SMED30032366

Overview
NameSMED30032366
Smed IDSMED30032366
Length (bp)385
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30032366 (SMED30032366) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30032366 (SMED30032366) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30032366 (SMED30032366) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30032366 (SMED30032366) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032366

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 42

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30032366SMESG000080004.1 SMESG000078886.1 SMESG000078780.1 SMESG000078276.1 SMESG000077377.1 SMESG000076900.1 SMESG000076091.1 SMESG000070563.1 SMESG000070487.1 SMESG000069936.1 SMESG000069843.1 SMESG000068687.1 SMESG000067323.1 SMESG000067128.1 SMESG000066411.1 SMESG000066333.1 SMESG000065178.1 SMESG000063482.1 SMESG000063430.1 SMESG000062535.1 SMESG000062279.1 SMESG000057533.1 SMESG000057427.1 SMESG000055265.1 SMESG000053372.1 SMESG000052056.1 SMESG000051183.1 SMESG000050587.1 SMESG000050353.1 SMESG000049398.1 SMESG000048922.1 SMESG000047988.1 SMESG000047874.1 SMESG000046659.1 SMESG000045843.1 SMESG000043782.1 SMESG000043425.1 SMESG000043019.1 SMESG000041242.1 SMESG000040236.1 SMESG000039783.1 SMESG000037212.1 SMESG000034701.1 SMESG000034367.1 SMESG000033592.1 SMESG000031778.1 SMESG000031308.1 SMESG000031049.1 SMESG000029226.1 SMESG000028811.1 SMESG000026530.1 SMESG000025956.1 SMESG000024909.1 SMESG000023833.1 SMESG000023573.1 SMESG000023546.1 SMESG000022236.1 SMESG000021499.1 SMESG000019820.1 SMESG000018414.1 SMESG000017989.1 SMESG000017936.1 SMESG000015191.1 SMESG000014475.1 SMESG000009011.1 SMESG000008656.1 SMESG000006220.1 SMESG000005037.1 SMESG000004638.1 SMESG000003422.1 Contig5461newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30032366SMESG000080004.1 SMESG000078886.1 SMESG000078780.1 SMESG000078276.1 SMESG000077377.1 SMESG000076900.1 SMESG000076091.1 SMESG000070563.1 SMESG000070487.1 SMESG000069936.1 SMESG000069843.1 SMESG000068687.1 SMESG000067323.1 SMESG000067128.1 SMESG000066411.1 SMESG000066333.1 SMESG000065178.1 SMESG000063482.1 SMESG000063430.1 SMESG000062535.1 SMESG000062279.1 SMESG000057533.1 SMESG000057427.1 SMESG000055265.1 SMESG000053372.1 SMESG000052056.1 SMESG000051183.1 SMESG000050587.1 SMESG000050353.1 SMESG000049398.1 SMESG000048922.1 SMESG000047988.1 SMESG000047874.1 SMESG000046659.1 SMESG000045843.1 SMESG000043782.1 SMESG000043425.1 SMESG000043019.1 SMESG000041242.1 SMESG000040236.1 SMESG000039783.1 SMESG000037212.1 SMESG000034701.1 SMESG000034367.1 SMESG000033592.1 SMESG000031778.1 SMESG000031308.1 SMESG000031049.1 SMESG000029226.1 SMESG000028811.1 SMESG000026530.1 SMESG000025956.1 SMESG000024909.1 SMESG000023833.1 SMESG000023573.1 SMESG000023546.1 SMESG000022236.1 SMESG000021499.1 SMESG000019820.1 SMESG000018414.1 SMESG000017989.1 SMESG000017936.1 SMESG000015191.1 SMESG000014475.1 SMESG000009011.1 SMESG000008656.1 SMESG000006220.1 SMESG000005037.1 SMESG000004638.1 SMESG000003422.1 Contig5461uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30032366SMESG000033099.1 Contig5461newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30032366SMESG000033099.1 Contig5461uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30032366SMESG000079430.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000070487.1 SMESG000069936.1 SMESG000066411.1 SMESG000065866.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000058180.1 SMESG000057864.1 SMESG000057533.1 SMESG000057427.1 SMESG000053372.1 SMESG000050587.1 SMESG000050353.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000046053.1 SMESG000043782.1 SMESG000040179.1 SMESG000037212.1 SMESG000035558.1 SMESG000034701.1 SMESG000033592.1 SMESG000031049.1 SMESG000029555.1 SMESG000029226.1 SMESG000026530.1 SMESG000024597.1 SMESG000023611.1 SMESG000022236.1 SMESG000021499.1 SMESG000019334.1 SMESG000017989.1 SMESG000013698.1 SMESG000008351.1 SMESG000006220.1 SMESG000005221.1 SMESG000001234.1 Contig15604newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032366SMESG000079430.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000070487.1 SMESG000069936.1 SMESG000066411.1 SMESG000065866.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000058180.1 SMESG000057864.1 SMESG000057533.1 SMESG000057427.1 SMESG000053372.1 SMESG000050587.1 SMESG000050353.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000046053.1 SMESG000043782.1 SMESG000040179.1 SMESG000037212.1 SMESG000035558.1 SMESG000034701.1 SMESG000033592.1 SMESG000031049.1 SMESG000029555.1 SMESG000029226.1 SMESG000026530.1 SMESG000024597.1 SMESG000023611.1 SMESG000022236.1 SMESG000021499.1 SMESG000019334.1 SMESG000017989.1 SMESG000013698.1 SMESG000008351.1 SMESG000006220.1 SMESG000005221.1 SMESG000001234.1 Contig15604uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032366SMESG000079430.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000069936.1 SMESG000065288.1 SMESG000062279.1 SMESG000057864.1 SMESG000057533.1 SMESG000057427.1 SMESG000053372.1 SMESG000050587.1 SMESG000050353.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000046053.1 SMESG000043782.1 SMESG000042302.1 SMESG000037212.1 SMESG000034701.1 SMESG000031049.1 SMESG000029555.1 SMESG000029226.1 SMESG000026530.1 SMESG000024597.1 SMESG000023611.1 SMESG000022236.1 SMESG000021499.1 SMESG000019334.1 SMESG000017989.1 SMESG000008351.1 SMESG000006220.1 SMESG000005221.1 SMESG000001234.1 SMESG000047031.1 Contig12510newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032366SMESG000079430.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000069936.1 SMESG000065288.1 SMESG000062279.1 SMESG000057864.1 SMESG000057533.1 SMESG000057427.1 SMESG000053372.1 SMESG000050587.1 SMESG000050353.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000046053.1 SMESG000043782.1 SMESG000042302.1 SMESG000037212.1 SMESG000034701.1 SMESG000031049.1 SMESG000029555.1 SMESG000029226.1 SMESG000026530.1 SMESG000024597.1 SMESG000023611.1 SMESG000022236.1 SMESG000021499.1 SMESG000019334.1 SMESG000017989.1 SMESG000008351.1 SMESG000006220.1 SMESG000005221.1 SMESG000001234.1 SMESG000047031.1 Contig12510uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032366SMESG000050587.1 SMESG000046053.1 SMESG000034701.1 SMESG000029555.1 SMESG000026530.1 SMESG000008351.1 SMESG000006220.1 Contig16387newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032366SMESG000050587.1 SMESG000046053.1 SMESG000034701.1 SMESG000029555.1 SMESG000026530.1 SMESG000008351.1 SMESG000006220.1 Contig16387uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032366SMESG000076091.1 SMESG000070487.1 SMESG000069936.1 SMESG000066411.1 SMESG000066165.1 SMESG000065866.1 SMESG000065178.1 SMESG000062279.1 SMESG000053372.1 SMESG000050587.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000046053.1 SMESG000043782.1 SMESG000029226.1 SMESG000028508.1 SMESG000026530.1 SMESG000022236.1 SMESG000004687.1 Contig17376newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032366SMESG000076091.1 SMESG000070487.1 SMESG000069936.1 SMESG000066411.1 SMESG000066165.1 SMESG000065866.1 SMESG000065178.1 SMESG000062279.1 SMESG000053372.1 SMESG000050587.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000046053.1 SMESG000043782.1 SMESG000029226.1 SMESG000028508.1 SMESG000026530.1 SMESG000022236.1 SMESG000004687.1 Contig17376uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30032366SMESG000080004.1 SMESG000079430.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000070393.1 SMESG000069936.1 SMESG000068687.1 SMESG000065866.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000061056.1 SMESG000059025.1 SMESG000058180.1 SMESG000057864.1 SMESG000057533.1 SMESG000057427.1 SMESG000055140.1 SMESG000053372.1 SMESG000053240.1 SMESG000050587.1 SMESG000050353.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000046053.1 SMESG000043782.1 SMESG000042816.1 SMESG000042302.1 SMESG000040179.1 SMESG000038292.1 SMESG000037212.1 SMESG000034701.1 SMESG000033592.1 SMESG000031049.1 SMESG000029555.1 SMESG000029226.1 SMESG000026530.1 SMESG000024597.1 SMESG000023611.1 SMESG000022236.1 SMESG000021499.1 SMESG000019334.1 SMESG000017989.1 SMESG000013698.1 SMESG000013635.1 SMESG000009102.1 SMESG000008351.1 SMESG000006220.1 SMESG000005221.1 SMESG000001234.1 SMESG000026425.1 dd_Smed_v4_9908_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30032366SMESG000080004.1 SMESG000079430.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000070393.1 SMESG000069936.1 SMESG000068687.1 SMESG000065866.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000061056.1 SMESG000059025.1 SMESG000058180.1 SMESG000057864.1 SMESG000057533.1 SMESG000057427.1 SMESG000055140.1 SMESG000053372.1 SMESG000053240.1 SMESG000050587.1 SMESG000050353.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000046053.1 SMESG000043782.1 SMESG000042816.1 SMESG000042302.1 SMESG000040179.1 SMESG000038292.1 SMESG000037212.1 SMESG000034701.1 SMESG000033592.1 SMESG000031049.1 SMESG000029555.1 SMESG000029226.1 SMESG000026530.1 SMESG000024597.1 SMESG000023611.1 SMESG000022236.1 SMESG000021499.1 SMESG000019334.1 SMESG000017989.1 SMESG000013698.1 SMESG000013635.1 SMESG000009102.1 SMESG000008351.1 SMESG000006220.1 SMESG000005221.1 SMESG000001234.1 SMESG000026425.1 dd_Smed_v4_9908_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30032366SMESG000079180.1 SMESG000076652.1 SMESG000076091.1 SMESG000066578.1 SMESG000065288.1 SMESG000059025.1 SMESG000057427.1 SMESG000052755.1 SMESG000052524.1 SMESG000050353.1 SMESG000046659.1 SMESG000037212.1 SMESG000033451.1 SMESG000031049.1 SMESG000022236.1 SMESG000019334.1 SMESG000017989.1 SMESG000026425.1 Contig11424newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30032366SMESG000079180.1 SMESG000076652.1 SMESG000076091.1 SMESG000066578.1 SMESG000065288.1 SMESG000059025.1 SMESG000057427.1 SMESG000052755.1 SMESG000052524.1 SMESG000050353.1 SMESG000046659.1 SMESG000037212.1 SMESG000033451.1 SMESG000031049.1 SMESG000022236.1 SMESG000019334.1 SMESG000017989.1 SMESG000026425.1 Contig11424newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30032366SMESG000079180.1 SMESG000076652.1 SMESG000076091.1 SMESG000066578.1 SMESG000065288.1 SMESG000059025.1 SMESG000057427.1 SMESG000052755.1 SMESG000052524.1 SMESG000050353.1 SMESG000046659.1 SMESG000037212.1 SMESG000033451.1 SMESG000031049.1 SMESG000022236.1 SMESG000019334.1 SMESG000017989.1 SMESG000026425.1 Contig11424uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30032366SMESG000079180.1 SMESG000076652.1 SMESG000076091.1 SMESG000066578.1 SMESG000065288.1 SMESG000059025.1 SMESG000057427.1 SMESG000052755.1 SMESG000052524.1 SMESG000050353.1 SMESG000046659.1 SMESG000037212.1 SMESG000033451.1 SMESG000031049.1 SMESG000022236.1 SMESG000019334.1 SMESG000017989.1 SMESG000026425.1 Contig11424uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30032366SMESG000076652.1 SMESG000053372.1 SMESG000050353.1 SMESG000040848.1 SMESG000034123.1 SMESG000029555.1 SMESG000023611.1 SMESG000064571.1 Contig19011newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30032366SMESG000076652.1 SMESG000053372.1 SMESG000050353.1 SMESG000040848.1 SMESG000034123.1 SMESG000029555.1 SMESG000023611.1 SMESG000064571.1 Contig19011newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30032366SMESG000076652.1 SMESG000053372.1 SMESG000050353.1 SMESG000040848.1 SMESG000034123.1 SMESG000029555.1 SMESG000023611.1 SMESG000064571.1 Contig19011uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30032366SMESG000076652.1 SMESG000053372.1 SMESG000050353.1 SMESG000040848.1 SMESG000034123.1 SMESG000029555.1 SMESG000023611.1 SMESG000064571.1 Contig19011uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
oocyteSMED30032366SMESG000080004.1 SMESG000069936.1 SMESG000058785.1 SMESG000057533.1 SMESG000022485.1 SMESG000022236.1 SMESG000009102.1 SMESG000005221.1 Contig11196newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30032366SMESG000080004.1 SMESG000069936.1 SMESG000058785.1 SMESG000057533.1 SMESG000022485.1 SMESG000022236.1 SMESG000009102.1 SMESG000005221.1 Contig11196newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30032366SMESG000080004.1 SMESG000069936.1 SMESG000058785.1 SMESG000057533.1 SMESG000022485.1 SMESG000022236.1 SMESG000009102.1 SMESG000005221.1 Contig11196uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30032366SMESG000080004.1 SMESG000069936.1 SMESG000058785.1 SMESG000057533.1 SMESG000022485.1 SMESG000022236.1 SMESG000009102.1 SMESG000005221.1 Contig11196uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30032366SMESG000080004.1 SMESG000079430.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000069936.1 SMESG000068687.1 SMESG000065866.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000061056.1 SMESG000059025.1 SMESG000058180.1 SMESG000057864.1 SMESG000057533.1 SMESG000057427.1 SMESG000055140.1 SMESG000053372.1 SMESG000050587.1 SMESG000050353.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000043782.1 SMESG000042816.1 SMESG000042302.1 SMESG000038292.1 SMESG000037212.1 SMESG000034701.1 SMESG000033592.1 SMESG000031049.1 SMESG000029555.1 SMESG000029226.1 SMESG000026530.1 SMESG000023611.1 SMESG000022236.1 SMESG000021499.1 SMESG000019334.1 SMESG000017989.1 SMESG000013698.1 SMESG000013635.1 SMESG000009102.1 SMESG000008455.1 SMESG000008351.1 SMESG000006220.1 SMESG000005221.1 SMESG000001234.1 SMESG000019578.1 Contig11835newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30032366SMESG000080004.1 SMESG000079430.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000069936.1 SMESG000068687.1 SMESG000065866.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000061056.1 SMESG000059025.1 SMESG000058180.1 SMESG000057864.1 SMESG000057533.1 SMESG000057427.1 SMESG000055140.1 SMESG000053372.1 SMESG000050587.1 SMESG000050353.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000043782.1 SMESG000042816.1 SMESG000042302.1 SMESG000038292.1 SMESG000037212.1 SMESG000034701.1 SMESG000033592.1 SMESG000031049.1 SMESG000029555.1 SMESG000029226.1 SMESG000026530.1 SMESG000023611.1 SMESG000022236.1 SMESG000021499.1 SMESG000019334.1 SMESG000017989.1 SMESG000013698.1 SMESG000013635.1 SMESG000009102.1 SMESG000008455.1 SMESG000008351.1 SMESG000006220.1 SMESG000005221.1 SMESG000001234.1 SMESG000019578.1 Contig11835newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30032366SMESG000080004.1 SMESG000079430.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000069936.1 SMESG000068687.1 SMESG000065866.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000061056.1 SMESG000059025.1 SMESG000058180.1 SMESG000057864.1 SMESG000057533.1 SMESG000057427.1 SMESG000055140.1 SMESG000053372.1 SMESG000050587.1 SMESG000050353.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000043782.1 SMESG000042816.1 SMESG000042302.1 SMESG000038292.1 SMESG000037212.1 SMESG000034701.1 SMESG000033592.1 SMESG000031049.1 SMESG000029555.1 SMESG000029226.1 SMESG000026530.1 SMESG000023611.1 SMESG000022236.1 SMESG000021499.1 SMESG000019334.1 SMESG000017989.1 SMESG000013698.1 SMESG000013635.1 SMESG000009102.1 SMESG000008455.1 SMESG000008351.1 SMESG000006220.1 SMESG000005221.1 SMESG000001234.1 SMESG000019578.1 Contig11835uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30032366SMESG000080004.1 SMESG000079430.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000069936.1 SMESG000068687.1 SMESG000065866.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000061056.1 SMESG000059025.1 SMESG000058180.1 SMESG000057864.1 SMESG000057533.1 SMESG000057427.1 SMESG000055140.1 SMESG000053372.1 SMESG000050587.1 SMESG000050353.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000043782.1 SMESG000042816.1 SMESG000042302.1 SMESG000038292.1 SMESG000037212.1 SMESG000034701.1 SMESG000033592.1 SMESG000031049.1 SMESG000029555.1 SMESG000029226.1 SMESG000026530.1 SMESG000023611.1 SMESG000022236.1 SMESG000021499.1 SMESG000019334.1 SMESG000017989.1 SMESG000013698.1 SMESG000013635.1 SMESG000009102.1 SMESG000008455.1 SMESG000008351.1 SMESG000006220.1 SMESG000005221.1 SMESG000001234.1 SMESG000019578.1 Contig11835uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30032366SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000070393.1 SMESG000065288.1 SMESG000062279.1 SMESG000061056.1 SMESG000057864.1 SMESG000057427.1 SMESG000053372.1 SMESG000050587.1 SMESG000050353.1 SMESG000047874.1 SMESG000046659.1 SMESG000046053.1 SMESG000042302.1 SMESG000037212.1 SMESG000031049.1 SMESG000029226.1 SMESG000026530.1 SMESG000021499.1 SMESG000019334.1 SMESG000017989.1 SMESG000006220.1 SMESG000001234.1 Contig15140newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30032366SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000070393.1 SMESG000065288.1 SMESG000062279.1 SMESG000061056.1 SMESG000057864.1 SMESG000057427.1 SMESG000053372.1 SMESG000050587.1 SMESG000050353.1 SMESG000047874.1 SMESG000046659.1 SMESG000046053.1 SMESG000042302.1 SMESG000037212.1 SMESG000031049.1 SMESG000029226.1 SMESG000026530.1 SMESG000021499.1 SMESG000019334.1 SMESG000017989.1 SMESG000006220.1 SMESG000001234.1 Contig15140newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30032366SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000070393.1 SMESG000065288.1 SMESG000062279.1 SMESG000061056.1 SMESG000057864.1 SMESG000057427.1 SMESG000053372.1 SMESG000050587.1 SMESG000050353.1 SMESG000047874.1 SMESG000046659.1 SMESG000046053.1 SMESG000042302.1 SMESG000037212.1 SMESG000031049.1 SMESG000029226.1 SMESG000026530.1 SMESG000021499.1 SMESG000019334.1 SMESG000017989.1 SMESG000006220.1 SMESG000001234.1 Contig15140uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30032366SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000070393.1 SMESG000065288.1 SMESG000062279.1 SMESG000061056.1 SMESG000057864.1 SMESG000057427.1 SMESG000053372.1 SMESG000050587.1 SMESG000050353.1 SMESG000047874.1 SMESG000046659.1 SMESG000046053.1 SMESG000042302.1 SMESG000037212.1 SMESG000031049.1 SMESG000029226.1 SMESG000026530.1 SMESG000021499.1 SMESG000019334.1 SMESG000017989.1 SMESG000006220.1 SMESG000001234.1 Contig15140uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30032366SMESG000080965.1 SMESG000079430.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000069936.1 SMESG000068687.1 SMESG000066165.1 SMESG000065288.1 SMESG000062279.1 SMESG000061056.1 SMESG000059025.1 SMESG000058180.1 SMESG000057864.1 SMESG000057533.1 SMESG000057427.1 SMESG000053372.1 SMESG000050587.1 SMESG000050353.1 SMESG000049945.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000046053.1 SMESG000043782.1 SMESG000042302.1 SMESG000040179.1 SMESG000038292.1 SMESG000037212.1 SMESG000034701.1 SMESG000031049.1 SMESG000029725.1 SMESG000029555.1 SMESG000029226.1 SMESG000026530.1 SMESG000024597.1 SMESG000023611.1 SMESG000022236.1 SMESG000021499.1 SMESG000020698.1 SMESG000020034.1 SMESG000019334.1 SMESG000017989.1 SMESG000014531.1 SMESG000013698.1 SMESG000013635.1 SMESG000008351.1 SMESG000006220.1 SMESG000005221.1 SMESG000080004.1 SMESG000026425.1 Contig16779newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30032366SMESG000080965.1 SMESG000079430.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000069936.1 SMESG000068687.1 SMESG000066165.1 SMESG000065288.1 SMESG000062279.1 SMESG000061056.1 SMESG000059025.1 SMESG000058180.1 SMESG000057864.1 SMESG000057533.1 SMESG000057427.1 SMESG000053372.1 SMESG000050587.1 SMESG000050353.1 SMESG000049945.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000046053.1 SMESG000043782.1 SMESG000042302.1 SMESG000040179.1 SMESG000038292.1 SMESG000037212.1 SMESG000034701.1 SMESG000031049.1 SMESG000029725.1 SMESG000029555.1 SMESG000029226.1 SMESG000026530.1 SMESG000024597.1 SMESG000023611.1 SMESG000022236.1 SMESG000021499.1 SMESG000020698.1 SMESG000020034.1 SMESG000019334.1 SMESG000017989.1 SMESG000014531.1 SMESG000013698.1 SMESG000013635.1 SMESG000008351.1 SMESG000006220.1 SMESG000005221.1 SMESG000080004.1 SMESG000026425.1 Contig16779newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30032366SMESG000080965.1 SMESG000079430.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000069936.1 SMESG000068687.1 SMESG000066165.1 SMESG000065288.1 SMESG000062279.1 SMESG000061056.1 SMESG000059025.1 SMESG000058180.1 SMESG000057864.1 SMESG000057533.1 SMESG000057427.1 SMESG000053372.1 SMESG000050587.1 SMESG000050353.1 SMESG000049945.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000046053.1 SMESG000043782.1 SMESG000042302.1 SMESG000040179.1 SMESG000038292.1 SMESG000037212.1 SMESG000034701.1 SMESG000031049.1 SMESG000029725.1 SMESG000029555.1 SMESG000029226.1 SMESG000026530.1 SMESG000024597.1 SMESG000023611.1 SMESG000022236.1 SMESG000021499.1 SMESG000020698.1 SMESG000020034.1 SMESG000019334.1 SMESG000017989.1 SMESG000014531.1 SMESG000013698.1 SMESG000013635.1 SMESG000008351.1 SMESG000006220.1 SMESG000005221.1 SMESG000080004.1 SMESG000026425.1 Contig16779uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30032366SMESG000080965.1 SMESG000079430.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000069936.1 SMESG000068687.1 SMESG000066165.1 SMESG000065288.1 SMESG000062279.1 SMESG000061056.1 SMESG000059025.1 SMESG000058180.1 SMESG000057864.1 SMESG000057533.1 SMESG000057427.1 SMESG000053372.1 SMESG000050587.1 SMESG000050353.1 SMESG000049945.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000046053.1 SMESG000043782.1 SMESG000042302.1 SMESG000040179.1 SMESG000038292.1 SMESG000037212.1 SMESG000034701.1 SMESG000031049.1 SMESG000029725.1 SMESG000029555.1 SMESG000029226.1 SMESG000026530.1 SMESG000024597.1 SMESG000023611.1 SMESG000022236.1 SMESG000021499.1 SMESG000020698.1 SMESG000020034.1 SMESG000019334.1 SMESG000017989.1 SMESG000014531.1 SMESG000013698.1 SMESG000013635.1 SMESG000008351.1 SMESG000006220.1 SMESG000005221.1 SMESG000080004.1 SMESG000026425.1 Contig16779uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30032366SMESG000079430.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000069936.1 SMESG000068687.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000057864.1 SMESG000057533.1 SMESG000057427.1 SMESG000053372.1 SMESG000050587.1 SMESG000050353.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000046053.1 SMESG000043782.1 SMESG000040179.1 SMESG000037212.1 SMESG000034701.1 SMESG000033592.1 SMESG000031049.1 SMESG000029226.1 SMESG000026530.1 SMESG000024597.1 SMESG000023611.1 SMESG000022236.1 SMESG000021499.1 SMESG000019334.1 SMESG000017989.1 SMESG000013698.1 SMESG000008351.1 SMESG000006220.1 SMESG000005221.1 SMESG000001234.1 SMESG000080004.1 Contig5168newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30032366SMESG000079430.1 SMESG000076652.1 SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000069936.1 SMESG000068687.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000057864.1 SMESG000057533.1 SMESG000057427.1 SMESG000053372.1 SMESG000050587.1 SMESG000050353.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000046053.1 SMESG000043782.1 SMESG000040179.1 SMESG000037212.1 SMESG000034701.1 SMESG000033592.1 SMESG000031049.1 SMESG000029226.1 SMESG000026530.1 SMESG000024597.1 SMESG000023611.1 SMESG000022236.1 SMESG000021499.1 SMESG000019334.1 SMESG000017989.1 SMESG000013698.1 SMESG000008351.1 SMESG000006220.1 SMESG000005221.1 SMESG000001234.1 SMESG000080004.1 Contig5168uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30032366SMESG000015488.1 Contig5168newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30032366SMESG000015488.1 Contig5168uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30032366 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.003306:65290..65677 -1218
v31.010312:2830..3213 -1194
Homology
BLAST of SMED30032366 vs. UniProt/SwissProt
Match: sp|Q84177|PRO_ADEP3 (Protease OS=Porcine adenovirus A serotype 3 OX=35265 GN=L3 PE=3 SV=1)

HSP 1 Score: 49.6766 bits (117), Expect = 5.531e-7
Identity = 35/113 (30.97%), Postives = 50/113 (44.25%), Query Frame = 1
Query:   88 EFLGVFPLDKIPYLRNNQ--AIIVNTQSSHLGGEHWLAIYMKPSK--IFVFDPMGF------------YYPALMVSKLQTMGK---PIVYNKTMYQKPWTLTCGQHCLAWLLS 369
             FLG F      +L+ +Q    IVNT + H GG HWLA+  +P+    + FDP GF            Y   L  S +Q+       +V +    Q P +  CG  CL +L +
Sbjct:   19 RFLGTFDKSFPGFLQESQRCCAIVNTAARHTGGRHWLAVAWEPASRTFYFFDPFGFSDRELAQVYDFEYQRLLRKSAIQSTPDRCLTLVKSTQSVQGPHSAACGLFCLLFLAA 131          
BLAST of SMED30032366 vs. TrEMBL
Match: A0A3C1S1Q5 (Uncharacterized protein OS=Tenacibaculum sp. OX=1906242 GN=DDE71_02150 PE=4 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 2.136e-11
Identity = 34/111 (30.63%), Postives = 59/111 (53.15%), Query Frame = 1
Query:   40 MDSVQVYRIGKQILGHEFLGVFPLDKIPYLRNNQA--IIVNTQSSHLGGEHWLAIYMKPSKIFVFDPMG--FYYPALMVSKLQTMGKPIVYNKTMYQKPWTLTCGQHCLAW 360
            MDS ++ +  KQ    +FLGVF +D++  +  N+   +I NT +S   G+HW+A+ +  ++IF FD +   F Y       ++   K +++N    Q   +  CG HCL +
Sbjct:    1 MDSNEINKFAKQFGLKKFLGVFAVDELSLIPKNRLGLVIFNTDTSQSVGQHWVALCITKTRIFYFDSLNIKFQYSTHFTDFMKYTKKELIWNTIQIQSNISEKCGIHCLVF 111          
BLAST of SMED30032366 vs. TrEMBL
Match: A0A443S1W5 (Uncharacterized protein (Fragment) OS=Leptotrombidium deliense OX=299467 GN=B4U80_06898 PE=4 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.394e-9
Identity = 37/96 (38.54%), Postives = 50/96 (52.08%), Query Frame = 1
Query:   88 EFLGVFPLDKIPYL-RNNQAIIVNTQSSHLGGEHWLAIYM-KPSKIFVFDPMGF--YYPALMVSKLQTMGKPIVYNKTMYQKPWTLTCGQHCLAWL 363
            EF+G FP D IP   R   + IVNT SS+  GEHW+AIY+ K +K   FD  G    +  L     +     + YN    Q P + TCG+ CL ++
Sbjct:    3 EFVGTFPRDNIPTTTRRPASFIVNTDSSNEPGEHWVAIYLTKNNKAEYFDSFGLPPLHRDLTEFIHEHAKNGVKYNNICIQHPLSTTCGKFCLKYV 98          
BLAST of SMED30032366 vs. TrEMBL
Match: A0A4Y2MES2 (Uncharacterized protein OS=Araneus ventricosus OX=182803 GN=AVEN_200179_1 PE=4 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 2.602e-9
Identity = 34/99 (34.34%), Postives = 48/99 (48.48%), Query Frame = 1
Query:   91 FLGVFPLDKIPYLRNNQAIIVNTQSSHLGGEHWLAIYMKPSKIFVFDPMG-----FYYPALMVSKLQTMGKPIVYNKTMYQKPWTLTCGQHCLAWLLSK 372
            F GVFP D IP L    AIIVNT  S   G+HW+A++M+  K+  FD  G     F   +   S          YN   +Q   +L CG + + ++L +
Sbjct:   20 FQGVFPADNIPLLTGKAAIIVNTDVSGGHGKHWVALFMESDKLDFFDSFGKSPDEFLNGSFHTSCFAEKFPNTTYNPIKFQSRESLVCGYYSIYFILQR 118          
BLAST of SMED30032366 vs. TrEMBL
Match: A0A1A8V644 (Uncharacterized protein (Fragment) OS=Nothobranchius furzeri OX=105023 GN=LOTGIDRAFT_175928 PE=4 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 5.283e-9
Identity = 39/121 (32.23%), Postives = 60/121 (49.59%), Query Frame = 1
Query:   40 MDSVQVYRIGKQILGHEFLGVFPLDKIPYLRNNQAI----IVNTQSSHLGGEHWLAIYMKPSKIFV-FDPMGF-----YYPALMVSKLQTMGKPIVYNKTMYQKPWTLTCGQHCLAWLLSK 372
            MD+ +++ I   +LG  F GVF  DK+  +     +    +VNT  +HL GEHWLA+ ++   +   FD  GF     YYP  +++ L+     I Y     Q   +  CG HC+ +L  K
Sbjct:    1 MDNHELHGILSSLLGDLFSGVFASDKLSTIPKKIQLLAYFVVNTHPAHLPGEHWLALPVEQDGLGTFFDSYGFSPEFEYYPKTIMNFLKERCSEIHYQDDHLQSLTSDRCGHHCVLFLCHK 121          
BLAST of SMED30032366 vs. TrEMBL
Match: A0A2B4RXN3 (Pulmonary surfactant-associated protein D OS=Stylophora pistillata OX=50429 GN=Sftpd PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.065e-8
Identity = 30/91 (32.97%), Postives = 45/91 (49.45%), Query Frame = 1
Query:   91 FLGVFPLDKIPYLRNNQAIIVNTQSSHLGGEHWLAIYMKPSKIFVFDPMGFYYPALMVSKLQTMGKPIVYNKTMYQKPWTLTCGQHCLAWL 363
            F GV   D++   +  +  ++N   SH  G HW+A++     I  FD  G + P  +VS   T G    YN T YQ   ++ CG +CL +L
Sbjct:  952 FGGVISRDQVKDCKPKRCYVINLNESHESGSHWVAMFFGSDLILYFDSFGLHPPQEIVSLSNTEGINYAYNNTHYQALLSVLCGYYCLYFL 1042          
BLAST of SMED30032366 vs. Planmine SMEST
Match: SMESG000006220.1 (SMESG000006220.1)

HSP 1 Score: 220.32 bits (560), Expect = 2.156e-67
Identity = 102/108 (94.44%), Postives = 103/108 (95.37%), Query Frame = 1
Query:   52 QVYRIGKQILGHEFLGVFPLDKIPYLRNNQAIIVNTQSSHLGGEHWLAIYMKPSKIFVFDPMGFYYPALMVSKLQTMGKPIVYNKTMYQKPWTLTCGQHCLAWLLSKR 375
             VYRIGKQILGHEFLGVFPLDKIPYLRNNQAIIVNTQSSHLGGEHWLAIYMKPSKIFVFDPMGFYYPALMVSKLQTMGKPIVYNKTMYQKPWTLTCGQHCLA +   R
Sbjct:  353 NVYRIGKQILGHEFLGVFPLDKIPYLRNNQAIIVNTQSSHLGGEHWLAIYMKPSKIFVFDPMGFYYPALMVSKLQTMGKPIVYNKTMYQKPWTLTCGQHCLALVYFNR 460          
BLAST of SMED30032366 vs. Planmine SMEST
Match: SMESG000050353.1 (SMESG000050353.1)

HSP 1 Score: 216.083 bits (549), Expect = 6.085e-66
Identity = 99/105 (94.29%), Postives = 101/105 (96.19%), Query Frame = 1
Query:   46 SVQVYRIGKQILGHEFLGVFPLDKIPYLRNNQAIIVNTQSSHLGGEHWLAIYMKPSKIFVFDPMGFYYPALMVSKLQTMGKPIVYNKTMYQKPWTLTCGQHCLAW 360
            +V VYRIGKQILGHEFLGVFPLDKIPYLRNNQAIIVNTQSSHLGGEHWLAIYMKP KIFVFDPMGFYYPAL+VSKLQ MGKPIVYNKTMYQK WTLTCGQHCLAW
Sbjct:  270 TVLVYRIGKQILGHEFLGVFPLDKIPYLRNNQAIIVNTQSSHLGGEHWLAIYMKPCKIFVFDPMGFYYPALVVSKLQAMGKPIVYNKTMYQKQWTLTCGQHCLAW 374          
BLAST of SMED30032366 vs. Planmine SMEST
Match: SMESG000043200.1 (SMESG000043200.1)

HSP 1 Score: 187.963 bits (476), Expect = 1.842e-59
Identity = 85/112 (75.89%), Postives = 95/112 (84.82%), Query Frame = 1
Query:   46 SVQVYRIGKQILGHEFLGVFPLDKIPYLRNNQAIIVNTQSSHLGGEHWLAIYMKPSKIFVFDPMGFYYPALMVSKLQTMGKPIVYNKTMYQKPWTLTCGQHCLAWLLSKRFD 381
            S+QV R+G  +LG+EF+GV+ LDKIPYLRNNQAIIV TQS HL GEHW+AIYMKP KI VFDP+GFY PALMVSKLQTM KPI+YNKTMYQ P T T GQHCL WL+ KRFD
Sbjct:  272 SIQVNRLGNLLLGNEFVGVYRLDKIPYLRNNQAIIVITQSFHLSGEHWIAIYMKPDKIHVFDPLGFYSPALMVSKLQTMNKPIMYNKTMYQNPMTRTYGQHCLTWLMYKRFD 383          
BLAST of SMED30032366 vs. Planmine SMEST
Match: SMESG000022236.1 (SMESG000022236.1)

HSP 1 Score: 168.703 bits (426), Expect = 8.653e-51
Identity = 75/76 (98.68%), Postives = 75/76 (98.68%), Query Frame = 1
Query:   55 VYRIGKQILGHEFLGVFPLDKIPYLRNNQAIIVNTQSSHLGGEHWLAIYMKPSKIFVFDPMGFYYPALMVSKLQTM 282
            VYRIGKQILGHEFLGVFPLDKIPYLRNNQAIIVNTQSSHLGGEHWLAIYM PSKIFVFDPMGFYYPALMVSKLQTM
Sbjct:   59 VYRIGKQILGHEFLGVFPLDKIPYLRNNQAIIVNTQSSHLGGEHWLAIYMNPSKIFVFDPMGFYYPALMVSKLQTM 134          
BLAST of SMED30032366 vs. Planmine SMEST
Match: SMESG000022236.1 (SMESG000022236.1)

HSP 1 Score: 169.474 bits (428), Expect = 2.291e-50
Identity = 76/79 (96.20%), Postives = 77/79 (97.47%), Query Frame = 1
Query:   46 SVQVYRIGKQILGHEFLGVFPLDKIPYLRNNQAIIVNTQSSHLGGEHWLAIYMKPSKIFVFDPMGFYYPALMVSKLQTM 282
            +V VYRIGKQILGHEFLGVFPLDKIPYLRNNQAIIVNTQSSHLGGEHWLAIYM PSKIFVFDPMGFYYPALMVSKLQTM
Sbjct:   85 TVLVYRIGKQILGHEFLGVFPLDKIPYLRNNQAIIVNTQSSHLGGEHWLAIYMNPSKIFVFDPMGFYYPALMVSKLQTM 163          
The following BLAST results are available for this feature:
BLAST of SMED30032366 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032366 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032366 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032366 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032366 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032366 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032366 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q84177|PRO_ADEP35.531e-730.97Protease OS=Porcine adenovirus A serotype 3 OX=352... [more]
back to top
BLAST of SMED30032366 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3C1S1Q52.136e-1130.63Uncharacterized protein OS=Tenacibaculum sp. OX=19... [more]
A0A443S1W51.394e-938.54Uncharacterized protein (Fragment) OS=Leptotrombid... [more]
A0A4Y2MES22.602e-934.34Uncharacterized protein OS=Araneus ventricosus OX=... [more]
A0A1A8V6445.283e-932.23Uncharacterized protein (Fragment) OS=Nothobranchi... [more]
A0A2B4RXN31.065e-832.97Pulmonary surfactant-associated protein D OS=Stylo... [more]
back to top
BLAST of SMED30032366 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032366 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032366 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032366 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032366 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032366 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006220.12.156e-6794.44SMESG000006220.1[more]
SMESG000050353.16.085e-6694.29SMESG000050353.1[more]
SMESG000043200.11.842e-5975.89SMESG000043200.1[more]
SMESG000022236.18.653e-5198.68SMESG000022236.1[more]
SMESG000022236.12.291e-5096.20SMESG000022236.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032366 ID=SMED30032366|Name=SMED30032366|organism=Schmidtea mediterranea sexual|type=transcript|length=385bp
TGTTGGTATAAATGTATAGATAATTTATGATAATTTGTCATGGATTCTGT
TCAGGTCTATCGAATTGGAAAACAAATACTAGGACATGAATTTTTAGGGG
TTTTTCCTCTTGATAAAATTCCATATTTACGTAATAATCAAGCCATAATC
GTCAATACTCAATCATCTCATCTCGGTGGAGAACATTGGTTAGCAATATA
TATGAAACCTAGCAAGATATTTGTATTTGATCCTATGGGTTTCTATTATC
CGGCTTTAATGGTTTCGAAACTTCAAACAATGGGTAAACCTATTGTCTAT
AATAAAACTATGTATCAAAAACCATGGACCTTAACATGTGGTCAACATTG
TTTAGCTTGGTTATTATCCAAGAGATTTGATGATC
back to top

protein sequence of SMED30032366-orf-1

>SMED30032366-orf-1 ID=SMED30032366-orf-1|Name=SMED30032366-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=115bp
MDSVQVYRIGKQILGHEFLGVFPLDKIPYLRNNQAIIVNTQSSHLGGEHW
LAIYMKPSKIFVFDPMGFYYPALMVSKLQTMGKPIVYNKTMYQKPWTLTC
GQHCLAWLLSKRFDD
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000136whole organism
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR000855Peptidase_C5
Vocabulary: molecular function
TermDefinition
GO:0004197cysteine-type endopeptidase activity
GO:0008233peptidase activity
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis