C2 domain-containing protein

Overview
NameC2 domain-containing protein
Smed IDSMED30032368
Length (bp)2538
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of C2 domain-containing protein (SMED30032368) t-SNE clustered cells

Violin plots show distribution of expression levels for C2 domain-containing protein (SMED30032368) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of C2 domain-containing protein (SMED30032368) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for C2 domain-containing protein (SMED30032368) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032368

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30032368SMESG000059632.1 dd_Smed_v4_6358_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30032368SMESG000059632.1 dd_Smed_v4_6358_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30032368SMESG000059632.1 dd_Smed_v4_6358_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30032368SMESG000059632.1 dd_Smed_v6_6358_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30032368SMESG000059632.1 SMED30032368smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of C2 domain-containing protein vs. Ensembl Fly
Match: CG10737 (gene:FBgn0034420 transcript:FBtr0290317)

HSP 1 Score: 53.1434 bits (126), Expect = 1.106e-6
Identity = 29/98 (29.59%), Postives = 53/98 (54.08%), Query Frame = 2
Query: 1079 GRTLVVGLIKVVEVQELKNPLKNGYCVLELDEPYQRHVSHLISLTDYPIWNQHFIFSLNSNSQRLTVELF-HASKKCQNPFSLGVSIIPISLIIVDPS 1369
            GR L+V ++K   +++ +NP    Y V+E+DEP Q++ +        P W++HF+F L+  S  +  E++ H       P  LG+ ++ I  + V P+
Sbjct:  378 GRRLLVKIVKGDGIRDAQNP----YVVIEMDEPAQKNQTG-TQRGGKPFWDEHFLFELSPQSAEILFEVYDHPVIASDPPKFLGLGLVGIDELAVGPA 470          
BLAST of C2 domain-containing protein vs. Ensembl Fly
Match: CG10737 (gene:FBgn0034420 transcript:FBtr0100282)

HSP 1 Score: 53.1434 bits (126), Expect = 1.129e-6
Identity = 29/98 (29.59%), Postives = 53/98 (54.08%), Query Frame = 2
Query: 1079 GRTLVVGLIKVVEVQELKNPLKNGYCVLELDEPYQRHVSHLISLTDYPIWNQHFIFSLNSNSQRLTVELF-HASKKCQNPFSLGVSIIPISLIIVDPS 1369
            GR L+V ++K   +++ +NP    Y V+E+DEP Q++ +        P W++HF+F L+  S  +  E++ H       P  LG+ ++ I  + V P+
Sbjct:  357 GRRLLVKIVKGDGIRDAQNP----YVVIEMDEPAQKNQTG-TQRGGKPFWDEHFLFELSPQSAEILFEVYDHPVIASDPPKFLGLGLVGIDELAVGPA 449          
BLAST of C2 domain-containing protein vs. Ensembl Fly
Match: CG10737 (gene:FBgn0034420 transcript:FBtr0290314)

HSP 1 Score: 53.1434 bits (126), Expect = 1.165e-6
Identity = 29/98 (29.59%), Postives = 53/98 (54.08%), Query Frame = 2
Query: 1079 GRTLVVGLIKVVEVQELKNPLKNGYCVLELDEPYQRHVSHLISLTDYPIWNQHFIFSLNSNSQRLTVELF-HASKKCQNPFSLGVSIIPISLIIVDPS 1369
            GR L+V ++K   +++ +NP    Y V+E+DEP Q++ +        P W++HF+F L+  S  +  E++ H       P  LG+ ++ I  + V P+
Sbjct:  357 GRRLLVKIVKGDGIRDAQNP----YVVIEMDEPAQKNQTG-TQRGGKPFWDEHFLFELSPQSAEILFEVYDHPVIASDPPKFLGLGLVGIDELAVGPA 449          
BLAST of C2 domain-containing protein vs. Ensembl Fly
Match: CG10737 (gene:FBgn0034420 transcript:FBtr0340453)

HSP 1 Score: 53.1434 bits (126), Expect = 1.179e-6
Identity = 29/98 (29.59%), Postives = 53/98 (54.08%), Query Frame = 2
Query: 1079 GRTLVVGLIKVVEVQELKNPLKNGYCVLELDEPYQRHVSHLISLTDYPIWNQHFIFSLNSNSQRLTVELF-HASKKCQNPFSLGVSIIPISLIIVDPS 1369
            GR L+V ++K   +++ +NP    Y V+E+DEP Q++ +        P W++HF+F L+  S  +  E++ H       P  LG+ ++ I  + V P+
Sbjct:  378 GRRLLVKIVKGDGIRDAQNP----YVVIEMDEPAQKNQTG-TQRGGKPFWDEHFLFELSPQSAEILFEVYDHPVIASDPPKFLGLGLVGIDELAVGPA 470          
BLAST of C2 domain-containing protein vs. Ensembl Fly
Match: CG10737 (gene:FBgn0034420 transcript:FBtr0086585)

HSP 1 Score: 53.1434 bits (126), Expect = 1.214e-6
Identity = 29/98 (29.59%), Postives = 53/98 (54.08%), Query Frame = 2
Query: 1079 GRTLVVGLIKVVEVQELKNPLKNGYCVLELDEPYQRHVSHLISLTDYPIWNQHFIFSLNSNSQRLTVELF-HASKKCQNPFSLGVSIIPISLIIVDPS 1369
            GR L+V ++K   +++ +NP    Y V+E+DEP Q++ +        P W++HF+F L+  S  +  E++ H       P  LG+ ++ I  + V P+
Sbjct:  378 GRRLLVKIVKGDGIRDAQNP----YVVIEMDEPAQKNQTG-TQRGGKPFWDEHFLFELSPQSAEILFEVYDHPVIASDPPKFLGLGLVGIDELAVGPA 470          
BLAST of C2 domain-containing protein vs. TrEMBL
Match: A0A3P6GCE5 (C2 domain-containing protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS2810 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.120e-13
Identity = 39/87 (44.83%), Postives = 59/87 (67.82%), Query Frame = 2
Query: 1043 SPFHDRVSSKLIGRTLVVGLIKVVEVQELKNPLKNGYCVLELDEPYQRHVSHLISLTDYPIWNQHFIFSLNSNSQRLTVELFHASKK 1303
            SP H+RV+  L  + L+V ++K  +  +L+N   + YCV+ELDEPYQRH +H++  ++   W+QH +F LNSNS+R   E+F  SKK
Sbjct:  163 SPLHERVAPNLASKNLLVKVVKA-DFIDLRNS-SDAYCVVELDEPYQRHATHVVPSSEQLFWDQHLLFGLNSNSKRAAFEVFELSKK 247          
BLAST of C2 domain-containing protein vs. TrEMBL
Match: A0A5K3FPU9 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.783e-13
Identity = 39/87 (44.83%), Postives = 59/87 (67.82%), Query Frame = 2
Query: 1043 SPFHDRVSSKLIGRTLVVGLIKVVEVQELKNPLKNGYCVLELDEPYQRHVSHLISLTDYPIWNQHFIFSLNSNSQRLTVELFHASKK 1303
            SP H+RV+  L  + L+V ++K  +  +L+N   + YCV+ELDEPYQRH +H++  ++   W+QH +F LNSNS+R   E+F  SKK
Sbjct:  429 SPLHERVAPNLASKNLLVKVVKA-DFIDLRNS-SDAYCVVELDEPYQRHATHVVPSSEQLFWDQHLLFGLNSNSKRAAFEVFELSKK 513          
BLAST of C2 domain-containing protein vs. TrEMBL
Match: A0A5K3FMN9 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.854e-13
Identity = 39/87 (44.83%), Postives = 59/87 (67.82%), Query Frame = 2
Query: 1043 SPFHDRVSSKLIGRTLVVGLIKVVEVQELKNPLKNGYCVLELDEPYQRHVSHLISLTDYPIWNQHFIFSLNSNSQRLTVELFHASKK 1303
            SP H+RV+  L  + L+V ++K  +  +L+N   + YCV+ELDEPYQRH +H++  ++   W+QH +F LNSNS+R   E+F  SKK
Sbjct:  429 SPLHERVAPNLASKNLLVKVVKA-DFIDLRNS-SDAYCVVELDEPYQRHATHVVPSSEQLFWDQHLLFGLNSNSKRAAFEVFELSKK 513          
BLAST of C2 domain-containing protein vs. TrEMBL
Match: W6V6F4 (C2 domain-containing protein OS=Echinococcus granulosus OX=6210 GN=EGR_03222 PE=4 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.909e-13
Identity = 39/87 (44.83%), Postives = 60/87 (68.97%), Query Frame = 2
Query: 1043 SPFHDRVSSKLIGRTLVVGLIKVVEVQELKNPLKNGYCVLELDEPYQRHVSHLISLTDYPIWNQHFIFSLNSNSQRLTVELFHASKK 1303
            SP H+RV+  L  + L+V ++K  +  +LK+   + YCV+ELDEPYQRH +H++  ++   W+QH +F LNSNS+R T E+F  SK+
Sbjct:  326 SPLHERVTPNLASKNLLVKVVKA-DFIDLKSS-SDAYCVVELDEPYQRHATHVVPPSEQLFWDQHLLFGLNSNSKRATFEVFELSKR 410          
BLAST of C2 domain-containing protein vs. TrEMBL
Match: A0A068WCL7 (C2 calcium lipid binding region CaLB OS=Echinococcus granulosus OX=6210 GN=EgrG_001056800 PE=4 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.109e-13
Identity = 39/87 (44.83%), Postives = 60/87 (68.97%), Query Frame = 2
Query: 1043 SPFHDRVSSKLIGRTLVVGLIKVVEVQELKNPLKNGYCVLELDEPYQRHVSHLISLTDYPIWNQHFIFSLNSNSQRLTVELFHASKK 1303
            SP H+RV+  L  + L+V ++K  +  +LK+   + YCV+ELDEPYQRH +H++  ++   W+QH +F LNSNS+R T E+F  SK+
Sbjct:  418 SPLHERVTPNLASKNLLVKVVKA-DFIDLKSS-SDAYCVVELDEPYQRHATHVVPPSEQLFWDQHLLFGLNSNSKRATFEVFELSKR 502          
BLAST of C2 domain-containing protein vs. Ensembl Cavefish
Match: c2cd2 (C2 calcium dependent domain containing 2 [Source:NCBI gene;Acc:103037452])

HSP 1 Score: 53.5286 bits (127), Expect = 8.658e-7
Identity = 28/82 (34.15%), Postives = 46/82 (56.10%), Query Frame = 2
Query: 1154 CVLELDEPYQRHVSHLISLTDYPIWNQHFIFSLNSNSQRLTVELFHASKKCQNPFSLGVSIIPISLIIVDP-SENYFPINNN 1396
            CVL LD+P QR  S ++S T  P W+Q FIF L+  S+ L ++L    +  ++   LG   +P +L++  P  +  F + N+
Sbjct:  275 CVLRLDDPPQRLTSSVLSNTHNPAWDQPFIFELSGRSKELNIQLLDNGRAPESCL-LGQVCVPFNLVMRHPRGQQTFTLMND 355          
BLAST of C2 domain-containing protein vs. Ensembl Cavefish
Match: c2cd2 (C2 calcium dependent domain containing 2 [Source:NCBI gene;Acc:103037452])

HSP 1 Score: 53.1434 bits (126), Expect = 1.053e-6
Identity = 28/82 (34.15%), Postives = 46/82 (56.10%), Query Frame = 2
Query: 1154 CVLELDEPYQRHVSHLISLTDYPIWNQHFIFSLNSNSQRLTVELFHASKKCQNPFSLGVSIIPISLIIVDP-SENYFPINNN 1396
            CVL LD+P QR  S ++S T  P W+Q FIF L+  S+ L ++L    +  ++   LG   +P +L++  P  +  F + N+
Sbjct:  275 CVLRLDDPPQRLTSSVLSNTHNPAWDQPFIFELSGRSKELNIQLLDNGRAPESCL-LGQVCVPFNLVMRHPRGQQTFTLMND 355          
BLAST of C2 domain-containing protein vs. Ensembl Medaka
Match: c2cd2 (C2 calcium dependent domain containing 2 [Source:NCBI gene;Acc:101175427])

HSP 1 Score: 53.5286 bits (127), Expect = 7.903e-7
Identity = 37/121 (30.58%), Postives = 57/121 (47.11%), Query Frame = 2
Query: 1019 DCYEPGEESPFHDRVSS-KLIGRTLVVGLIKVVEVQELKNPLKNGYCVLELDEPYQRHVSHLISLTDYPIWNQHFIFSLNSNSQRLTVELFHASKKCQNPFSLGVSIIPISLIIVDPSENY 1378
            D  E G   P   R    KL+ + + V L +  +     NPL    CVL LDEP Q+  + ++  T  P W+Q F+F LN  S+ L V++ +     Q+   LG + +P  L+   P   +
Sbjct:  239 DTCEKGVSPPKPPRAHDWKLLVKNIRVTLNQEDDAAGSMNPL----CVLWLDEPLQKFSTSVLKSTASPAWDQPFVFELNGRSKELNVQVMNDGMPQQDSL-LGQASVPFDLVKKQPKGQH 354          
BLAST of C2 domain-containing protein vs. Planmine SMEST
Match: SMESG000059632.1 (SMESG000059632.1)

HSP 1 Score: 1387.47 bits (3590), Expect = 0.000e+0
Identity = 705/713 (98.88%), Postives = 705/713 (98.88%), Query Frame = 2
Query:   20 MYNLENLLVQYATFNWQNLFIDXXXXXXXXXXXXXXXXXXXXTRWILDSKSLITLSSTYTQTDICYPEFKESKSKITESGDVLLESILNHKFTRNHIFNSWIINFNEFKFSQIISKNCRIEEFNENYSDPFKISQIRIIENKELITFTFRMKCARLFLVLQLMYEEKRIRQAHLDMTDIELSALVMIRFTENGLLLKLFPDCVCDMSCELIVDGISDSEREMSLAEFKRDFKLIMMQTLEMEWKSSPSQDNEASESDRQYQLGGSPINDAASGDIETSRSVSMEIAESVDENRVLLEMADCDNSKSEISGGHVVDVHGKEMMSHISLFTMDSNDCYEPGEESPFHDRVSSKLIGRTLVVGLIKVVEVQELKNPLKNGYCVLELDEPYQRHVSHLISLTDYPIWNQHFIFSLNSNSQRLTVELFHASKKCQNPFSLGVSIIPISLIIVDPSENYFPINNNQIGSRKSWRCDVIPGAADSKIPAFLIEFQIMRNVHDLTKPAVDPPSDISSNTSGPSLQLEKIVKTSDKFELNPENGGILSHNCHKMQTIPEAQTPDNTLTKIRSAEENKIFLREKTNNENGRSKSVIRRIRHRFSRLSVPWISEKSKSDDCLDQIADENETQIAHNSEVPVQPPAELFITNSNNKPKFFSKISDVDLRNSRSLSISLKKVFNIPSKKQSDKYKEKSLEQLFKDMDPKLFDTISNEGFNRIMNSK 2158
            MYNLENLLVQYATFNWQNLFIDLNSNLSFLFILCFIFVLIFITRWILDSKSLITLSSTYTQTDICYPEFKESKSKITESGDVLLESILNHKFTRNHIFNSWIINFNEFKFSQIISKNCRIEEFNENYSDPFKISQIRIIENKELITFTFRMKCARLFLVLQLMYEEKRIRQAHLDMTDIELSALVMIRFTENGLLLKLFPDCVCDMSCELIVDGISDSEREMSLAEFKRDFKLIMMQTLEMEWKSSPSQDNEASESDRQYQLGGSPINDAASGDIETSRSVSMEIAESVDENRVLLEMADCDNSKSEIS GHVVDVHGKEMMSHISLFTMDSNDCYEPGEESPFHDRVSSKLIGRTLVVGLIKVVEVQELKNPLKNGYCVLELDEPYQRHVSHLISLTDYPIWNQHFIFSLNSNSQRLTVELFHASKKCQNPFSLGVSIIPISLIIVDPSENYFPINNNQIGSRKSWRCDVIPGAADSKIPAFLIEFQIMRNVHDLTKPAVDPPSDISSNTSGPSLQLEKIVKTSDKFELNPENG       HKMQTIPEAQTPDNTLTKIRSAEENKIFLREKTNNENGRSKSVIRRIRHRFSRLSVPWISEKSKSDDCLDQIADENETQIAHNSEVPVQPPAELFITNSNNKPKFFSKISDVDLRNSRSLSISLKKVFNIPSKKQSDKYKEKSLEQLFKDMDPKLFDTISNEGFNRIMNSK
Sbjct:    1 MYNLENLLVQYATFNWQNLFIDLNSNLSFLFILCFIFVLIFITRWILDSKSLITLSSTYTQTDICYPEFKESKSKITESGDVLLESILNHKFTRNHIFNSWIINFNEFKFSQIISKNCRIEEFNENYSDPFKISQIRIIENKELITFTFRMKCARLFLVLQLMYEEKRIRQAHLDMTDIELSALVMIRFTENGLLLKLFPDCVCDMSCELIVDGISDSEREMSLAEFKRDFKLIMMQTLEMEWKSSPSQDNEASESDRQYQLGGSPINDAASGDIETSRSVSMEIAESVDENRVLLEMADCDNSKSEISDGHVVDVHGKEMMSHISLFTMDSNDCYEPGEESPFHDRVSSKLIGRTLVVGLIKVVEVQELKNPLKNGYCVLELDEPYQRHVSHLISLTDYPIWNQHFIFSLNSNSQRLTVELFHASKKCQNPFSLGVSIIPISLIIVDPSENYFPINNNQIGSRKSWRCDVIPGAADSKIPAFLIEFQIMRNVHDLTKPAVDPPSDISSNTSGPSLQLEKIVKTSDKFELNPENG-------HKMQTIPEAQTPDNTLTKIRSAEENKIFLREKTNNENGRSKSVIRRIRHRFSRLSVPWISEKSKSDDCLDQIADENETQIAHNSEVPVQPPAELFITNSNNKPKFFSKISDVDLRNSRSLSISLKKVFNIPSKKQSDKYKEKSLEQLFKDMDPKLFDTISNEGFNRIMNSK 706          
BLAST of C2 domain-containing protein vs. Planmine SMEST
Match: SMESG000059632.1 (SMESG000059632.1)

HSP 1 Score: 1379.39 bits (3569), Expect = 0.000e+0
Identity = 703/713 (98.60%), Postives = 703/713 (98.60%), Query Frame = 2
Query:   20 MYNLENLLVQYATFNWQNLFIDXXXXXXXXXXXXXXXXXXXXTRWILDSKSLITLSSTYTQTDICYPEFKESKSKITESGDVLLESILNHKFTRNHIFNSWIINFNEFKFSQIISKNCRIEEFNENYSDPFKISQIRIIENKELITFTFRMKCARLFLVLQLMYEEKRIRQAHLDMTDIELSALVMIRFTENGLLLKLFPDCVCDMSCELIVDGISDSEREMSLAEFKRDFKLIMMQTLEMEWKSSPSQDNEASESDRQYQLGGSPINDAASGDIETSRSVSMEIAESVDENRVLLEMADCDNSKSEISGGHVVDVHGKEMMSHISLFTMDSNDCYEPGEESPFHDRVSSKLIGRTLVVGLIKVVEVQELKNPLKNGYCVLELDEPYQRHVSHLISLTDYPIWNQHFIFSLNSNSQRLTVELFHASKKCQNPFSLGVSIIPISLIIVDPSENYFPINNNQIGSRKSWRCDVIPGAADSKIPAFLIEFQIMRNVHDLTKPAVDPPSDISSNTSGPSLQLEKIVKTSDKFELNPENGGILSHNCHKMQTIPEAQTPDNTLTKIRSAEENKIFLREKTNNENGRSKSVIRRIRHRFSRLSVPWISEKSKSDDCLDQIADENETQIAHNSEVPVQPPAELFITNSNNKPKFFSKISDVDLRNSRSLSISLKKVFNIPSKKQSDKYKEKSLEQLFKDMDPKLFDTISNEGFNRIMNSK 2158
            MYNLENLLVQYATFNWQNLFIDLNSNLSFLFILCFIFVLIFITRWILDSKSLITLSSTYTQTDICYPEFKESKSKITESGDVLLESILNHKFTRNHIFNSWIINFNEFKFSQIISKNCRIEEFNENYSDPFKISQIRIIENKELITFTFRMKCARLFLVLQLMYEEKRIRQAHLDMTDIELSALVMIRFTENGLLLKLFPDCVCDMSCELIVDGISDSEREMSLAEFKRDFKLIMMQTLEMEWKSSPSQDNEASESDRQYQLGGSPINDAASGDIETSRSVSMEIAESVDENRVLLEMADCDNSKSE   GHVVDVHGKEMMSHISLFTMDSNDCYEPGEESPFHDRVSSKLIGRTLVVGLIKVVEVQELKNPLKNGYCVLELDEPYQRHVSHLISLTDYPIWNQHFIFSLNSNSQRLTVELFHASKKCQNPFSLGVSIIPISLIIVDPSENYFPINNNQIGSRKSWRCDVIPGAADSKIPAFLIEFQIMRNVHDLTKPAVDPPSDISSNTSGPSLQLEKIVKTSDKFELNPENG       HKMQTIPEAQTPDNTLTKIRSAEENKIFLREKTNNENGRSKSVIRRIRHRFSRLSVPWISEKSKSDDCLDQIADENETQIAHNSEVPVQPPAELFITNSNNKPKFFSKISDVDLRNSRSLSISLKKVFNIPSKKQSDKYKEKSLEQLFKDMDPKLFDTISNEGFNRIMNSK
Sbjct:    1 MYNLENLLVQYATFNWQNLFIDLNSNLSFLFILCFIFVLIFITRWILDSKSLITLSSTYTQTDICYPEFKESKSKITESGDVLLESILNHKFTRNHIFNSWIINFNEFKFSQIISKNCRIEEFNENYSDPFKISQIRIIENKELITFTFRMKCARLFLVLQLMYEEKRIRQAHLDMTDIELSALVMIRFTENGLLLKLFPDCVCDMSCELIVDGISDSEREMSLAEFKRDFKLIMMQTLEMEWKSSPSQDNEASESDRQYQLGGSPINDAASGDIETSRSVSMEIAESVDENRVLLEMADCDNSKSE--NGHVVDVHGKEMMSHISLFTMDSNDCYEPGEESPFHDRVSSKLIGRTLVVGLIKVVEVQELKNPLKNGYCVLELDEPYQRHVSHLISLTDYPIWNQHFIFSLNSNSQRLTVELFHASKKCQNPFSLGVSIIPISLIIVDPSENYFPINNNQIGSRKSWRCDVIPGAADSKIPAFLIEFQIMRNVHDLTKPAVDPPSDISSNTSGPSLQLEKIVKTSDKFELNPENG-------HKMQTIPEAQTPDNTLTKIRSAEENKIFLREKTNNENGRSKSVIRRIRHRFSRLSVPWISEKSKSDDCLDQIADENETQIAHNSEVPVQPPAELFITNSNNKPKFFSKISDVDLRNSRSLSISLKKVFNIPSKKQSDKYKEKSLEQLFKDMDPKLFDTISNEGFNRIMNSK 704          
The following BLAST results are available for this feature:
BLAST of C2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG107371.106e-629.59gene:FBgn0034420 transcript:FBtr0290317[more]
CG107371.129e-629.59gene:FBgn0034420 transcript:FBtr0100282[more]
CG107371.165e-629.59gene:FBgn0034420 transcript:FBtr0290314[more]
CG107371.179e-629.59gene:FBgn0034420 transcript:FBtr0340453[more]
CG107371.214e-629.59gene:FBgn0034420 transcript:FBtr0086585[more]
back to top
BLAST of C2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P6GCE51.120e-1344.83C2 domain-containing protein OS=Mesocestoides cort... [more]
A0A5K3FPU91.783e-1344.83Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3FMN91.854e-1344.83Uncharacterized protein OS=Mesocestoides corti OX=... [more]
W6V6F41.909e-1344.83C2 domain-containing protein OS=Echinococcus granu... [more]
A0A068WCL72.109e-1344.83C2 calcium lipid binding region CaLB OS=Echinococc... [more]
back to top
BLAST of C2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
c2cd28.658e-734.15C2 calcium dependent domain containing 2 [Source:N... [more]
c2cd21.053e-634.15C2 calcium dependent domain containing 2 [Source:N... [more]
back to top
BLAST of C2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
c2cd27.903e-730.58C2 calcium dependent domain containing 2 [Source:N... [more]
back to top
BLAST of C2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000059632.10.000e+098.88SMESG000059632.1[more]
SMESG000059632.10.000e+098.60SMESG000059632.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032368 ID=SMED30032368|Name=C2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2538bp
TTTGAAATGAATTTTAATTATGTATAATTTAGAAAATCTTCTTGTTCAAT
ATGCAACCTTCAACTGGCAAAATTTATTTATTGATCTGAATTCTAATCTA
TCTTTTTTATTCATTTTATGTTTTATTTTCGTATTAATTTTCATCACAAG
ATGGATATTAGATTCAAAATCGCTGATAACTTTATCTTCAACTTATACTC
AAACAGATATCTGTTATCCAGAATTCAAGGAATCCAAATCAAAAATTACT
GAATCTGGCGACGTTCTTTTAGAGTCAATATTAAATCACAAATTTACTCG
AAATCACATTTTCAATAGCTGGATCATTAATTTTAATGAATTTAAATTTT
CTCAAATTATTTCGAAAAATTGTCGAATTGAAGAATTTAATGAAAATTAT
TCTGATCCGTTCAAGATCTCACAAATTAGAATTATTGAAAATAAAGAACT
CATAACCTTCACATTCCGAATGAAGTGCGCAAGATTGTTTCTCGTCCTCC
AACTGATGTATGAAGAGAAACGGATTCGCCAGGCACATTTGGACATGACA
GATATCGAATTGTCAGCTCTCGTCATGATCAGGTTCACGGAAAACGGATT
GCTACTGAAATTGTTCCCGGATTGTGTTTGTGACATGAGCTGCGAGCTCA
TTGTTGATGGGATATCAGATAGTGAGCGAGAGATGAGCCTAGCGGAATTC
AAACGAGATTTCAAACTCATAATGATGCAGACTCTGGAAATGGAATGGAA
ATCGTCACCTTCTCAAGATAATGAAGCGAGTGAATCCGATCGTCAATATC
AACTGGGCGGTTCACCTATCAATGACGCAGCCAGTGGCGACATTGAGACC
AGTCGGTCTGTGTCTATGGAGATTGCTGAATCAGTTGATGAAAATCGAGT
TTTGCTTGAAATGGCCGATTGTGACAATTCAAAAAGTGAAATCTCAGGCG
GTCATGTAGTGGATGTTCATGGAAAAGAAATGATGAGTCATATTTCCCTG
TTTACGATGGACTCAAACGATTGTTATGAGCCAGGAGAAGAGTCGCCTTT
TCATGACAGGGTCTCAAGTAAGTTGATTGGGAGAACTCTCGTTGTGGGAC
TAATCAAGGTTGTAGAAGTGCAAGAACTGAAAAATCCCCTGAAAAACGGC
TACTGCGTATTGGAATTGGACGAACCTTATCAACGGCACGTTAGCCATTT
GATCTCTCTCACTGATTATCCTATTTGGAACCAGCATTTCATATTCTCTC
TCAATTCGAATTCACAACGATTGACTGTCGAATTGTTTCATGCATCAAAA
AAGTGCCAAAATCCATTTTCTTTGGGCGTTTCGATAATTCCGATAAGTCT
TATCATTGTTGATCCTTCGGAAAACTATTTCCCTATTAATAACAATCAAA
TTGGATCTAGGAAATCTTGGCGATGCGATGTGATTCCTGGTGCCGCCGAC
AGTAAGATACCGGCGTTTCTTATTGAATTTCAGATAATGAGAAATGTTCA
CGATCTTACCAAGCCAGCAGTTGATCCGCCTTCAGACATAAGCAGCAACA
CCAGTGGACCTTCGCTGCAGTTGGAAAAAATCGTCAAAACCTCTGACAAA
TTCGAACTGAATCCGGAAAATGGTGGGATTTTATCGCATAATTGTCACAA
GATGCAAACTATACCGGAAGCTCAAACTCCTGACAATACTCTTACAAAAA
TTCGCTCAGCCGAAGAAAATAAAATATTTCTACGAGAGAAAACAAACAAT
GAGAATGGAAGGTCAAAATCAGTAATTAGACGTATCCGACATCGGTTTTC
CCGGCTCTCTGTGCCATGGATAAGTGAAAAAAGCAAAAGTGACGATTGTC
TTGATCAAATCGCCGATGAAAACGAAACTCAAATCGCTCATAATTCTGAG
GTTCCTGTTCAGCCTCCTGCCGAATTGTTTATAACCAATTCAAATAACAA
GCCGAAATTCTTTTCAAAAATATCTGATGTTGATTTAAGGAATTCTCGTA
GCCTCAGTATCAGTTTGAAGAAAGTTTTTAATATTCCTTCGAAAAAACAA
AGTGACAAATATAAAGAAAAAAGTTTAGAACAGCTTTTCAAGGATATGGA
TCCGAAATTGTTCGACACGATTTCCAACGAGGGATTTAATCGTATAATGA
ATAGTAAATGAGTGGGGGTAAAATTTCATTGTGATAAATCATGTTTGATA
AATATATCGTGCGGACAAGCGATGTTGTCATTTATTTATTTTCTTTGGTT
CTTTTCAATAATAAGTTTCTGAATCAGTGGAAAGAGGCTAGAATTATTTT
GCTGACCATGGCAGTAGTGATGACTGGGTTGATTATGTTCTACTATTTAC
AATTGACCATGAAATATGAATGAATACCACAGTTGATGCACCATTTATAT
TTATCTCATCTATGTGGTATCCCCATAAAGTATCAGAATGAAACGCAATA
ACTATAATATTTTGAAGAAGTGATTATTTATCATTAGCCTACCATCTTAA
TCAGTGTCAAATACTATATTTTGATAACAATAATGACG
back to top

protein sequence of SMED30032368-orf-1

>SMED30032368-orf-1 ID=SMED30032368-orf-1|Name=SMED30032368-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=714bp
MYNLENLLVQYATFNWQNLFIDLNSNLSFLFILCFIFVLIFITRWILDSK
SLITLSSTYTQTDICYPEFKESKSKITESGDVLLESILNHKFTRNHIFNS
WIINFNEFKFSQIISKNCRIEEFNENYSDPFKISQIRIIENKELITFTFR
MKCARLFLVLQLMYEEKRIRQAHLDMTDIELSALVMIRFTENGLLLKLFP
DCVCDMSCELIVDGISDSEREMSLAEFKRDFKLIMMQTLEMEWKSSPSQD
NEASESDRQYQLGGSPINDAASGDIETSRSVSMEIAESVDENRVLLEMAD
CDNSKSEISGGHVVDVHGKEMMSHISLFTMDSNDCYEPGEESPFHDRVSS
KLIGRTLVVGLIKVVEVQELKNPLKNGYCVLELDEPYQRHVSHLISLTDY
PIWNQHFIFSLNSNSQRLTVELFHASKKCQNPFSLGVSIIPISLIIVDPS
ENYFPINNNQIGSRKSWRCDVIPGAADSKIPAFLIEFQIMRNVHDLTKPA
VDPPSDISSNTSGPSLQLEKIVKTSDKFELNPENGGILSHNCHKMQTIPE
AQTPDNTLTKIRSAEENKIFLREKTNNENGRSKSVIRRIRHRFSRLSVPW
ISEKSKSDDCLDQIADENETQIAHNSEVPVQPPAELFITNSNNKPKFFSK
ISDVDLRNSRSLSISLKKVFNIPSKKQSDKYKEKSLEQLFKDMDPKLFDT
ISNEGFNRIMNSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR039934C2CD2/C2CD2L
IPR000008C2_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000008C2 domainSMARTSM00239C2_3ccoord: 359..454
e-value: 1.3E-4
score: 31.4
IPR000008C2 domainPFAMPF00168C2coord: 362..444
e-value: 7.9E-6
score: 26.1
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 356..469
e-value: 2.3E-8
score: 35.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 244..268
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 362..459
NoneNo IPR availableTMHMMTMhelixcoord: 25..47
IPR039934C2 domain-containing protein 2-likePANTHERPTHR21119UNCHARACTERIZEDcoord: 361..456