  Y  ++ I  G+R+   +  G    Y++GG+G VLS   +RR  +      C      +D+ +G  L+         +  LH   FH   PE + + +  
Sbjct:   88 LFKKVRILCWVMTGPSNLQSKAQHVKNTWSRHCNVVLFMSSEEDRSFPTVGLGT--GEGRDQLYWKTIRAFHYALKNHGHEADWFLKADDDTFVVVDNLRWILSNYTPEQPIYFGKRFKPYTKQG----YMSGGAGYVLSKEALRRFVEGFSTKVCTHTTPVEDLAMGQCLEKMGVLAGDSRDSLHRETFHPFIPEHHLTGKFS 285          
BLAST of Beta-1,3-glucosyltransferase vs. UniProt/SwissProt
Match: sp|P79948|LFNG_XENLA (Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe OS=Xenopus laevis OX=8355 GN=lfng PE=2 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 8.786e-7
Identity = 53/203 (26.11%), Postives = 93/203 (45.81%), Query Frame = 1
Query:  757 IDQSEFLVAVKTCKKFFRSRIVTIKSTW-TPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSI-LTMIAEDPKW--NEVKFLVIVDDDTLLSVPRLRQLLYCY-----------RMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRISKLT----FCNSND---WPDDMTLGMWLDDA-NQSLLHSHLFH 1296
            I  ++  +AVKT KKF RSR+  +  TW + + E    F +  D ++   +  V++T        +++   M  E  K+  ++ K+   VDDD  ++V  L +LL  Y            +D  I   ER +  +     + + TGG+G  +S  +  ++S       F N+ +    PDD T+G  ++      L+ S+LFH
Sbjct:  106 ITANDVFIAVKTTKKFHRSRMDLLMDTWISRNKEQTFIFTDGEDEELQKKTGNVISTNCSAAHSRQALSCKMAVEYDKFIESDKKWFCHVDDDNYVNVRTLVKLLSRYSHTNDIYIGKPSLDRPIQATERISESNMRPVNFWFATGGAGFCISRGLALKMSPWASGGHFMNTAEKIRLPDDCTIGYIIESVLGVKLIRSNLFH 308          
BLAST of Beta-1,3-glucosyltransferase vs. UniProt/SwissProt
Match: sp|Q9JJ06|C1GLT_MOUSE (Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=C1galt1 PE=1 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 4.777e-6
Identity = 49/203 (24.14%), Postives = 82/203 (40.39%), Query Frame = 1
Query:  751 SMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGH-------CSKLKSILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRIS---KLTFCNSNDWPDDMTLGMWLDDAN------QSLLHSHLFHQARPE 1311
            ++  + + L  V T  +    +   +K+TW      +L+ +   ++  PTV    L T+ G            + +     ED  W      +  DDDT + V  LR LL  Y  ++ I  G R+    +   GY  ++GG+G VLS   +RR     K   C  +   +D+ LG  ++  N      +  +    FH   PE
Sbjct:   82 NLYQKVKILCWVMTSPQNLEKKAKHVKATWAQRCNKVLFMSSEENQDFPTVG---LKTKEGREQLYWKTIKAFQYVHDHYLEDADW-----FMKADDDTYVIVDNLRWLLSKYNPEQPIYFGRRFK--PYVKQGY--MSGGAGYVLSKEALRRFVNAFKTEKCTHSSSIEDLALGRCMEIINVEAGDSRDTIGKETFHPFVPE 272          
BLAST of Beta-1,3-glucosyltransferase vs. TrEMBL
Match: A0A4D5RJX8 (Putative beta-13-glucosyltransferase OS=Ixodes scapularis OX=6945 PE=4 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 1.877e-86
Identity = 148/373 (39.68%), Postives = 213/373 (57.10%), Query Frame = 1
Query:  331 KWIIFAQEETRLELKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFAKPHSLLYPHREVGFILSINLCKLILEELDREFLAPEKYDTH---IDPQYEMVKFIREKLISDFQMSNNSEFCLKSEPDEYCAVWITQFSYLPNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAEDPKWN-EVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRISKLTF-CNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLNHSNSHTQKY 1434
            +W  F ++ T+L+L +L  +L++ +    + LG+AL D + +IIHHF  P SL YP    G +LS +        L+R   A  +  +H   ID QYE  KF+         + +   FCLK E    C  W  + +  P+C         LVAVKTC +F + R+  +K+TW  D E +++F++V D  +PTV+ GV N + GHC+K  +IL  +  +   +   ++LV+ DDDTLLS+PRL   L C+  D+ IALGERY + S  G GYDYLTGGSG+V +   V RI +    C S+D PDDM LG  L      L HS LFHQARP+DY+S  +  ++ ISFHKFW   P+E Y ++LN   S+  ++
Sbjct:  100 RWFFFCEDSTQLDLGRLVKLLNKYNCTDDHFLGHALWDLESTIIHHFDDPMSLAYPAISAGMVLSSS-------ALNRAATAWAQTASHEFSIDRQYEFAKFLGTPECGALLLEDVPSFCLKQEKGRSCVTWSARQT--PSCGHPAPGDAVLVAVKTCSQFHKERVPLVKATWAKDAEQVVFFSDVEDADIPTVTVGVSNVKRGHCAKTMAILKHVLSNGLLDTRTRWLVVADDDTLLSIPRLLDFLGCFNADDEIALGERYGFGSASGRGYDYLTGGSGMVFTKRTVERIVQSGCSCPSDDSPDDMLLGACLQRLGIPLTHSPLFHQARPDDYSSALLSHQRPISFHKFWMMDPIETYRRWLNDGPSNGSQH 463          
BLAST of Beta-1,3-glucosyltransferase vs. TrEMBL
Match: V5H8F6 (Putative beta-13-glucosyltransferase OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 1.958e-86
Identity = 148/373 (39.68%), Postives = 213/373 (57.10%), Query Frame = 1
Query:  331 KWIIFAQEETRLELKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFAKPHSLLYPHREVGFILSINLCKLILEELDREFLAPEKYDTH---IDPQYEMVKFIREKLISDFQMSNNSEFCLKSEPDEYCAVWITQFSYLPNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAEDPKWN-EVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRISKLTF-CNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLNHSNSHTQKY 1434
            +W  F ++ T+L+L +L  +L++ +    + LG+AL D + +IIHHF  P SL YP    G +LS +        L+R   A  +  +H   ID QYE  KF+         + +   FCLK E    CA W  + +  P+C         LVAVKTC +F + R+  +K+TW  D E +++F++V D  +PTV+ GV N + GHC+K  +IL  +  +   +   ++LV+ DDDTLLS+PRL   L C+  D+ IALGERY + S  G GYDYLTGGSG+V +   V RI +    C S+D PDDM LG  L      L HS LFHQARP+DY+   +  ++ ISFHKFW   P+E Y ++LN   S+  ++
Sbjct:  100 RWFFFCEDSTQLDLGRLVKLLNKYNCTDDHFLGHALWDLESTIIHHFDDPMSLAYPAISAGMVLSSS-------ALNRAATAWAQTASHEFSIDRQYEFAKFLGTPECGVLLLEDVPSFCLKQEKGRSCATWSARQT--PSCGRPAPGDAVLVAVKTCSQFHKERVPLVKATWAKDAERVVFFSDVEDADIPTVTVGVSNVKRGHCAKTMAILKHVLSNGLLDTRTRWLVVADDDTLLSIPRLLDFLGCFNTDDEIALGERYGFGSASGRGYDYLTGGSGMVFTKRTVERIVQSGCSCPSDDSPDDMLLGACLQRLGIPLTHSPLFHQARPDDYSGALLSHQRPISFHKFWMMDPIETYRRWLNDGPSNGSQH 463          
BLAST of Beta-1,3-glucosyltransferase vs. TrEMBL
Match: A0A1S3HB91 (beta-1,3-glucosyltransferase isoform X1 OS=Lingula unguis OX=7574 GN=LOC106153738 PE=4 SV=1)

HSP 1 Score: 276.944 bits (707), Expect = 4.283e-83
Identity = 148/370 (40.00%), Postives = 215/370 (58.11%), Query Frame = 1
Query:  325 KFKWIIFAQEETRLELKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFA---KPHSLLYPHREVGFILSINLCKLILEELDREFLAPEKYDTHIDPQYEMVKFIREKLISDFQMSNNSEFCLKSEPDEYCAVWITQFSYLPNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRI--SKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRID-TEKSISFHKFWETKPLELYHKYLNHSN 1416
            KF+W+ F +++T + L +L  +L   D  +   LG ALRD   +IIHHFA    P S  YP    GF+LS  L K + E   R      K D  IDP++E+ KFI +      ++++  E C   EPDE CA        LP+C + + + +   A+KTC+++   R+  ++ TW  D  NI Y++E  D  +PT+  GV NT  GHC K  +IL  +      +++ +LV+ DDDTLLSV RL++LL CY  +E +ALGERY Y +  G GYDY+TGG G+VLS   V  +  +K  +C S++ PDDM LG WL   +  ++HS LFHQARP+DYA   +   E+ ISFHK W   P ++Y+++L   +
Sbjct:  106 KFRWLFFCEDQTSINLAKLLEVLKRFDPSKEQFLGKALRDSIPTIIHHFAFHDNPSSFAYPDFAAGFLLSQPLIKSLAE---RWLEKKSKMDFTIDPKHELAKFIWDDDRGP-RLTDIPELC-AGEPDEKCAT--NCEVRLPDCGAPVPKEKIFFAIKTCEQYHTERVPVVQKTWGQDAMNIEYYSEKEDSSIPTIDLGVPNTVRGHCGKFLAILKRVHSKENLSKIPWLVVADDDTLLSVSRLQRLLACYNPEEKVALGERYGYGTSSGLGYDYITGGGGMVLSQKTVSVLLDTKTAYCPSDESPDDMLLGTWLKRLDIPIIHSPLFHQARPDDYAGDYLGHQEEPISFHKHWMVDPYKVYNQWLKEKD 468          
BLAST of Beta-1,3-glucosyltransferase vs. TrEMBL
Match: A0A0B7A1F6 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF92505 PE=4 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 4.413e-82
Identity = 162/424 (38.21%), Postives = 234/424 (55.19%), Query Frame = 1
Query:  169 YHNTRFSLFKRHLVSQLPTN--QPPKLIYSENDTTSVLFH-LILPAIRFYRN--EIIKFKWIIFAQEETRLELKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFA---KPHSLLYPHREVGFILSINLCKLILEELDREFLAPEKYDTHIDPQYEMVKFIREKLISDFQMSNNSEFC-LKSEPDEYCAVWITQFSYLPNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRISKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLNHS 1413
            +H +  +  K H  +QLP N  Q PKL+++  D   V     ILP I    N    +   WI+  +E T + +  L  ML      + +LLG  L D + +IIHHFA    P    YP    GF++SI L K +   L    +   K D  IDP++E   F+ ++  +  +++N ++FC   +  D  C    +Q    PNC S ID  +  VAVKTC++F  SRI  +K+TW  + + I YF+EV D+K+PT+   V NTE GHC K  +I+      PK + +K+++I DDDT++++ RLR LL CY   + +ALGERY Y    G GYDY+TGG G+V SM  V+ +++   C  N+ PDDMTLGM L      + HS  FHQARPEDY+   +  +  +SFHK W   P ++Y + L  S
Sbjct:   38 FHESLATELKTHFENQLPLNKIQWPKLLFTHKDFLHVHGAWTILPLIHQIVNVHADVDTSWILICEEHTHINVSLLTAMLQHYKATEKHLLGRKLYDHETTIIHHFAFADNPSQFAYPDFGAGFVMSIALVKHLHHRLHTSRM---KTDFSIDPKHEFALFVLDEG-NGTKLTNVNQFCSADTSSDPNCIT--SQPDKFPNCGSSIDNGDLFVAVKTCQQFHESRIPVVKATWGKEAKVIEYFSEVVDKKIPTIDLMVPNTERGHCGKTMAIIQRAVSSPKLSRIKWVLIADDDTIINLDRLRALLACYNQQQPVALGERYGYGVVNGGGYDYITGGGGMVFSMPAVKLLAERCECYKNNAPDDMTLGMCLRSIGIPVTHSRYFHQARPEDYSKDFLANQLPVSFHKHWNNDPYKVYDQLLASS 455          
BLAST of Beta-1,3-glucosyltransferase vs. TrEMBL
Match: V5IER3 (Putative beta 13-galactosyltransferase-like b (Fragment) OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 4.753e-82
Identity = 141/344 (40.99%), Postives = 196/344 (56.98%), Query Frame = 1
Query:  418 NLLGYALRDFDRSIIHHFAKPHSLLYPHREVGFILSINLCKLILEELDREFLAPEKYDTH---IDPQYEMVKFIREKLISDFQMSNNSEFCLKSEPDEYCAVWITQFSYLPNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAEDPKWN-EVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRISKLTF-CNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLNHSNSHTQKY 1434
            + LG+AL D + +IIHHF  P SL YP    G +LS +        L+R   A  +  +H   ID QYE  KF+         + +   FCLK E    CA W  + +  P+C         LVAVKTC +F + R+  +K+TW  D E +++F++V D  +PTV+ GV N + GHC+K  +IL  +  +   +   ++LV+ DDDTLLS+PRL   L C+  D+ IALGERY + S  G GYDYLTGGSG+V +   V RI +    C S+D PDDM LG  L      L HS LFHQARP+DY+   +  ++ ISFHKFW   P+E Y ++LN   S+  ++
Sbjct:    2 HFLGHALWDLESTIIHHFDDPMSLAYPAISAGMVLSSS-------ALNRAATAWAQTASHEFSIDRQYEFAKFLGTPECGVLLLEDVPSFCLKQEKGRSCATWSARQT--PSCGRPAPGDAVLVAVKTCSQFHKERVPLVKATWAKDAERVVFFSDVEDADIPTVTVGVSNVKRGHCAKTMAILKHVLSNGLLDTRTRWLVVADDDTLLSIPRLLDFLGCFNTDDEIALGERYGFGSASGRGYDYLTGGSGMVFTKRTVERIVQSGCSCPSDDSPDDMLLGACLQRLGIPLTHSPLFHQARPDDYSGALLSHQRPISFHKFWMMDPIETYRRWLNDGPSNGSQH 336          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Cavefish
Match: b3glctb (beta 3-glucosyltransferase b [Source:ZFIN;Acc:ZDB-GENE-091204-128])

HSP 1 Score: 255.373 bits (651), Expect = 2.686e-78
Identity = 159/422 (37.68%), Postives = 227/422 (53.79%), Query Frame = 1
Query:  169 YHNTRFSLFKRHLV--SQLPTNQPPKLIYSENDTTSVLFHLILPAIRFYRNEII-KFKWIIFAQEETRLELKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFA---KPHSLLYPHREVGFILSINLCKLILEELDREFLAPEKYDTHIDPQYEMVKFIREKLISDFQMSNNSEFC--LKSEPD-EYCAVWITQFSYLPNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRR-ISKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYL 1404
            YH  R    + HL   +QL     P +++    +       ILPA+            WI F +EET ++L +L  +LS     +   LG AL D + +IIHH+A   +P +  YP    G+ LS  L K + + +  E   P K D  ID ++E+  +I E+      + N  EFC  L   P+  +CA  +   +Y+P+C + + + E  VAVKTC+KF R R+  +K TW  D   + Y+++ AD  +PTV   V NTE GHC+K  SIL   A         +L+IVDDDTL+S+PRLR+LL CY   E + +GERY Y    G GY Y+TGG G+V S   V+R +S    C S D PDDM LGM L+     + HS  FHQARP+DY+ Q +  +  +SFHK W   P+ +Y ++L
Sbjct:   63 YHTLRAEQRRAHLFHQAQLLKQGLPDVVFLHELSEYGGNWGILPALPLLAEGYCWSSSWIFFLEEETIVDLDRLLQVLSRFTSGREWFLGRALYDKEATIIHHYAFSEEPSAFSYPDFTAGWALSCPLVKRLADYVKYE---PPKSDFTIDLKHEIALYIWEEGRGP-ALINVREFCSELHGSPNTNHCASAVN--TYIPSCGNPVKKEELFVAVKTCQKFHRDRVPVVKKTWAKDAALLEYYSDAADPAIPTVDLRVPNTERGHCAKTFSILRRFASG-GVTRAPWLLIVDDDTLISLPRLRKLLRCYNPGEPVCVGERYGYGLSQG-GYSYVTGGGGMVFSREAVQRMLSSGCGCYSPDAPDDMVLGMCLNTLGIPVTHSPQFHQARPDDYSKQLLLRQSPVSFHKHWNINPVAVYQRWL 476          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Cavefish
Match: b3glcta (beta 3-glucosyltransferase [Source:NCBI gene;Acc:103021575])

HSP 1 Score: 226.483 bits (576), Expect = 3.543e-67
Identity = 152/427 (35.60%), Postives = 228/427 (53.40%), Query Frame = 1
Query:  169 YHNTRFSLFKRHLVSQLPT--NQPPKLIYSENDTTSVLFHLILPAIRFYRNEI-IKFKWIIFAQEETRLELKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFA---KPHSLLYPHREVGFILSINLCKLILEELDREFLAPEKYDTHIDPQYEMVKFIREKLISDFQMSNNSEFCL---KSEPDEYCAVWITQFSYLPNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILT--MIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRI-SKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLNHS 1413
            +H  R    +  L+ Q       PP ++     T +     ILP++ ++ +       WI+F +EET ++L +L  +L +    +   LG +L D + +IIHH+A    P +  YP    G+ LSI L   +  ++  E   P K D  ID ++E+  +I ++     +++   E C     S   + CA  +   S  P C   + Q +  VAVKTCKKF   R+  +K TW     ++ Y+++ AD  +PT+  GV NT+ GHC K  +IL+  M +  P   +  +L+IVDDDTL+S+PRL+ LL CY   E + LGERY Y      GY Y+TGG G+V S   VRR+ +    C SND PDDM +GM L+     + HS LFHQARPEDYA   +  +  ISFHK W   P+ +++K+L+ S
Sbjct:   68 FHARRAERLRAELLLQTAALRESPPTILLLHTLTDNEGDWSILPSLPYFSSHFRGNSSWIVFLEEETSVKLDRLLSVLKKFVRRKEWFLGKSLHDDESTIIHHYAFAENPSAFKYPDFSAGWALSIPLVIRLANKVQEE---PLKSDFTIDLKHEVALYIWDEGKGP-RLTAVPELCTLPENSPKAKDCATTVGTHS--PLCGEPVPQEDIFVAVKTCKKFHSERVPVVKKTWEKQASHLEYYSDHADPSIPTIDLGVPNTDRGHCGKTFAILSRYMSSAVP---QTDWLLIVDDDTLISLPRLQALLSCYDSRESVCLGERYGYGL-GQGGYSYITGGGGMVFSREAVRRLLASGCKCYSNDAPDDMVVGMCLNALQIPVTHSPLFHQARPEDYARDFLAHQTPISFHKHWNIDPIAVFNKWLSDS 484          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Cavefish
Match: b3glcta (beta 3-glucosyltransferase [Source:NCBI gene;Acc:103021575])

HSP 1 Score: 226.868 bits (577), Expect = 5.432e-67
Identity = 152/427 (35.60%), Postives = 229/427 (53.63%), Query Frame = 1
Query:  169 YHNTRFSLFKRHLVSQLPT--NQPPKLIYSENDTTSVLFHLILPAIRFYRNEI-IKFKWIIFAQEETRLELKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFA---KPHSLLYPHREVGFILSINLCKLILEELDREFLAPEKYDTHIDPQYEMVKFIREKLISDFQMSNNSEFCL---KSEPDEYCAVWITQFSYLPNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILT--MIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRI-SKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLNHS 1413
            +H  R    +  L+ Q       PP ++     T +     ILP++ ++ +       WI+F +EET ++L +L  +L +    +   LG +L D + +IIHH+A    P +  YP    G+ LSI L   +  ++  E   P K D  ID ++E+  +I ++     +++   E C     S   + CA   T  ++ P C   + Q +  VAVKTCKKF   R+  +K TW     ++ Y+++ AD  +PT+  GV NT+ GHC K  +IL+  M +  P   +  +L+IVDDDTL+S+PRL+ LL CY   E + LGERY Y      GY Y+TGG G+V S   VRR+ +    C SND PDDM +GM L+     + HS LFHQARPEDYA   +  +  ISFHK W   P+ +++K+L+ S
Sbjct:  108 FHARRAERLRAELLLQTAALRESPPTILLLHTLTDNEGDWSILPSLPYFSSHFRGNSSWIVFLEEETSVKLDRLLSVLKKFVRRKEWFLGKSLHDDESTIIHHYAFAENPSAFKYPDFSAGWALSIPLVIRLANKVQEE---PLKSDFTIDLKHEVALYIWDEGKGP-RLTAVPELCTLPENSPKAKDCAT--TVGTHSPLCGEPVPQEDIFVAVKTCKKFHSERVPVVKKTWEKQASHLEYYSDHADPSIPTIDLGVPNTDRGHCGKTFAILSRYMSSAVP---QTDWLLIVDDDTLISLPRLQALLSCYDSRESVCLGERYGYGL-GQGGYSYITGGGGMVFSREAVRRLLASGCKCYSNDAPDDMVVGMCLNALQIPVTHSPLFHQARPEDYARDFLAHQTPISFHKHWNIDPIAVFNKWLSDS 524          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Cavefish
Match: b3glcta (beta 3-glucosyltransferase [Source:NCBI gene;Acc:103021575])

HSP 1 Score: 224.172 bits (570), Expect = 7.909e-67
Identity = 142/369 (38.48%), Postives = 207/369 (56.10%), Query Frame = 1
Query:  334 WIIFAQEETRLELKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFA---KPHSLLYPHREVGFILSINLCKLILEELDREFLAPEKYDTHIDPQYEMVKFIREKLISDFQMSNNSEFCL---KSEPDEYCAVWITQFSYLPNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILT--MIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRI-SKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLNHS 1413
            WI+F +EET ++L +L  +L +    +   LG +L D + +IIHH+A    P +  YP    G+ LSI L   +  ++  E   P K D  ID ++E+  +I ++     +++   E C     S   + CA  +   S  P C   + Q +  VAVKTCKKF   R+  +K TW     ++ Y+++ AD  +PT+  GV NT+ GHC K  +IL+  M +  P   +  +L+IVDDDTL+S+PRL+ LL CY   E + LGERY Y      GY Y+TGG G+V S   VRR+ +    C SND PDDM +GM L+     + HS LFHQARPEDYA   +  +  ISFHK W   P+ +++K+L+ S
Sbjct:   79 WIVFLEEETSVKLDRLLSVLKKFVRRKEWFLGKSLHDDESTIIHHYAFAENPSAFKYPDFSAGWALSIPLVIRLANKVQEE---PLKSDFTIDLKHEVALYIWDEGKGP-RLTAVPELCTLPENSPKAKDCATTVGTHS--PLCGEPVPQEDIFVAVKTCKKFHSERVPVVKKTWEKQASHLEYYSDHADPSIPTIDLGVPNTDRGHCGKTFAILSRYMSSAVP---QTDWLLIVDDDTLISLPRLQALLSCYDSRESVCLGERYGYGL-GQGGYSYITGGGGMVFSREAVRRLLASGCKCYSNDAPDDMVVGMCLNALQIPVTHSPLFHQARPEDYARDFLAHQTPISFHKHWNIDPIAVFNKWLSDS 437          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Cavefish
Match: c1galt1a (glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-A-like [Source:NCBI gene;Acc:103043397])

HSP 1 Score: 59.3066 bits (142), Expect = 4.177e-9
Identity = 49/199 (24.62%), Postives = 83/199 (41.71%), Query Frame = 1
Query:  775 LVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVL-NTETGHCSKLKSI---LTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRISK---LTFCNSNDWPDDMTLGMWLDDAN------QSLLHSHLFHQARPEDYASQRI 1332
            L  V T     +S+   +K+TWT     +L+ + V D   P V  G     +  +   +++    L    ED  W      +  DDDT + V  LR +L  Y  ++ +  G+R+   +  G    Y++GG+G VLS   +RR  +      C      +D+ +G  L+         +  LH   FH   PE + + + 
Sbjct:   88 LCWVMTGPSNLQSKARHVKATWTRHCNTVLFMSSVEDHSFPAVGLGTGEGRDQLYWKTIRAFHYALKNHGEDADW-----FLKADDDTFVVVDNLRWVLSNYSSEDPVYFGKRFKPYAKQG----YMSGGAGYVLSKEALRRFVEGFSTKVCTHTTSVEDLAMGQCLEKMGVLAGDSRDSLHRETFHPFVPEHHLTGKF 277          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004592.1 (pep scaffold:Pmarinus_7.0:GL478389:36397:42648:-1 gene:ENSPMAG00000004181.1 transcript:ENSPMAT00000004592.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.138 bits (248), Expect = 2.885e-25
Identity = 57/125 (45.60%), Postives = 73/125 (58.40%), Query Frame = 1
Query: 1033 SVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRI-SKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYL 1404
            SVPRL++LL CY   E + LGERY Y    G GY Y+TGG G+V S   V+++ +    C S+D PDDM LGM          HS  FHQARPEDY    + +   +SFHK W T P  +Y ++L
Sbjct:    1 SVPRLQKLLSCYDPTEPVYLGERYGYGLLTGGGYSYITGGGGMVFSREAVKKLMAGGCKCYSDDAPDDMVLGMCFKSLAIPATHSPQFHQARPEDYPLDYLTSHSPVSFHKHWNTDPYHIYERWL 125          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006954.1 (pep scaffold:Pmarinus_7.0:GL487056:3020:4063:-1 gene:ENSPMAG00000006292.1 transcript:ENSPMAT00000006954.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 2.863e-7
Identity = 42/175 (24.00%), Postives = 74/175 (42.29%), Query Frame = 1
Query:  814 RIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRI---SKLTFCNSNDWPDDMTLGMWLD------DANQSLLHSHLFHQARPE 1311
            +I  IK++W    +  L+ +  AD    T+     +T  G+                  +V +++  +DDT + V  L+ LL  Y  ++ I  G R+ Y    G    Y++GGSG VLS   V ++    ++  C+     +D+ +   L+        ++ LL    FH   PE
Sbjct:   28 KIPHIKASWAKRCDVALFMSSQADDVYGTIGLRTEDTAGGNQYYRTIDAFKYVHRHHLRDVDWVLKAEDDTFIVVENLKLLLSNYSAEQPIFFGRRFKYFVKQG----YMSGGSGYVLSRRAVSKLVEAVEMKACDDEAKAEDVGIAACLEKIGVVAGESRDLLEREAFHGVFPE 198          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Nematostella
Match: EDO41359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4P9])

HSP 1 Score: 234.187 bits (596), Expect = 2.991e-71
Identity = 136/381 (35.70%), Postives = 220/381 (57.74%), Query Frame = 1
Query:  286 ILPAI--RFYRNEIIKFKWIIFAQEETRLELKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFA---KPHSLLYPHREVGFILSINLCKLILEELDREFLAPEKYDTHIDPQYEMVKFIREKLISDFQMSNNSEFCLK-SEPDEYCAVWITQFSYLPNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRISK-LTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLN 1407
            ILP++  R+  N+     WI F +E+T ++LK+L  +L + +  +   LG+A++D   +IIHHFA    P    +P    G+ +SI L K + + L+ +   P   D  ID Q+E+  FIR +      +++  E C       E+CA   T ++   +C   I   +   AVKT KK+   R+  +K T     +++++++E  D  VPT + GV NT+TGHC+KLK+I+   A D ++++  +LV++DDDT++SVPR++QLL CY   E I LGERY +    G GY+Y+TGG G+VLS + +  + +    C  ++ PDDM LG    + N  + HS  FHQARP +Y +  +D + ++SFHK ++  P+ +Y  YL+
Sbjct:   65 ILPSLLQRYADNK----AWIFFCEEDTVIDLKKLIEVLGKYNASKELFLGHAIQDPRPAIIHHFAFVEDPSQFSFPDFAAGWAISIPLLKSMSKRLESK---PINSDFTIDVQHEVAMFIRNEGEGTL-LTDVPELCTTLPGTQEHCA---TSYNSSISCGR-ISSDDIFFAVKTTKKYHGDRVPVVKKTLGQHAKHVVFYSETEDPDVPTENIGVPNTDTGHCAKLKAIIDRSAVDRRFSDKPWLVVIDDDTIMSVPRMQQLLACYDPQEPILLGERYGFGVATGYGYEYVTGGGGMVLSRAGINMLRESGCGCWQDNSPDDMWLGNCFRNLNIPVTHSPAFHQARPVEYVASLLDHQSAVSFHKHYDIDPIAVYRDYLS 433          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Medaka
Match: b3glcta (beta-1,3-glucosyltransferase [Source:NCBI gene;Acc:101156344])

HSP 1 Score: 236.498 bits (602), Expect = 1.453e-71
Identity = 153/437 (35.01%), Postives = 231/437 (52.86%), Query Frame = 1
Query:  169 YHNTRFSLFKRHLVSQLP--TNQPPKLIY----SENDTTSVLFHLILPAIRFYRNEIIKFKWIIFAQEETRLELKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFA---KPHSLLYPHREVGFILSINLCKLILEELDREFLAPEKYDTHIDPQYEMVKFIREKLISDFQMSNNSEFCLKSEPD---EYCAVWITQFSYLP-NCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSM-SVVRRISKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLNHSNSHTQKYQ 1437
            +H  +    + HL+ Q    T +PP ++     S+ND    +  L LP   F R+ +    W++F +EET +++     +LS+ D  +   +G  L D + +IIHH+A    P    YP     + LS+ L   +  ++  E   P K D  ID ++E+  +I +       ++   E C + E     ++CA   T  S  P  C   + + +  VAVKTC+KF   R+  IK TW  D   + Y+++ AD  +PT++ GV NTE GHC K  +IL         N  K+L++VDDDTL+S+PRL+ LL CY   E ++LGERY Y    G GY Y+TGG G+V S  +VVR +     C SND PDDM LGM  +     + HS LFHQARPEDY +  +  +  ISFHK W   P+ +++K+L  + +    ++
Sbjct:   24 FHVRQAERRRAHLLQQAQSLTKKPPVVLLLHSLSDNDGDWSILPL-LP--EFSRSFVKNSSWLVFLEEETNIKMPAFVKVLSKFDKTKEWFVGKPLFDKESTIIHHYAFAENPSIFKYPDFAAAWALSMPLVVRLANKVRDE---PLKSDFTIDLKHEIALYIWDSGKGP-HLTAAPELCTEPEDSLNAQHCA---TTLSKGPTQCGEPVQKEDIFVAVKTCRKFHNERVPVIKRTWEKDAVLLEYYSDHADPSIPTINLGVPNTERGHCGKTFAILQRFLSSHVPN-TKWLLVVDDDTLISLPRLQALLSCYDPSEPVSLGERYGYGLSQG-GYSYITGGGGMVFSREAVVRLLDSGCKCYSNDAPDDMVLGMCFNALGLPVTHSPLFHQARPEDYPTDLLAHQVPISFHKHWNINPVAVFNKWLRDNATEKSSHE 448          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Medaka
Match: b3glctb (beta-1,3-glucosyltransferase [Source:NCBI gene;Acc:101167890])

HSP 1 Score: 236.498 bits (602), Expect = 3.023e-71
Identity = 148/382 (38.74%), Postives = 216/382 (56.54%), Query Frame = 1
Query:  286 ILPAI-RFYRNEIIKFKWIIFAQEETRLELKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFA---KPHSLLYPHREVGFILSINLCKLILEELDREFLAPEKYDTHIDPQYEMVKFIREKLISDFQMSNNSEFCLKSEPDEYCAVWITQFSYLPNCASMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRR-ISKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLNHSN 1416
            ILPA+ R +        W  F  EET + L  L  +LS     +   LG  L D   SIIHH+A    P S  YP    G+ +S+ LC+ + E +  E L   K D  ID  +E+  +I E   +  +++   EFC  ++P + CA   T  +YLP+C   + +S+  VAVKTC+KF   R+  +K+TW      + Y+++V D  +PTVS GV NT+ GHC K  +I+          +  +L+IVDDDTL+S+ RLR+LL CY  +E ++LGERY +    G GY Y TGG+G+VLS + V R +S    C S+D PDDM LG         ++H+ LFHQA+PEDYA +    + +ISFHK W T P+ +Y ++L+ ++
Sbjct:  106 ILPALPRLFAAYGRSASWFFFMAEETAVILSALLVVLSRYPVQEEWFLGKRLHDNKASIIHHYAFSEDPASFGYPDPAAGWAVSVPLCQRLSERVQHENL---KSDFTIDLPHEIALYIWEGG-NGPELTAVPEFC--TQPSDNCATTFT--TYLPDCGPPVSKSKVFVAVKTCEKFQSERVPVVKATWEKSAGLLEYYSDVIDASIPTVSLGVPNTDRGHCGKTFAIVRRFWSQAA-TKADWLLIVDDDTLISLTRLRRLLRCYDPEEAVSLGERYGFGLMQG-GYSYTTGGAGMVLSRTAVSRLLSSGCGCYSDDAPDDMVLGRCFTFLRVPIIHNPLFHQAQPEDYAEELSSLKHAISFHKHWNTDPVTIYRQWLHDTD 477          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Medaka
Match: ENSORLT00000009400.2 (glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-B-like [Source:NCBI gene;Acc:101170759])

HSP 1 Score: 55.0694 bits (131), Expect = 9.280e-8
Identity = 49/209 (23.44%), Postives = 84/209 (40.19%), Query Frame = 1
Query:  754 MIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGH-------CSKLKSILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRIS---KLTFCNSNDWPDDMTLGMWLDDAN------QSLLHSHLFHQARPEDYASQRI 1332
            +  +   L  V T  +   SR   +++TW+     +++ + V D   PTV    L+T+ G              +      D  W      +  DDDT + V  LR +L  +  DE +  G+R+   +  G    Y++GG+G VLS   ++R     +   C      +D+ LG  L+         +  LH   FH   PE + + + 
Sbjct:   81 LFQKVRVLCWVMTGPENLESRARHVRATWSRHCNIVVFMSSVGDPDFPTVG---LDTKEGRDQLYWKTIRAFHYVYEHHGSDADW-----FLKADDDTYVVVDNLRWILSNHTPDEPVYFGKRFKPYTKQG----YMSGGAGYVLSKEALKRFVEGFRTGTCTHTTPVEDLALGQCLEKMGVIAGDSRDTLHRETFHPFVPEHHLTTKF 277          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Medaka
Match: ENSORLT00000027014.1 (glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-B [Source:NCBI gene;Acc:101156399])

HSP 1 Score: 51.2174 bits (121), Expect = 1.467e-6
Identity = 48/205 (23.41%), Postives = 82/205 (40.00%), Query Frame = 1
Query:  751 SMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCS-KLKSILTM-IAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRIS---KLTFCNSNDWPDDMTLGMWLDDAN------QSLLHSHLFHQARPEDYASQRI 1332
            ++  +   L  V T       +   +K TW+     +++ + V D   PTV    L T+ G      K+I     A +    E  + +  DDDT + V  LR +L  Y   + I  G R+   +  G    Y++GG+G VLS   +RR     +   C      +D+ +G  ++         +   H   FH   PE + + + 
Sbjct:   80 ALYKKVRILCWVMTGPNNLEKKARHVKYTWSRHCNIVIFMSSVDDPDFPTVG---LGTKEGRDQLYWKTIRAFHYAYEHHAEEADWFLKADDDTYVIVDNLRWILANYTAQDPIYFGRRFKPYAKQG----YMSGGAGYVLSREALRRFVEGFQSKVCTHTTSVEDLAMGQCMEKVGVKAGDSRDSAHRETFHPFVPESHLTGKF 277          
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Medaka
Match: ENSORLT00000002043.2 (glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-B [Source:NCBI gene;Acc:101156399])

HSP 1 Score: 50.8322 bits (120), Expect = 2.050e-6
Identity = 48/205 (23.41%), Postives = 82/205 (40.00%), Query Frame = 1
Query:  751 SMIDQSEFLVAVKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCS-KLKSILTM-IAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRIS---KLTFCNSNDWPDDMTLGMWLDDAN------QSLLHSHLFHQARPEDYASQRI 1332
            ++  +   L  V T       +   +K TW+     +++ + V D   PTV    L T+ G      K+I     A +    E  + +  DDDT + V  LR +L  Y   + I  G R+   +  G    Y++GG+G VLS   +RR     +   C      +D+ +G  ++         +   H   FH   PE + + + 
Sbjct:   80 ALYKKVRILCWVMTGPNNLEKKARHVKYTWSRHCNIVIFMSSVDDPDFPTVG---LGTKEGRDQLYWKTIRAFHYAYEHHAEEADWFLKADDDTYVIVDNLRWILANYTAQDPIYFGRRFKPYAKQG----YMSGGAGYVLSREALRRFVEGFQSKVCTHTTSVEDLAMGQCMEKVGVKAGDSRDSAHRETFHPFVPESHLTGKF 277          
BLAST of Beta-1,3-glucosyltransferase vs. Planmine SMEST
Match: SMESG000009947.1 (SMESG000009947.1)

HSP 1 Score: 379.407 bits (973), Expect = 5.271e-131
Identity = 179/179 (100.00%), Postives = 179/179 (100.00%), Query Frame = 1
Query:  964 MIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRISKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLNHSNSHTQKYQPHSESDYHDEEIYEHNGREEL 1500
            MIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRISKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLNHSNSHTQKYQPHSESDYHDEEIYEHNGREEL
Sbjct:    1 MIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRISKLTFCNSNDWPDDMTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPLELYHKYLNHSNSHTQKYQPHSESDYHDEEIYEHNGREEL 179          
BLAST of Beta-1,3-glucosyltransferase vs. Planmine SMEST
Match: SMESG000061842.1 (SMESG000061842.1)

HSP 1 Score: 53.1434 bits (126), Expect = 2.508e-7
Identity = 38/162 (23.46%), Postives = 73/162 (45.06%), Query Frame = 1
Query:  820 VTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETGHCSKLKSILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEHIALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVR-----RISKLTFC-NSNDWPDDMTLGMWLDDANQSLLHSH 1287
            + IK++W    +  ++ +   +  +P+++  V         K K +   I  D K N+  F V +DDD+ + +  LR+ L  +  ++ I  G R+       +   Y++GG+G VLS + V+      I +   C +  +  +D+ LG  L   N   + S 
Sbjct:   83 IAIKNSWARRCDEYIFISNEKNSFLPSININVKEGRQYLWQKTKRMFRYIY-DNKLNQFDFFVKIDDDSFVIIENLREFLKQFNSEKLIYTGRRFK----LENQQSYMSGGAGYVLSRAAVKLLVEFGIGRHRACVHEMEESEDVNLGKCLQGLNVEFIDSR 239          
The following BLAST results are available for this feature:
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
B3GLCT2.468e-6736.53beta 3-glucosyltransferase [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ZC250.22.842e-5433.88Glycoprotein-N-acetylgalactosamine 3-beta-galactos... [more]
C02H6.11.795e-726.74Glycoprotein-N-acetylgalactosamine 3-beta-galactos... [more]
C16D9.68.864e-724.89Glycoprotein-N-acetylgalactosamine 3-beta-galactos... [more]
back to top
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG91097.320e-6232.91gene:FBgn0031765 transcript:FBtr0079224[more]
CG91091.073e-5832.03gene:FBgn0031765 transcript:FBtr0343131[more]
CG340561.169e-1126.40gene:FBgn0054056 transcript:FBtr0100833[more]
CG29758.839e-1024.68gene:FBgn0031468 transcript:FBtr0077619[more]
tgy2.309e-827.27gene:FBgn0030984 transcript:FBtr0290275[more]
back to top
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
b3glctb2.204e-7938.81beta 3-glucosyltransferase b [Source:ZFIN;Acc:ZDB-... [more]
b3glctb2.530e-7938.81beta 3-glucosyltransferase b [Source:ZFIN;Acc:ZDB-... [more]
b3glctb1.792e-7838.56beta 3-glucosyltransferase b [Source:ZFIN;Acc:ZDB-... [more]
b3glctb4.133e-7838.56beta 3-glucosyltransferase b [Source:ZFIN;Acc:ZDB-... [more]
b3glcta8.032e-6936.22beta 3-glucosyltransferase a [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fam131a4.905e-7735.27family with sequence similarity 131 member A [Sour... [more]
fam131a5.802e-7735.27family with sequence similarity 131 member A [Sour... [more]
fam131a1.352e-7635.27family with sequence similarity 131 member A [Sour... [more]
fam131a1.576e-7635.27family with sequence similarity 131 member A [Sour... [more]
fam131a8.027e-6934.57family with sequence similarity 131 member A [Sour... [more]
back to top
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
B3glct2.258e-6739.73beta-3-glucosyltransferase [Source:MGI Symbol;Acc:... [more]
C1galt16.829e-724.14core 1 synthase, glycoprotein-N-acetylgalactosamin... [more]
back to top
BLAST of Beta-1,3-glucosyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6Y288|B3GLT_HUMAN1.185e-6636.53Beta-1,3-glucosyltransferase OS=Homo sapiens OX=96... [more]
sp|Q8BHT6|B3GLT_MOUSE1.580e-6639.73Beta-1,3-glucosyltransferase OS=Mus musculus OX=10... [more]
sp|Q08BL3|C1GTA_DANRE9.713e-825.00Glycoprotein-N-acetylgalactosamine 3-beta-galactos... [more]
sp|P79948|LFNG_XENLA8.786e-726.11Beta-1,3-N-acetylglucosaminyltransferase lunatic f... [more]
sp|Q9JJ06|C1GLT_MOUSE4.777e-624.14Glycoprotein-N-acetylgalactosamine 3-beta-galactos... [more]
back to top
BLAST of Beta-1,3-glucosyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4D5RJX81.877e-8639.68Putative beta-13-glucosyltransferase OS=Ixodes sca... [more]
V5H8F61.958e-8639.68Putative beta-13-glucosyltransferase OS=Ixodes ric... [more]
A0A1S3HB914.283e-8340.00beta-1,3-glucosyltransferase isoform X1 OS=Lingula... [more]
A0A0B7A1F64.413e-8238.21Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
V5IER34.753e-8240.99Putative beta 13-galactosyltransferase-like b (Fra... [more]
back to top
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
b3glctb2.686e-7837.68beta 3-glucosyltransferase b [Source:ZFIN;Acc:ZDB-... [more]
b3glcta3.543e-6735.60beta 3-glucosyltransferase [Source:NCBI gene;Acc:1... [more]
b3glcta5.432e-6735.60beta 3-glucosyltransferase [Source:NCBI gene;Acc:1... [more]
b3glcta7.909e-6738.48beta 3-glucosyltransferase [Source:NCBI gene;Acc:1... [more]
c1galt1a4.177e-924.62glycoprotein-N-acetylgalactosamine 3-beta-galactos... [more]
back to top
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000004592.12.885e-2545.60pep scaffold:Pmarinus_7.0:GL478389:36397:42648:-1 ... [more]
ENSPMAT00000006954.12.863e-724.00pep scaffold:Pmarinus_7.0:GL487056:3020:4063:-1 ge... [more]
back to top
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO413592.991e-7135.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Beta-1,3-glucosyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
b3glcta1.453e-7135.01beta-1,3-glucosyltransferase [Source:NCBI gene;Acc... [more]
b3glctb3.023e-7138.74beta-1,3-glucosyltransferase [Source:NCBI gene;Acc... [more]
ENSORLT00000009400.29.280e-823.44glycoprotein-N-acetylgalactosamine 3-beta-galactos... [more]
ENSORLT00000027014.11.467e-623.41glycoprotein-N-acetylgalactosamine 3-beta-galactos... [more]
ENSORLT00000002043.22.050e-623.41glycoprotein-N-acetylgalactosamine 3-beta-galactos... [more]
back to top
BLAST of Beta-1,3-glucosyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000009947.15.271e-131100.00SMESG000009947.1[more]
SMESG000061842.12.508e-723.46SMESG000061842.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032370 ID=SMED30032370|Name=Beta-1,3-glucosyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1633bp
AAATGACCTTAATAACTGTTTTGTTTTAAAACTATGTTAAATATCTCAAA
CAATCTTATTATTTCTCTAAATTTCCTCGTTATTTTTATTGCATTTACCA
AATGCACGGAACATGACATAAATGGCAACGATGTAGTAGTTTTAGTTAAT
GTGCAACCAAATTCTGTATATCACAACACTCGATTTAGTCTTTTTAAGAG
ACACTTAGTCAGCCAATTACCAACCAATCAACCTCCAAAGCTAATTTATT
CTGAAAATGACACGACATCGGTTCTATTTCACTTGATTTTACCGGCAATT
CGATTTTACCGCAATGAAATCATAAAGTTTAAATGGATAATTTTTGCTCA
AGAAGAAACAAGACTGGAATTGAAGCAACTTTATCACATGTTGTCGGAAG
TTGATTATGATCAGCCTAATCTTCTTGGATATGCTTTGAGAGATTTCGAT
AGATCAATTATTCATCACTTTGCGAAACCGCATTCTCTTCTTTATCCTCA
TCGGGAAGTTGGATTTATCTTATCTATTAATCTTTGCAAATTAATATTGG
AAGAGCTCGATCGAGAGTTTCTAGCGCCTGAGAAATATGATACACATATT
GATCCGCAATATGAAATGGTGAAATTTATTCGGGAGAAATTAATTTCTGA
TTTCCAAATGTCGAATAACAGCGAATTCTGTCTGAAAAGTGAACCGGACG
AGTATTGTGCTGTGTGGATTACTCAGTTCTCCTATCTACCAAATTGTGCA
TCCATGATTGATCAGTCCGAGTTTTTGGTTGCCGTCAAAACTTGCAAAAA
GTTTTTTCGATCTCGAATAGTGACAATCAAAAGCACATGGACTCCTGATG
TGGAAAACATTTTATATTTCGCTGAAGTTGCCGATAGAAAGGTTCCAACG
GTTTCCACTGGAGTGCTGAATACAGAAACCGGACATTGCTCCAAACTGAA
GAGCATATTAACAATGATTGCTGAGGACCCAAAGTGGAATGAAGTCAAAT
TCTTGGTTATTGTCGATGATGACACCTTGCTAAGCGTTCCGCGCCTGAGG
CAGTTACTATATTGCTATCGGATGGATGAGCACATAGCGCTAGGAGAACG
ATACGCATACATGTCATGGTTTGGATCTGGATATGACTACCTCACTGGTG
GCAGTGGAATCGTGTTATCCATGTCTGTCGTTAGGAGAATCTCTAAGCTC
ACATTCTGCAACAGCAACGATTGGCCGGACGACATGACATTGGGAATGTG
GCTAGATGACGCCAATCAATCGCTTCTTCACAGCCATTTGTTCCACCAGG
CCCGCCCGGAAGATTATGCATCTCAGCGCATTGATACTGAAAAATCTATT
TCGTTCCATAAGTTCTGGGAAACGAAACCACTGGAACTCTATCATAAGTA
CCTTAATCATTCTAATAGTCACACGCAGAAATATCAGCCCCATTCCGAGT
CGGATTATCACGATGAGGAAATATACGAGCACAACGGCAGGGAGGAATTG
TGAAATCCATTTTGTGTGTTTAGGAACTTTTATTTTGTTTGTTTTATCGA
TTTGTGTTTCACTGTGATAATGTGATTGTTGTTGTAATTTTACGCATTTA
TTTGATTGGTTAATAAAATTTATATGAATTGAA
back to top

protein sequence of SMED30032370-orf-1

>SMED30032370-orf-1 ID=SMED30032370-orf-1|Name=SMED30032370-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=490bp
MLNISNNLIISLNFLVIFIAFTKCTEHDINGNDVVVLVNVQPNSVYHNTR
FSLFKRHLVSQLPTNQPPKLIYSENDTTSVLFHLILPAIRFYRNEIIKFK
WIIFAQEETRLELKQLYHMLSEVDYDQPNLLGYALRDFDRSIIHHFAKPH
SLLYPHREVGFILSINLCKLILEELDREFLAPEKYDTHIDPQYEMVKFIR
EKLISDFQMSNNSEFCLKSEPDEYCAVWITQFSYLPNCASMIDQSEFLVA
VKTCKKFFRSRIVTIKSTWTPDVENILYFAEVADRKVPTVSTGVLNTETG
HCSKLKSILTMIAEDPKWNEVKFLVIVDDDTLLSVPRLRQLLYCYRMDEH
IALGERYAYMSWFGSGYDYLTGGSGIVLSMSVVRRISKLTFCNSNDWPDD
MTLGMWLDDANQSLLHSHLFHQARPEDYASQRIDTEKSISFHKFWETKPL
ELYHKYLNHSNSHTQKYQPHSESDYHDEEIYEHNGREEL*
back to top

protein sequence of SMED30032370-orf-2

>SMED30032370-orf-2 ID=SMED30032370-orf-2|Name=SMED30032370-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=127bp
SIHINFINQSNKCVKLQQQSHYHSETQIDKTNKIKVPKHTKWISQFLPAV
VLVYFLIVIIRLGMGLIFLRVTIRMIKVLMIEFQWFRFPELMERNRFFSI
NALRCIIFRAGLVEQMAVKKRLIGVI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000036eye
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR003378Fringe-like
Vocabulary: molecular function
TermDefinition
GO:0016757transferase activity, transferring glycosyl groups
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003378Fringe-likePFAMPF02434Fringecoord: 2..148
e-value: 5.4E-26
score: 91.6
NoneNo IPR availableGENE3DG3DSA:3.90.550.50coord: 2..177
e-value: 1.9E-13
score: 52.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 164..190
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 170..190
NoneNo IPR availablePANTHERPTHR10811FRINGE-RELATEDcoord: 21..171
NoneNo IPR availablePANTHERPTHR10811:SF59BETA-1,3-GLUCOSYLTRANSFERASEcoord: 21..171