EOG090X01A3

Overview
NameEOG090X01A3
Smed IDSMED30032354
Length (bp)3265
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of EOG090X01A3 (SMED30032354) t-SNE clustered cells

Violin plots show distribution of expression levels for EOG090X01A3 (SMED30032354) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of EOG090X01A3 (SMED30032354) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for EOG090X01A3 (SMED30032354) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of EOG090X01A3 vs. Ensembl Human
Match: MFN1 (mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262])

HSP 1 Score: 103.99 bits (258), Expect = 5.003e-23
Identity = 75/265 (28.30%), Postives = 146/265 (55.09%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVV--NNEEKDIDELGVINCSQEM-----MGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKK--------ILCDILRLPDN-EIESKIFFISANERMAIFTNEVTAIS------APKWDERNNEFASLFSYLQTKMSESADCKKF 1031
             G+TSSGKS++INA L + +LP+  G  +NCF+ ++G+ + ++ YL+   ++E+K +  +  +  +  M      G L+ +++ +AKC LL DD++++DSPG D      ++ID++  D+DV +LV +S + +  +E + F ++  +L+K N+ I+ N WD   S       +P Y+++ ++         L + L++ +  E +++IFF+SA E ++    +   +       A  +  R  EF +     +  +S+SA   KF
Sbjct:   81 FGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGT-DGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAGCLVRVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASAS-------EPEYMEDVRRQHMERCLHFLVEELKVVNALEAQNRIFFVSAKEVLSARKQKAQGMPESGVALAEGFHARLQEFQNFEQIFEECISQSAVKTKF 337          
BLAST of EOG090X01A3 vs. Ensembl Human
Match: MFN2 (mitofusin 2 [Source:HGNC Symbol;Acc:HGNC:16877])

HSP 1 Score: 106.301 bits (264), Expect = 1.105e-22
Identity = 70/215 (32.56%), Postives = 126/215 (58.60%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEE-----KDIDEL--GVINCSQEMMGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKK--------ILCDILRLPD-NEIESKIFFISANE 899
             G+TS+GKST+INA L + +LP+  G T+NCF+ ++G+ + +  +L+    E     K +++L   +    Q   GSL+++ +  +KCPLL DD++++DSPGID      ++ID++  D+DV +LV +S + +  +E + F ++  +L++ N+ I+ N WD   S       +P Y++E ++         L D L + D ++   +IFF+SA E
Sbjct:  102 FGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGT-DGHEAFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAGSLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASAS-------EPEYMEEVRRQHMERCTSFLVDELGVVDRSQAGDRIFFVSAKE 308          
BLAST of EOG090X01A3 vs. Ensembl Human
Match: MFN2 (mitofusin 2 [Source:HGNC Symbol;Acc:HGNC:16877])

HSP 1 Score: 106.301 bits (264), Expect = 1.105e-22
Identity = 70/215 (32.56%), Postives = 126/215 (58.60%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEE-----KDIDEL--GVINCSQEMMGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKK--------ILCDILRLPD-NEIESKIFFISANE 899
             G+TS+GKST+INA L + +LP+  G T+NCF+ ++G+ + +  +L+    E     K +++L   +    Q   GSL+++ +  +KCPLL DD++++DSPGID      ++ID++  D+DV +LV +S + +  +E + F ++  +L++ N+ I+ N WD   S       +P Y++E ++         L D L + D ++   +IFF+SA E
Sbjct:  102 FGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGT-DGHEAFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAGSLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASAS-------EPEYMEEVRRQHMERCTSFLVDELGVVDRSQAGDRIFFVSAKE 308          
BLAST of EOG090X01A3 vs. Ensembl Human
Match: MFN1 (mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262])

HSP 1 Score: 103.99 bits (258), Expect = 5.052e-22
Identity = 75/265 (28.30%), Postives = 146/265 (55.09%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVV--NNEEKDIDELGVINCSQEM-----MGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKK--------ILCDILRLPDN-EIESKIFFISANERMAIFTNEVTAIS------APKWDERNNEFASLFSYLQTKMSESADCKKF 1031
             G+TSSGKS++INA L + +LP+  G  +NCF+ ++G+ + ++ YL+   ++E+K +  +  +  +  M      G L+ +++ +AKC LL DD++++DSPG D      ++ID++  D+DV +LV +S + +  +E + F ++  +L+K N+ I+ N WD   S       +P Y+++ ++         L + L++ +  E +++IFF+SA E ++    +   +       A  +  R  EF +     +  +S+SA   KF
Sbjct:   81 FGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGT-DGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAGCLVRVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASAS-------EPEYMEDVRRQHMERCLHFLVEELKVVNALEAQNRIFFVSAKEVLSARKQKAQGMPESGVALAEGFHARLQEFQNFEQIFEECISQSAVKTKF 337          
BLAST of EOG090X01A3 vs. Ensembl Human
Match: MFN1 (mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262])

HSP 1 Score: 103.99 bits (258), Expect = 5.052e-22
Identity = 75/265 (28.30%), Postives = 146/265 (55.09%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVV--NNEEKDIDELGVINCSQEM-----MGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKK--------ILCDILRLPDN-EIESKIFFISANERMAIFTNEVTAIS------APKWDERNNEFASLFSYLQTKMSESADCKKF 1031
             G+TSSGKS++INA L + +LP+  G  +NCF+ ++G+ + ++ YL+   ++E+K +  +  +  +  M      G L+ +++ +AKC LL DD++++DSPG D      ++ID++  D+DV +LV +S + +  +E + F ++  +L+K N+ I+ N WD   S       +P Y+++ ++         L + L++ +  E +++IFF+SA E ++    +   +       A  +  R  EF +     +  +S+SA   KF
Sbjct:   81 FGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGT-DGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAGCLVRVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASAS-------EPEYMEDVRRQHMERCLHFLVEELKVVNALEAQNRIFFVSAKEVLSARKQKAQGMPESGVALAEGFHARLQEFQNFEQIFEECISQSAVKTKF 337          
BLAST of EOG090X01A3 vs. Ensembl Celegans
Match: fzo-1 (Transmembrane GTPase fzo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q23424])

HSP 1 Score: 107.071 bits (266), Expect = 2.638e-23
Identity = 88/278 (31.65%), Postives = 147/278 (52.88%), Query Frame = 3
Query:  297 VVLGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEEKDID--ELGVI-------NCSQEMMG--SLITMYYDR----AKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVL-IKPRYIQEAKKILCDILRL-PDNEIESKIFFISANE----RMAIFTNEVTAISAPKWDERNNEFASLFSYLQTKMSESADCKKFADLNNTYLETLA 1067
            V  G+TS+GKST INA L E +LP   G T+ CF++++GS E    +L +++  + ID   LG I       N     MG  SL+ +++ +     +C LL +DV+I+DSPG+D      ++ID++  D+DV +LV ++ + +T +E N F R+  KL+K NV I+ N WD   +  +++  +K +++   ++ L D L +  + E+  +IFF+S+ E    R+        A  A     R  EF +   + +  +S SA   KF   N    E + 
Sbjct:  104 VFFGRTSNGKSTTINAMLHEKVLPQGMGHTTCCFLQVEGS-EGEVGHLQLDDNPQKIDMKMLGKIGHALSDENSDLPAMGQDSLLKVFHPKKSESGECRLLQNDVVILDSPGVDLSPEFDSWIDKHCLDADVFVLVSNAESTLTQAEKNFFLRVAKKLSKPNVFILNNRWDASAAETENIEDVKKQHLTRFRQFLVDELEVCSEREVNDRIFFVSSREVLESRLKARGLVQKAYQAEGHGTRALEFQNFERHFEHCISRSAIHTKFEAHNRRAHEMIG 380          
BLAST of EOG090X01A3 vs. Ensembl Fly
Match: Marf (gene:FBgn0029870 transcript:FBtr0343373)

HSP 1 Score: 104.76 bits (260), Expect = 1.602e-22
Identity = 67/212 (31.60%), Postives = 120/212 (56.60%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEEK----DIDELGVINCSQEMM-GSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVI-----CSSHKDVLIKPRYIQEAKKILCDILRLP-DNEIESKIFFISANERM 905
             G+TS+GKS++INA L E +LP+  G T+NCF +++GS       +   +EEK    +I +L    C +++   SL+ +++ R +C LL DDV+ +DSPG+D      ++ID +  ++DV +LV+++ + +T +E   F  +  KL+K N+ I+ N WD       C   +   +K ++ +     L   L++  + E   ++FF+SA E +
Sbjct:  143 FGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVVNIKQLANALCQEKLCESSLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEPECQESELAKVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETL 354          
BLAST of EOG090X01A3 vs. Ensembl Fly
Match: Marf (gene:FBgn0029870 transcript:FBtr0070910)

HSP 1 Score: 102.834 bits (255), Expect = 6.570e-22
Identity = 66/208 (31.73%), Postives = 120/208 (57.69%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEEK----DIDELGVINCSQEMM-GSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHK-DVLIKPRYIQEAKKILCDILRLP-DNEIESKIFFISANERM 905
             G+TS+GKS++INA L E +LP+  G T+NCF +++GS       +   +EEK    +I +L    C +++   SL+ +++ R +C LL DDV+ +DSPG+D      ++ID +  ++DV +LV+++ + +T +E   F  +  KL+K N+ I+ N WD   +  +    +K ++ +     L   L++  + E   ++FF+SA E +
Sbjct:  143 FGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVVNIKQLANALCQEKLCESSLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEPECQESVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETL 350          
BLAST of EOG090X01A3 vs. Ensembl Fly
Match: Marf (gene:FBgn0029870 transcript:FBtr0070909)

HSP 1 Score: 102.834 bits (255), Expect = 6.570e-22
Identity = 66/208 (31.73%), Postives = 120/208 (57.69%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEEK----DIDELGVINCSQEMM-GSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHK-DVLIKPRYIQEAKKILCDILRLP-DNEIESKIFFISANERM 905
             G+TS+GKS++INA L E +LP+  G T+NCF +++GS       +   +EEK    +I +L    C +++   SL+ +++ R +C LL DDV+ +DSPG+D      ++ID +  ++DV +LV+++ + +T +E   F  +  KL+K N+ I+ N WD   +  +    +K ++ +     L   L++  + E   ++FF+SA E +
Sbjct:  143 FGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVVNIKQLANALCQEKLCESSLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEPECQESVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETL 350          
BLAST of EOG090X01A3 vs. Ensembl Fly
Match: fzo (gene:FBgn0011596 transcript:FBtr0084399)

HSP 1 Score: 85.1149 bits (209), Expect = 1.701e-16
Identity = 79/289 (27.34%), Postives = 148/289 (51.21%), Query Frame = 3
Query:  306 GKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEEKDID-----ELGVINCSQEMMGS-LITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDV--LIKPRYIQEAKKILCDILRLPDNEIES--KIFFISANERMAIFTNEVTAISAPKWDERNNEFASLFSYLQTKMSESADCKKFAD--------LNNTYLETLANF-NKCRCLIDEMKDKR 1115
            G+TS+GKS +INA L E +LP+  G T++CF +++ +  +   ++ V  E++ ++     +L   +    +  S L+ +   + +C +L  DV+++D+PG+D      + +D Y  D+DV ILV+++ + ++  E   FK + SKL++ N+ I+ N WD   S   ++   +K ++++    +L D L +     E+  +I+ +SA E + I   ++T  S  +  +R  EF    +     ++ SA   KF          LN      +  F  K   LIDE K++R
Sbjct:   93 GRTSNGKSAVINALLHEKILPSAMGHTTSCFCQVQANGSNETEHVKVEQEDEHMELSALSQLASAHSPGALKPSTLLQVNMAKNRCSILDYDVVLMDTPGVDVTAQLDDCLDSYCMDADVFILVLNAESTVSRVERQFFKDVASKLSRPNLFILNNRWDKASSLEPEMEQKVKDQHMERCVNLLVDELGVYSTAQEAWERIYHVSALEALHIRNGQITNPSG-QTQQRYQEFLRFENDFSNCLAVSALKTKFGPHLLSAQKILNQLKSTLICPFIEKVSRLIDENKERR 380          
BLAST of EOG090X01A3 vs. Ensembl Zebrafish
Match: MFN1 (mitofusin 1a [Source:NCBI gene;Acc:100329462])

HSP 1 Score: 112.849 bits (281), Expect = 1.030e-25
Identity = 82/265 (30.94%), Postives = 146/265 (55.09%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNN--EEKDIDELGVINCSQEM-----MGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKK--------ILCDILRLPD-NEIESKIFFISANERMAIFTNEVTAIS------APKWDERNNEFASLFSYLQTKMSESADCKKF 1031
             G+TS+GKST+INA L E +LP+  G T+NCF+ ++G+ +  + YL   +  E K I+ +  +  +  M      G L+ +++ + KC LL DD++++DSPGID  +   ++ID++  D+DV +LV +S + I  +E + F ++  +++K N+ I+ N WD         +++P Y+++ +K         L D L++ D N+   +IFF+SA E ++   +    +       A  + ER  EF S     +  +S+SA   KF
Sbjct:   82 FGRTSNGKSTIINAMLRERVLPSGIGHTTNCFLSVEGT-DGEQAYLTTEDSEERKGIETVNHLAHALHMNRNQDSGCLVRVFWPKTKCVLLRDDLVLMDSPGIDVTSELDSWIDKFCLDADVFVLVANSESTIMNTEKHFFHKVNERISKPNIFILNNRWDA-------SVLEPEYLEDVRKQHMDRCVSFLVDELKVVDLNKAPDRIFFVSAKEVLSARIHRAQGMPETGGALAEGFQERLMEFQSFERTFEEFISQSAVKTKF 338          
BLAST of EOG090X01A3 vs. Ensembl Zebrafish
Match: mfn1b (mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553])

HSP 1 Score: 102.064 bits (253), Expect = 8.270e-23
Identity = 69/215 (32.09%), Postives = 125/215 (58.14%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVV--NNEEKDIDELGVINCSQEM-----MGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKK--------ILCDILRLPDN-EIESKIFFISANE 899
             G+TS+GKST+INA L + +LP+  G T+NCF+ ++G+ E ++ +L    + EEK I  +  +  +  M      G L+ +++ + KC LL DD++++DSPG D      ++ID++  D+DV +LV +S + +  +E + F ++  KL+K N+ I+ N WD   +       +P Y+++ +K         L + L++ D  +  ++IFF+SA E
Sbjct:   82 FGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDE-DKAFLKTEGSEEEKSIKTVNQLAHALHMDESLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAA-------EPEYMEDVRKQHTDRCVNFLVEELKVVDRAQAPNRIFFVSAKE 288          
BLAST of EOG090X01A3 vs. Ensembl Zebrafish
Match: mfn1b (mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553])

HSP 1 Score: 102.064 bits (253), Expect = 9.285e-23
Identity = 69/215 (32.09%), Postives = 125/215 (58.14%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVV--NNEEKDIDELGVINCSQEM-----MGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKK--------ILCDILRLPDN-EIESKIFFISANE 899
             G+TS+GKST+INA L + +LP+  G T+NCF+ ++G+ E ++ +L    + EEK I  +  +  +  M      G L+ +++ + KC LL DD++++DSPG D      ++ID++  D+DV +LV +S + +  +E + F ++  KL+K N+ I+ N WD   +       +P Y+++ +K         L + L++ D  +  ++IFF+SA E
Sbjct:   82 FGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDE-DKAFLKTEGSEEEKSIKTVNQLAHALHMDESLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAA-------EPEYMEDVRKQHTDRCVNFLVEELKVVDRAQAPNRIFFVSAKE 288          
BLAST of EOG090X01A3 vs. Ensembl Zebrafish
Match: mfn2 (mitofusin 2 [Source:ZFIN;Acc:ZDB-GENE-081105-44])

HSP 1 Score: 104.76 bits (260), Expect = 1.944e-22
Identity = 80/267 (29.96%), Postives = 146/267 (54.68%), Query Frame = 3
Query:  297 VVLGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEE-----KDIDELG-VINCSQEM-MGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKK--------ILCDILRLPD-NEIESKIFFISANE------RMAIFTNEVTAISAPKWDERNNEFASLFSYLQTKMSESADCKKF 1031
            V  G+TS+GKS++INA L + +LP+  G T+NCF+ ++G+ + N ++L+    +     K +++L   ++  +++  GSL+ + + +AKC LL DD++++DSPGID      ++ID++  D+DV +LV +S + +  +E + F ++  +L+  N+ I+ N WD   +       +P Y++E ++         L D LR+ D +    +IFF+SA E      + A    E     A  +  R  EF +     +  +S+SA   KF
Sbjct:  100 VFFGRTSNGKSSVINAMLWDKVLPSGIGHTTNCFLRVEGT-DGNESFLLTEGSDERKSVKTVNQLAHALHQDEDLDAGSLVCVMWPKAKCALLRDDLVLVDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKSFFHKVNERLSSPNIFILNNRWDASAN-------EPEYMEEVRRQHMDRCTSFLVDELRVVDRSHAGDRIFFVSAKEVLQARVQKAQGMPEAGGALAEGFQARMFEFQNFERRFEECISQSAVKTKF 358          
BLAST of EOG090X01A3 vs. Ensembl Zebrafish
Match: mfn1b (mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553])

HSP 1 Score: 104.375 bits (259), Expect = 3.077e-22
Identity = 82/265 (30.94%), Postives = 143/265 (53.96%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVV--NNEEKDIDELGVINCSQEM-----MGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKK--------ILCDILRLPDN-EIESKIFFISA----NERM--AIFTNEVTAISAPKWDERNNEFASLFSYLQTKMSESADCKKF 1031
             G+TS+GKST+INA L + +LP+  G T+NCF+ ++G+ E ++ +L    + EEK I  +  +  +  M      G L+ +++ + KC LL DD++++DSPG D      ++ID++  D+DV +LV +S + +  +E + F ++  KL+K N+ I+ N WD   +       +P Y+++ +K         L + L++ D  +  ++IFF+SA    N RM  A    E     A  + +R  EF +     +  +S SA   KF
Sbjct:   82 FGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDE-DKAFLKTEGSEEEKSIKTVNQLAHALHMDESLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAA-------EPEYMEDVRKQHTDRCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRMQRAQGMPETGGALAEGFQDRLKEFQNFERSFEECISHSAVKTKF 338          
BLAST of EOG090X01A3 vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 113.235 bits (282), Expect = 6.484e-25
Identity = 83/258 (32.17%), Postives = 149/258 (57.75%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEE-----KDIDELG-VINCSQEM-MGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVL-IKPRYIQEAKKILCDILRLPDN-EIESKIFFISANE----RM--AIFTNEVTAISAPKWDERNNEFASLFSYLQTKMSESADCKKF 1031
             G+TSSGKST+IN+ L + +LP+  G T+NCF+ ++G+ E ++ YL+    E     K +++L   ++  +++  G L+ +++ +AKC LL DD++++DSPG D      ++ID++  D+DV +LV +S + +  +E + F ++  KL+K N+ I+ N WD   S  + +  ++ ++++  +  L D L++ D+ E + +IFF+SA E    RM  A    E  A  A  +  R  EF       +  +S+SA   KF
Sbjct:   97 FGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGT-EGDKAYLMTEGSEEKKSVKTVNQLAHALHMDKDLGAGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHMERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMHKAQGMPEAGAALAEGFHTRFLEFQKFEKLFEECISQSAVKTKF 353          
BLAST of EOG090X01A3 vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 113.235 bits (282), Expect = 6.739e-25
Identity = 83/258 (32.17%), Postives = 149/258 (57.75%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEE-----KDIDELG-VINCSQEM-MGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVL-IKPRYIQEAKKILCDILRLPDN-EIESKIFFISANE----RM--AIFTNEVTAISAPKWDERNNEFASLFSYLQTKMSESADCKKF 1031
             G+TSSGKST+IN+ L + +LP+  G T+NCF+ ++G+ E ++ YL+    E     K +++L   ++  +++  G L+ +++ +AKC LL DD++++DSPG D      ++ID++  D+DV +LV +S + +  +E + F ++  KL+K N+ I+ N WD   S  + +  ++ ++++  +  L D L++ D+ E + +IFF+SA E    RM  A    E  A  A  +  R  EF       +  +S+SA   KF
Sbjct:   97 FGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGT-EGDKAYLMTEGSEEKKSVKTVNQLAHALHMDKDLGAGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHMERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMHKAQGMPEAGAALAEGFHTRFLEFQKFEKLFEECISQSAVKTKF 353          
BLAST of EOG090X01A3 vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 113.235 bits (282), Expect = 7.777e-25
Identity = 83/258 (32.17%), Postives = 149/258 (57.75%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEE-----KDIDELG-VINCSQEM-MGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVL-IKPRYIQEAKKILCDILRLPDN-EIESKIFFISANE----RM--AIFTNEVTAISAPKWDERNNEFASLFSYLQTKMSESADCKKF 1031
             G+TSSGKST+IN+ L + +LP+  G T+NCF+ ++G+ E ++ YL+    E     K +++L   ++  +++  G L+ +++ +AKC LL DD++++DSPG D      ++ID++  D+DV +LV +S + +  +E + F ++  KL+K N+ I+ N WD   S  + +  ++ ++++  +  L D L++ D+ E + +IFF+SA E    RM  A    E  A  A  +  R  EF       +  +S+SA   KF
Sbjct:   92 FGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGT-EGDKAYLMTEGSEEKKSVKTVNQLAHALHMDKDLGAGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHMERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMHKAQGMPEAGAALAEGFHTRFLEFQKFEKLFEECISQSAVKTKF 348          
BLAST of EOG090X01A3 vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 112.849 bits (281), Expect = 7.839e-25
Identity = 83/258 (32.17%), Postives = 149/258 (57.75%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEE-----KDIDELG-VINCSQEM-MGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVL-IKPRYIQEAKKILCDILRLPDN-EIESKIFFISANE----RM--AIFTNEVTAISAPKWDERNNEFASLFSYLQTKMSESADCKKF 1031
             G+TSSGKST+IN+ L + +LP+  G T+NCF+ ++G+ E ++ YL+    E     K +++L   ++  +++  G L+ +++ +AKC LL DD++++DSPG D      ++ID++  D+DV +LV +S + +  +E + F ++  KL+K N+ I+ N WD   S  + +  ++ ++++  +  L D L++ D+ E + +IFF+SA E    RM  A    E  A  A  +  R  EF       +  +S+SA   KF
Sbjct:   82 FGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGT-EGDKAYLMTEGSEEKKSVKTVNQLAHALHMDKDLGAGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHMERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMHKAQGMPEAGAALAEGFHTRFLEFQKFEKLFEECISQSAVKTKF 338          
BLAST of EOG090X01A3 vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 112.849 bits (281), Expect = 8.148e-25
Identity = 83/258 (32.17%), Postives = 149/258 (57.75%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEE-----KDIDELG-VINCSQEM-MGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVL-IKPRYIQEAKKILCDILRLPDN-EIESKIFFISANE----RM--AIFTNEVTAISAPKWDERNNEFASLFSYLQTKMSESADCKKF 1031
             G+TSSGKST+IN+ L + +LP+  G T+NCF+ ++G+ E ++ YL+    E     K +++L   ++  +++  G L+ +++ +AKC LL DD++++DSPG D      ++ID++  D+DV +LV +S + +  +E + F ++  KL+K N+ I+ N WD   S  + +  ++ ++++  +  L D L++ D+ E + +IFF+SA E    RM  A    E  A  A  +  R  EF       +  +S+SA   KF
Sbjct:   82 FGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGT-EGDKAYLMTEGSEEKKSVKTVNQLAHALHMDKDLGAGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHMERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMHKAQGMPEAGAALAEGFHTRFLEFQKFEKLFEECISQSAVKTKF 338          
BLAST of EOG090X01A3 vs. Ensembl Mouse
Match: Mfn2 (mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230])

HSP 1 Score: 105.916 bits (263), Expect = 6.480e-23
Identity = 78/265 (29.43%), Postives = 141/265 (53.21%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEE-----KDIDELGVINCSQEMM--GSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKK--------ILCDILRLPDN-EIESKIFFISANERMAIFTNEVTAIS------APKWDERNNEFASLFSYLQTKMSESADCKKF 1031
             G+TS+GKST+INA L + +LP+  G T+NCF+ + G+ + +  +L+    E     K +++L       E +  GS++++ +  +KCPLL DD++++DSPGID      ++ID++  D+DV +LV +S + +  +E   F ++  +L++ N+ I+ N WD   S       +P Y++E ++         L D L + D  +   +IFF+SA E ++    +   +       A  +  R  EF +     +  +S+SA   KF
Sbjct:  102 FGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGT-DGHEAFLLTEGSEEKKSVKTVNQLAHALHQDEQLHAGSMVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASAS-------EPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEGGGALAEGFQVRMFEFQNFERQFEECISQSAVKTKF 358          
BLAST of EOG090X01A3 vs. Ensembl Mouse
Match: Mfn2 (mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230])

HSP 1 Score: 105.531 bits (262), Expect = 1.262e-22
Identity = 78/265 (29.43%), Postives = 141/265 (53.21%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEE-----KDIDELGVINCSQEMM--GSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKK--------ILCDILRLPDN-EIESKIFFISANERMAIFTNEVTAIS------APKWDERNNEFASLFSYLQTKMSESADCKKF 1031
             G+TS+GKST+INA L + +LP+  G T+NCF+ + G+ + +  +L+    E     K +++L       E +  GS++++ +  +KCPLL DD++++DSPGID      ++ID++  D+DV +LV +S + +  +E   F ++  +L++ N+ I+ N WD   S       +P Y++E ++         L D L + D  +   +IFF+SA E ++    +   +       A  +  R  EF +     +  +S+SA   KF
Sbjct:  102 FGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGT-DGHEAFLLTEGSEEKKSVKTVNQLAHALHQDEQLHAGSMVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASAS-------EPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEGGGALAEGFQVRMFEFQNFERQFEECISQSAVKTKF 358          
BLAST of EOG090X01A3 vs. Ensembl Mouse
Match: Mfn2 (mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230])

HSP 1 Score: 105.531 bits (262), Expect = 1.262e-22
Identity = 78/265 (29.43%), Postives = 141/265 (53.21%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEE-----KDIDELGVINCSQEMM--GSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKK--------ILCDILRLPDN-EIESKIFFISANERMAIFTNEVTAIS------APKWDERNNEFASLFSYLQTKMSESADCKKF 1031
             G+TS+GKST+INA L + +LP+  G T+NCF+ + G+ + +  +L+    E     K +++L       E +  GS++++ +  +KCPLL DD++++DSPGID      ++ID++  D+DV +LV +S + +  +E   F ++  +L++ N+ I+ N WD   S       +P Y++E ++         L D L + D  +   +IFF+SA E ++    +   +       A  +  R  EF +     +  +S+SA   KF
Sbjct:  102 FGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGT-DGHEAFLLTEGSEEKKSVKTVNQLAHALHQDEQLHAGSMVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASAS-------EPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEGGGALAEGFQVRMFEFQNFERQFEECISQSAVKTKF 358          
BLAST of EOG090X01A3 vs. Ensembl Mouse
Match: Mfn2 (mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230])

HSP 1 Score: 105.531 bits (262), Expect = 1.262e-22
Identity = 78/265 (29.43%), Postives = 141/265 (53.21%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEE-----KDIDELGVINCSQEMM--GSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKK--------ILCDILRLPDN-EIESKIFFISANERMAIFTNEVTAIS------APKWDERNNEFASLFSYLQTKMSESADCKKF 1031
             G+TS+GKST+INA L + +LP+  G T+NCF+ + G+ + +  +L+    E     K +++L       E +  GS++++ +  +KCPLL DD++++DSPGID      ++ID++  D+DV +LV +S + +  +E   F ++  +L++ N+ I+ N WD   S       +P Y++E ++         L D L + D  +   +IFF+SA E ++    +   +       A  +  R  EF +     +  +S+SA   KF
Sbjct:  102 FGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGT-DGHEAFLLTEGSEEKKSVKTVNQLAHALHQDEQLHAGSMVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASAS-------EPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEGGGALAEGFQVRMFEFQNFERQFEECISQSAVKTKF 358          
BLAST of EOG090X01A3 vs. Ensembl Mouse
Match: Mfn1 (mitofusin 1 [Source:MGI Symbol;Acc:MGI:1914664])

HSP 1 Score: 102.834 bits (255), Expect = 8.009e-22
Identity = 78/265 (29.43%), Postives = 144/265 (54.34%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVV--NNEEKDIDELGVINCSQEM-----MGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKK--------ILCDILR-LPDNEIESKIFFISANERM------AIFTNEVTAISAPKWDERNNEFASLFSYLQTKMSESADCKKF 1031
             G+TSSGKS++INA L + +LP+  G T+NCF+ ++G+ + ++ YL+   ++E+K +  +  +  +  M      G L+ +++ +AKC LL DD++++DSPG D       +ID++  D+DV +LV +S + +  +E + F ++  +L+K N+ I+ N WD   S       +P Y+++ ++         L + L+ +  +E  ++IFF+SA E +      A    E     A  +  R  EF +     +  +S+SA   KF
Sbjct:   81 FGRTSSGKSSVINAMLWDKVLPSGIGHTTNCFLSVEGT-DGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDIWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASAS-------EPEYMEDVRRQHMERCLHFLVEELKVVSPSEARNRIFFVSAKEVLNSRKHKAQGMPEGGGALAEGFQARLQEFQNFEQTFEECISQSAVKTKF 337          
BLAST of EOG090X01A3 vs. UniProt/SwissProt
Match: sp|Q23424|FZO1_CAEEL (Transmembrane GTPase fzo-1 OS=Caenorhabditis elegans OX=6239 GN=fzo-1 PE=3 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 3.355e-22
Identity = 88/278 (31.65%), Postives = 147/278 (52.88%), Query Frame = 3
Query:  297 VVLGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEEKDID--ELGVI-------NCSQEMMG--SLITMYYDR----AKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVL-IKPRYIQEAKKILCDILRL-PDNEIESKIFFISANE----RMAIFTNEVTAISAPKWDERNNEFASLFSYLQTKMSESADCKKFADLNNTYLETLA 1067
            V  G+TS+GKST INA L E +LP   G T+ CF++++GS E    +L +++  + ID   LG I       N     MG  SL+ +++ +     +C LL +DV+I+DSPG+D      ++ID++  D+DV +LV ++ + +T +E N F R+  KL+K NV I+ N WD   +  +++  +K +++   ++ L D L +  + E+  +IFF+S+ E    R+        A  A     R  EF +   + +  +S SA   KF   N    E + 
Sbjct:  104 VFFGRTSNGKSTTINAMLHEKVLPQGMGHTTCCFLQVEGS-EGEVGHLQLDDNPQKIDMKMLGKIGHALSDENSDLPAMGQDSLLKVFHPKKSESGECRLLQNDVVILDSPGVDLSPEFDSWIDKHCLDADVFVLVSNAESTLTQAEKNFFLRVAKKLSKPNVFILNNRWDASAAETENIEDVKKQHLTRFRQFLVDELEVCSEREVNDRIFFVSSREVLESRLKARGLVQKAYQAEGHGTRALEFQNFERHFEHCISRSAIHTKFEAHNRRAHEMIG 380          
BLAST of EOG090X01A3 vs. UniProt/SwissProt
Match: sp|O95140|MFN2_HUMAN (Mitofusin-2 OS=Homo sapiens OX=9606 GN=MFN2 PE=1 SV=3)

HSP 1 Score: 106.301 bits (264), Expect = 5.305e-22
Identity = 70/215 (32.56%), Postives = 126/215 (58.60%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEE-----KDIDEL--GVINCSQEMMGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKK--------ILCDILRLPD-NEIESKIFFISANE 899
             G+TS+GKST+INA L + +LP+  G T+NCF+ ++G+ + +  +L+    E     K +++L   +    Q   GSL+++ +  +KCPLL DD++++DSPGID      ++ID++  D+DV +LV +S + +  +E + F ++  +L++ N+ I+ N WD   S       +P Y++E ++         L D L + D ++   +IFF+SA E
Sbjct:  102 FGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGT-DGHEAFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAGSLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASAS-------EPEYMEEVRRQHMERCTSFLVDELGVVDRSQAGDRIFFVSAKE 308          
BLAST of EOG090X01A3 vs. UniProt/SwissProt
Match: sp|Q80U63|MFN2_MOUSE (Mitofusin-2 OS=Mus musculus OX=10090 GN=Mfn2 PE=1 SV=3)

HSP 1 Score: 105.531 bits (262), Expect = 8.824e-22
Identity = 78/265 (29.43%), Postives = 141/265 (53.21%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEE-----KDIDELGVINCSQEMM--GSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKK--------ILCDILRLPDN-EIESKIFFISANERMAIFTNEVTAIS------APKWDERNNEFASLFSYLQTKMSESADCKKF 1031
             G+TS+GKST+INA L + +LP+  G T+NCF+ + G+ + +  +L+    E     K +++L       E +  GS++++ +  +KCPLL DD++++DSPGID      ++ID++  D+DV +LV +S + +  +E   F ++  +L++ N+ I+ N WD   S       +P Y++E ++         L D L + D  +   +IFF+SA E ++    +   +       A  +  R  EF +     +  +S+SA   KF
Sbjct:  102 FGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGT-DGHEAFLLTEGSEEKKSVKTVNQLAHALHQDEQLHAGSMVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASAS-------EPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEGGGALAEGFQVRMFEFQNFERQFEECISQSAVKTKF 358          
BLAST of EOG090X01A3 vs. UniProt/SwissProt
Match: sp|Q8IWA4|MFN1_HUMAN (Mitofusin-1 OS=Homo sapiens OX=9606 GN=MFN1 PE=1 SV=3)

HSP 1 Score: 103.99 bits (258), Expect = 2.426e-21
Identity = 75/265 (28.30%), Postives = 146/265 (55.09%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVV--NNEEKDIDELGVINCSQEM-----MGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKK--------ILCDILRLPDN-EIESKIFFISANERMAIFTNEVTAIS------APKWDERNNEFASLFSYLQTKMSESADCKKF 1031
             G+TSSGKS++INA L + +LP+  G  +NCF+ ++G+ + ++ YL+   ++E+K +  +  +  +  M      G L+ +++ +AKC LL DD++++DSPG D      ++ID++  D+DV +LV +S + +  +E + F ++  +L+K N+ I+ N WD   S       +P Y+++ ++         L + L++ +  E +++IFF+SA E ++    +   +       A  +  R  EF +     +  +S+SA   KF
Sbjct:   81 FGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGT-DGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAGCLVRVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASAS-------EPEYMEDVRRQHMERCLHFLVEELKVVNALEAQNRIFFVSAKEVLSARKQKAQGMPESGVALAEGFHARLQEFQNFEQIFEECISQSAVKTKF 337          
BLAST of EOG090X01A3 vs. UniProt/SwissProt
Match: sp|Q8R500|MFN2_RAT (Mitofusin-2 OS=Rattus norvegicus OX=10116 GN=Mfn2 PE=1 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.950e-21
Identity = 78/265 (29.43%), Postives = 140/265 (52.83%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEE-----KDIDELGVINCSQEMM--GSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKK--------ILCDILRLPDN-EIESKIFFISANERMAIFTNEVTAIS------APKWDERNNEFASLFSYLQTKMSESADCKKF 1031
             G+TS+GKST+INA L + +LP+  G T+NCF+ + G+ + +  +L+    E     K +++L       E +  GSL+++ +  +KCPLL D ++++DSPGID      ++ID++  D+DV +LV +S + +  +E   F ++  +L++ N+ I+ N WD   S       +P Y++E ++         L D L + D  +   +IFF+SA E ++    +   +       A  +  R  EF +     +  +S+SA   KF
Sbjct:  102 FGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGT-DGHEAFLLTEGSEEKKSVKTVNQLAHALHQDEQLHAGSLVSVMWPNSKCPLLKDGLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASAS-------EPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEGGGALAEGFQVRMFEFQNFERRFEECISQSAVKTKF 358          
BLAST of EOG090X01A3 vs. TrEMBL
Match: A0A4Y7NJU3 (EOG090X01A3 OS=Moina brachiata OX=675436 GN=EOG090X01A3 PE=2 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 1.883e-24
Identity = 88/265 (33.21%), Postives = 147/265 (55.47%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEE-----KDIDELGVINCSQEMM-GSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKK--------ILCDILRL--PDNEIESKIFFISANERMAIFTNEV------TAISAPKWDERNNEFASLFSYLQTKMSESADCKKF 1031
             G+TS+GKST+IN+ L E +LP+  G T+NCFI+++GS E+  +YL+  + +     K + +L    C+  +   SL+ +Y+   KCPLL DDV+++DSPGID      ++ID++  D+DV +LV +S + + ++E N F ++ ++L+K NV ++ N WD   +       +P Y++E +K         L D L++     E E ++FF+SA E +    NE       T + A  +  R  EF       +  +S+SA   KF
Sbjct:  106 FGRTSNGKSTVINSMLRERILPSGIGHTTNCFIQVEGS-ENGESYLICEDSDERKNVKSVSQLAHSLCTDSLGDSSLVRVYWPTDKCPLLRDDVVLVDSPGIDVSPNLDSWIDRHCLDADVFVLVANSESTLMLTEKNFFFKVSARLSKPNVFVLNNRWDASAN-------EPEYLEEVRKQHLLRTVDFLVDELKVCATRTEAEQRVFFVSAKEVLQARINEFKGVPINTGMVADGFHSRYFEFQDFERKFEECISKSAVRTKF 362          
BLAST of EOG090X01A3 vs. TrEMBL
Match: A0A4Y7NLE1 (EOG090X01A3 OS=Simocephalus serrulatus OX=117539 GN=EOG090X01A3 PE=2 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 5.230e-24
Identity = 87/265 (32.83%), Postives = 146/265 (55.09%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEE-----KDIDELGVINCSQEMM-GSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKK--------ILCDILRL--PDNEIESKIFFISANERMAIFTNEV------TAISAPKWDERNNEFASLFSYLQTKMSESADCKKF 1031
             G+TS+GKST+IN+ L E +LP+  G T+NCFI+++GS E+  +YL+  +       K + +L    C+  +   SL+ +Y+   KCPLL DDV+++DSPGID      ++ID++  D+DV +LV +S + + ++E N F ++ ++L+K NV ++ N WD   S       +P +++E ++         L D L++     E E ++FF+SA E +    NE       T + A  +  R  EF       +  +S+SA   KF
Sbjct:  108 FGRTSNGKSTVINSMLRERILPSGIGHTTNCFIQVEGS-ENGESYLISEDSADRKNVKSVSQLAHSLCTGSLGDSSLVRVYWPTDKCPLLRDDVVLVDSPGIDVSPNLDSWIDRHCLDADVFVLVANSESTLMLTEKNFFFKVSARLSKPNVFVLNNRWDASAS-------EPEFLEEVRRQHLLRTVDFLVDELKVCATRTEAEQRVFFVSAKEVLQARINEFKGLPINTGVVADGFHGRYFEFQDFERKFEECISKSAVRTKF 364          
BLAST of EOG090X01A3 vs. TrEMBL
Match: A0A1I7SVT7 (Dynamin-type G domain-containing protein OS=Bursaphelenchus xylophilus OX=6326 PE=3 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 5.738e-24
Identity = 80/215 (37.21%), Postives = 133/215 (61.86%), Query Frame = 3
Query:  297 VVLGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEEK-DIDELGVI-------NCSQEMMG--SLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICS---SHKDVLIKPRYIQEAKKILCDILRL-PDNEIESKIFFISANE 899
            V  G+TS+GKST+INA L   +LP   G T+ CF++++G  E+++++ V NNEEK  I+EL  +       N   + MG  SL+ ++Y +A   LL +DV+I+DSPG+D      ++ID++  D+DV +LV ++ + +T +E + F R+ SKL++ NV I+ N WD   S    H++ +++ ++     + L D L+    +E+ES+ FFISA E
Sbjct:   92 VFFGRTSNGKSTVINAMLHSKVLPQGMGHTTCCFLQVEGGSENDKHFKVENNEEKIPIEELDSVGHALSSGNSKLKAMGQDSLLRIFYPKAGSKLLQNDVVIVDSPGVDLSPEFDSWIDKHCIDADVFVLVCNAESTLTQAEKSFFHRVSSKLSRPNVFILNNRWDASASEPEKHRE-MVRAQHRTRFVQFLVDELKTCSKDEVESRYFFISAKE 305          
BLAST of EOG090X01A3 vs. TrEMBL
Match: A0A1D2MQ73 (Transmembrane GTPase Marf OS=Orchesella cincta OX=48709 GN=Ocin01_11721 PE=3 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 5.954e-24
Identity = 72/209 (34.45%), Postives = 128/209 (61.24%), Query Frame = 3
Query:  297 VVLGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEE-----KDIDELGVINCSQEMM-GSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDV-LIKPRYIQEAKKILCDILRLPDNE-IESKIFFISANE 899
            V  G+TS+GKST+INA L + +LP+  G T++CF++++GS   N +YL++ N       + + +L    C +++   SL+ +++ + KCPLL DDV+ +DSPGID       +ID+Y  D+DV +LV ++ + + ++E N F ++ ++++K N+ I+ N WD   S    V  ++ ++++ A   L   L++   E +  +IFFISA E
Sbjct:  101 VFFGRTSNGKSTVINAMLRDKILPSGIGHTTSCFLQVEGSETPNESYLILENTTERRSVQSVSQLAHALCKEKLTESSLVRVFWPKEKCPLLRDDVVFVDSPGIDVSPNLDEWIDKYCLDADVFVLVSNAESTLMLTEKNFFHKVSNQISKPNIFILNNRWDASASEIDFVDQVRAQHMERASDFLVSELKVVAKEQVGERIFFISAKE 309          
BLAST of EOG090X01A3 vs. TrEMBL
Match: A0A1B6IG39 (Dynamin-type G domain-containing protein (Fragment) OS=Homalodisca liturata OX=320908 GN=g.54100 PE=3 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 7.140e-24
Identity = 81/259 (31.27%), Postives = 148/259 (57.14%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEE-----KDIDELGVINCSQEM-MGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVL--IKPRYIQEAKKILCDILRL-PDNEIESKIFFISANERMAIFTNEVTAISAPK------WDERNNEFASLFSYLQTKMSESADCKKFA 1034
             G+TS+GKST+INA L + +LP+  G T+NCF++++GS ++  +YL+  N +     + +  LG   C +++   +L+ +++ R KC LL DDV+++DSPGID       +ID++  D+DV +LV ++ + + ++E N F ++ ++L+K N+ I++N WD   +S  + L  ++ ++++ A   L   L++    E + +IFF+SA E +     E   + A        +  R  EF       +  +S+SA   KFA
Sbjct:  106 FGRTSNGKSTVINAMLRDKILPSGIGHTTNCFLQVEGS-DNGESYLMTENSKEKQNVQSVGHLGHALCKEKLNESTLVRIFWPRDKCILLRDDVVLVDSPGIDVTPNLDEWIDKHCLDADVFVLVANAESTLMVTEKNFFHKVSTRLSKPNIFILHNRWDA-SASEPEFLDQVRVQHLERAIDFLVKELKVCSQKEAQERIFFVSAKEVLQGRLQEAKGLPAHSGALAEGFPNRYFEFQDFERKFEECISKSAVKTKFA 362          
BLAST of EOG090X01A3 vs. Ensembl Cavefish
Match: mfn1b (mitofusin-1 [Source:NCBI gene;Acc:103030239])

HSP 1 Score: 108.227 bits (269), Expect = 1.723e-23
Identity = 85/265 (32.08%), Postives = 142/265 (53.58%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVV--NNEEKDIDELGVINCSQEM-----MGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKK--------ILCDILRLPDN-EIESKIFFISA----NERM--AIFTNEVTAISAPKWDERNNEFASLFSYLQTKMSESADCKKF 1031
             G+TS+GKST+INA L + +LP+  G T+NCF+ ++G+ E ++ YL    + EEK I  +  +  +  M      G L+ +++ + KC LL DD++++DSPG D      ++ID++  D+DV +LV +S + +  +E + F ++  +L+K N+ I+ N WD   S       +P Y+ + +K         L + L++ D  E  + IFF+SA    N RM  A    E     A  + +R  EF S     +  +S+SA   KF
Sbjct:   82 FGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDE-DKAYLKTEGSEEEKSIKTVNQLAHALHMDESLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTQLDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASAS-------EPEYMDDVRKQHTDRCVNFLVEELKVVDREEAPNHIFFVSAKEVLNSRMQRAQGMPETGGALAEGFQDRLKEFQSFERTFEECISQSAVKTKF 338          
BLAST of EOG090X01A3 vs. Ensembl Cavefish
Match: mfn1b (mitofusin-1 [Source:NCBI gene;Acc:103030239])

HSP 1 Score: 107.457 bits (267), Expect = 2.330e-23
Identity = 85/265 (32.08%), Postives = 142/265 (53.58%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVV--NNEEKDIDELGVINCSQEM-----MGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKK--------ILCDILRLPDN-EIESKIFFISA----NERM--AIFTNEVTAISAPKWDERNNEFASLFSYLQTKMSESADCKKF 1031
             G+TS+GKST+INA L + +LP+  G T+NCF+ ++G+ E ++ YL    + EEK I  +  +  +  M      G L+ +++ + KC LL DD++++DSPG D      ++ID++  D+DV +LV +S + +  +E + F ++  +L+K N+ I+ N WD   S       +P Y+ + +K         L + L++ D  E  + IFF+SA    N RM  A    E     A  + +R  EF S     +  +S+SA   KF
Sbjct:   82 FGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDE-DKAYLKTEGSEEEKSIKTVNQLAHALHMDESLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTQLDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASAS-------EPEYMDDVRKQHTDRCVNFLVEELKVVDREEAPNHIFFVSAKEVLNSRMQRAQGMPETGGALAEGFQDRLKEFQSFERTFEECISQSAVKTKF 338          
BLAST of EOG090X01A3 vs. Ensembl Cavefish
Match: mfn2 (mitofusin 2 [Source:ZFIN;Acc:ZDB-GENE-081105-44])

HSP 1 Score: 105.531 bits (262), Expect = 9.700e-23
Identity = 82/267 (30.71%), Postives = 144/267 (53.93%), Query Frame = 3
Query:  297 VVLGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEE-----KDIDELG-VINCSQEM-MGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKK--------ILCDILRLPDNEIES-KIFFISANE------RMAIFTNEVTAISAPKWDERNNEFASLFSYLQTKMSESADCKKF 1031
            V  G+TS+GKS++INA L + +LP+  G T+NCF+ ++G+ + N  +L+    E     K +++L   ++  +++  GSL+ + + +AKC LL DD++++DSPGID      ++ID++  D+DV +LV +S + +  +E + F ++  +L+  N+ I+ N WD   S       +P Y++E ++         L D L + D    S +IFF+SA E      + A    E     A  +  R  EF +     +  +S+SA   KF
Sbjct:  100 VFFGRTSNGKSSVINAMLWDKVLPSGIGHTTNCFLRVEGT-DGNEAFLLTEGSEERKNVKTVNQLAHALHQDEDLDAGSLVCVMWPKAKCALLRDDLVLVDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKSFFHKVNERLSSPNIFILNNRWDASAS-------EPEYMEEVRRQHMDRCSSFLVDELGVVDRAQASDRIFFVSAKEVLQARVQKAQGMPEAGGALAEGFQARMFEFQNFERRFEECISQSAVKTKF 358          
BLAST of EOG090X01A3 vs. Ensembl Cavefish
Match: ENSAMXT00000043809.1 (mitofusin-1-like [Source:NCBI gene;Acc:103034819])

HSP 1 Score: 104.375 bits (259), Expect = 2.036e-22
Identity = 79/260 (30.38%), Postives = 144/260 (55.38%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNN--EEKDIDELGVINCSQEM-----MGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVL--IKPRYIQEAKKILCDILRL--PDNEIESKIFFISANERMAIFTN------EVTAISAPKWDERNNEFASLFSYLQTKMSESADCKKF 1031
             G+TS+GKST+INA L E +LP+  G T+NCFI ++G+ + ++ +L   N  E K I  +  +  +  M      G L+ +++ + KC LL DD++++DSPG D  +   ++ID++  D+DV +LV +S + +  +E + F ++  +++K N+ I+ N WD    +  + L  ++ +++      L D L++  PD +  ++IFF+SA E ++   +      E  A  A  + +R  EF S     +  +S S+   KF
Sbjct:   82 FGRTSNGKSTVINAMLRERVLPSGIGHTTNCFISVEGT-DGDQAFLTTENSEERKSIKTVNQLAHALHMDRNLDSGCLVRVFWPKTKCALLRDDLVLMDSPGTDVTSELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVSERISKPNIFILNNRWDA-SETEPEYLDGVRKQHMDRCVSFLVDELKVVSPD-QAPNRIFFVSAKEALSARIHRAQGMPETGAALADGFQDRLQEFQSFERTFEEFISHSSVKTKF 338          
BLAST of EOG090X01A3 vs. Ensembl Nematostella
Match: EDO42379 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1L1])

HSP 1 Score: 111.309 bits (277), Expect = 6.760e-25
Identity = 85/267 (31.84%), Postives = 148/267 (55.43%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVV--NNEEKDIDELGVINCS--QEMM--GSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDV----LIKPRYIQEAKKILCDILRLPD-NEIESKIFFISANE----RMAI---FTNEVTAISAPKWDERNNEFASLFSYLQTKMSESADCKKFADLNNT 1049
             G+TS+GKST++NA L + +LP   G T+NCF+ + GS +S   Y+++  ++E +++  LG I  +  +E +   SL+ +Y+ +++C +L +DV+++DSPGID       +ID++  D+DV +LV ++ + + ++E N F ++  KL+K N+ I+ N WD   +   DV    L+K +++Q     L   L+  D  + E ++FF+SA E    RM        E  AI    +  R  EF +     +  +S+SA   KF     T
Sbjct:  101 FGRTSNGKSTVVNAMLQDRILPMGIGHTTNCFLSVNGS-DSADPYILIPESDERRNVKTLGQIAHALFEEKLDHSSLVQVYWPKSRCKMLSEDVVLVDSPGIDVSPDLDLWIDKHCLDADVFVLVCNAESTLMVTEKNFFHKVNQKLSKPNIFILNNRWDA-SAGEPDVEMMELVKKQHLQRNVDFLSKELKCVDKKQAEDRVFFVSAKETLMSRMQKHQGMPEEGGAIHVDGFHGRKLEFENFEHKFEECISKSAIQTKFESHAGT 365          
BLAST of EOG090X01A3 vs. Ensembl Medaka
Match: mfn1b (mitofusin 1 [Source:NCBI gene;Acc:101158009])

HSP 1 Score: 112.464 bits (280), Expect = 7.075e-25
Identity = 86/265 (32.45%), Postives = 146/265 (55.09%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVV--NNEEKDIDELGVINCSQEM-----MGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKK--------ILCDILRLPDNE-IESKIFFISA----NERM--AIFTNEVTAISAPKWDERNNEFASLFSYLQTKMSESADCKKF 1031
             G+TS+GKST+INA L + +LP+  G T+NCF+ ++G+ + +R+YL    ++EEK I  +  +  +  M      G L+ +++ + KC LL DD++++DSPG D      ++ID++  D+DV +LV +S + +  +E + F ++  +L+K N+ I+ N WD   +       +P Y+++ +K         L + L++ D E   ++IFFISA    N RM  A    E     A  + ER  EF S     +  +S+SA   KF
Sbjct:   93 FGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGT-DDDRSYLKTEGSDEEKSIKTVNQMAHALHMDESLDAGCLVRVFWPKTKCALLRDDLVLVDSPGTDVTTQLDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASAN-------EPEYMEDVRKQHTDRCVNFLVEELKVVDREQAPNRIFFISAKEVLNSRMQRAQGMPETGGALAEGFQERLKEFQSFERRFEECISQSAVKTKF 349          
BLAST of EOG090X01A3 vs. Ensembl Medaka
Match: mfn1b (mitofusin 1 [Source:NCBI gene;Acc:101158009])

HSP 1 Score: 112.464 bits (280), Expect = 7.756e-25
Identity = 86/265 (32.45%), Postives = 146/265 (55.09%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVV--NNEEKDIDELGVINCSQEM-----MGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKK--------ILCDILRLPDNE-IESKIFFISA----NERM--AIFTNEVTAISAPKWDERNNEFASLFSYLQTKMSESADCKKF 1031
             G+TS+GKST+INA L + +LP+  G T+NCF+ ++G+ + +R+YL    ++EEK I  +  +  +  M      G L+ +++ + KC LL DD++++DSPG D      ++ID++  D+DV +LV +S + +  +E + F ++  +L+K N+ I+ N WD   +       +P Y+++ +K         L + L++ D E   ++IFFISA    N RM  A    E     A  + ER  EF S     +  +S+SA   KF
Sbjct:   93 FGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGT-DDDRSYLKTEGSDEEKSIKTVNQMAHALHMDESLDAGCLVRVFWPKTKCALLRDDLVLVDSPGTDVTTQLDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASAN-------EPEYMEDVRKQHTDRCVNFLVEELKVVDREQAPNRIFFISAKEVLNSRMQRAQGMPETGGALAEGFQERLKEFQSFERRFEECISQSAVKTKF 349          
BLAST of EOG090X01A3 vs. Ensembl Medaka
Match: mfn2 (mitofusin 2 [Source:NCBI gene;Acc:101170481])

HSP 1 Score: 104.375 bits (259), Expect = 2.253e-22
Identity = 82/266 (30.83%), Postives = 141/266 (53.01%), Query Frame = 3
Query:  297 VVLGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEEKD----IDELG-VINCSQEM-MGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKK--------ILCDILRLPDNEIES-KIFFISANERMAIFTNEVTAIS------APKWDERNNEFASLFSYLQTKMSESADCKKF 1031
            V  G+TS+GKST+INA L + +LP+  G T+NCF+ ++G+  S    L   +EEK     +++L   ++  Q++  GSL+ + + + KC LL DD++++DSPGID      ++ID++  D+DV +LV +S + +  +E + F ++  +L+  N+ I+ N WD   S       +P Y+ E ++         L + L + D    S +IFF+SA E +      V  +       A  +  R  EF +     +  +S+SA   KF
Sbjct:  100 VFFGRTSNGKSTVINAMLCDKVLPSGIGHTTNCFLRVEGTDGSEGFLLTEGSEEKKSIKTVNQLAHALHQDQDLDAGSLVCVMWPKVKCALLRDDLVLVDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKSFFHKVNERLSSPNIFILNNRWDASAS-------EPEYMDEVRRQHMDRCSNFLVEELGVVDRAQASDRIFFVSAKEVLQARMQRVQGMPEAGGALAEGFQARMFEFQNFERRFEECISQSAVKTKF 358          
BLAST of EOG090X01A3 vs. Ensembl Medaka
Match: ENSORLT00000009003.2 (pep primary_assembly:ASM223467v1:17:11595384:11602171:-1 gene:ENSORLG00000007178.2 transcript:ENSORLT00000009003.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.6709 bits (239), Expect = 3.675e-21
Identity = 74/245 (30.20%), Postives = 130/245 (53.06%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLV--VNNEEKDIDELGVINCSQEM-----MGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKKILCD---------ILRLPDNEIESKIFFISANE----RM--AIFTNEVTAISAPKWDERNNEF 971
             G+TS+GKST+INA L + +LP+  G T+NCF+ ++G+ + +  YL    + E + I  +  +  +  M        L+ +++ +++C LL +D++++DSPG D      ++ID++  D+DV +LV ++ + +  +E   F ++  +++K N+ I++N WD         + +P YIQE +K   D         +  +  NE   +IFFISA E    RM  A    E     A  + ER  EF
Sbjct:   80 FGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGT-DGDEAYLTSEASEERRSISTVNQLAHALHMDPTLDSSCLVKVFWPKSRCALLRNDLVLMDSPGTDVTLELDSWIDKFCLDADVFVLVGNAESTLMNTEKLFFHKVSERISKPNIFILHNRWDA-------SVTEPDYIQEVRKQHLDRCVGFLAEELGVVGPNEAPGRIFFISAKEVLSSRMQRAQGMPETGGALAEGFHERLTEF 316          
BLAST of EOG090X01A3 vs. Planmine SMEST
Match: SMESG000003246.1 (SMESG000003246.1)

HSP 1 Score: 986.482 bits (2549), Expect = 0.000e+0
Identity = 635/646 (98.30%), Postives = 637/646 (98.61%), Query Frame = 3
Query:   60 MSHNGFESRNKIVNKLFKLTKDIYCDDDKNVSLFNLCKNYENDWNVGINVGILPDISERNICXXXXXXXXXXXXXXXXXVVLGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEEKDIDELGVINCSQEMMGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKKILCDILRLPDNEIESKIFFISANERMAIFTNEVTAISAPKWDERNNEFASLFSYLQTKMSESADCKKFADLNNTYLETLANFNKCRCLIDEMKDKRIXXXXXXXXXXXXXXDFNSKINSEISAIFNDSYTDLLIKGXXXXXXXXXXXXXXXSNEEKYSLLEHETIQDQTVYGEGLRLSENEFEELLHQIIENSILKLTKRIIELSQSADDMDSFMLNKIFDIYFSQYLNLSEQLSHFDVGSLENNLIEINRKIKIASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAVKLPFHFAWKENDLAIKNMWNSFESVLTDSYNRFRDNMTSNXXXXXXXXXAKAMKIRNNLNSIAEDLNNFPNRP 1997
            MSHNGFESRNKIVNKLFKLTKDIYCDDDKNVS FNLCKNYENDWNVGINVGILPDISERNICDDFDLLKSKLNNNDKKFVVLGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEEKDIDELGVIN SQEMMGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVN IDQYFRDSDVIILVVSSVTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKKILCDILRLPDNEIESKIFFISANERMAIFTNEVTAISAPKWDERNNEFASLFSYLQ KMSESADCKKFADLNNTYLE LANFNKCRCLIDEMKDKRIELAAKLKNELKKLEDFNSKINSEISAIFNDSY DLLIKGKELLKKNPQLLNKNNSNEEKY LLE ETIQDQTVYGE LRLSENEFEELLHQIIENSILKLTKRIIELSQSA+DMDSFMLNKIFDIYFSQYLNLSEQLSHFDVGSLENNLIEINRKIKIASGVTIGLTAAVTAAGIATGGAAFAIIGLAEAAIVGAGAAGGGAVAGGVLGSGAAFGAVKAVKLPFHFAWKENDLAIKNMWNSFESVLTDSY+RFRDNMTSNITEIITTIEAKAMKIRNNLNSIAEDLNNFPNRP
Sbjct:    1 MSHNGFESRNKIVNKLFKLTKDIYCDDDKNVSFFNLCKNYENDWNVGINVGILPDISERNICDDFDLLKSKLNNNDKKFVVLGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEEKDIDELGVINGSQEMMGSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNLIDQYFRDSDVIILVVSSVTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKKILCDILRLPDNEIESKIFFISANERMAIFTNEVTAISAPKWDERNNEFASLFSYLQRKMSESADCKKFADLNNTYLEALANFNKCRCLIDEMKDKRIELAAKLKNELKKLEDFNSKINSEISAIFNDSYIDLLIKGKELLKKNPQLLNKNNSNEEKYPLLERETIQDQTVYGERLRLSENEFEELLHQIIENSILKLTKRIIELSQSANDMDSFMLNKIFDIYFSQYLNLSEQLSHFDVGSLENNLIEINRKIKIASGVTIGLTAAVTAAGIATGGAAFAIIGLAEAAIVGAGAAGGGAVAGGVLGSGAAFGAVKAVKLPFHFAWKENDLAIKNMWNSFESVLTDSYDRFRDNMTSNITEIITTIEAKAMKIRNNLNSIAEDLNNFPNRP 646          
BLAST of EOG090X01A3 vs. Planmine SMEST
Match: SMESG000002973.1 (SMESG000002973.1)

HSP 1 Score: 155.606 bits (392), Expect = 3.583e-39
Identity = 106/279 (37.99%), Postives = 168/279 (60.22%), Query Frame = 3
Query:  297 VVLGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEEKDID---ELGVINCSQEMM-GSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKKILCDILRLPDNEIESKIFFISANERMAIFTNEVTAISA-PKWDERNNEFASLFSYLQTKMSESADCKKFAD-LNNTYLETLANFNKCRCLIDEMKDKR 1115
            VV GKTSSGKS+LINA LTE +LPT  GSTSN F++IK S  S + Y+ +NNE K I+   EL  + C   +  GS + ++YD  KC LL +++ I+D+PGID D+   N + QYF+D ++IILVV+S++GI++ E    ++   K +K ++ IV+N WD    +     ++ +Y++ A K+L D L   +  + ++IFF+SA ER  IF+++   +   P +  RN  F      L+ +++ + + KK +D LN  +   L  FN     +D + +KR
Sbjct:   68 VVFGKTSSGKSSLINALLTEEILPTSCGSTSNSFVQIKAS-SSKKEYIRINNEVKTIESLRELTSLLCEGHIKDGSHVDLFYDPEKCSLLKENIEIVDTPGIDSDSKFDNSVVQYFKDVNLIILVVNSLSGISLIEKEFLRKFGGKFSKLHLLIVFNLWDFPDKAKNRDAVRKQYMESATKLLTDELGYSNENVSNRIFFLSAFERTNIFSSKAKTVRKDPLFKARNASFEQFLITLKDELA-TLEHKKESDCLNELHSLILKLFNNSNA-VDLIMNKR 343          
BLAST of EOG090X01A3 vs. Planmine SMEST
Match: SMESG000002973.1 (SMESG000002973.1)

HSP 1 Score: 154.836 bits (390), Expect = 1.828e-38
Identity = 104/278 (37.41%), Postives = 164/278 (58.99%), Query Frame = 3
Query:  297 VVLGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEEKDID---ELGVINCSQEMM-GSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKKILCDILRLPDNEIESKIFFISANERMAIFTNEVTAISA-PKWDERNNEFASLFSYLQTKMSESADCKKFADLNNTYLETLANFNKCRCLIDEMKDKR 1115
            VV GKTSSGKS+LINA LTE +LPT  GSTSN F++IK S  S + Y+ +NNE K I+   EL  + C   +  GS + ++YD  KC LL +++ I+D+PGID D+   N + QYF+D ++IILVV+S++GI++ E    ++   K +K ++ IV+N WD    +     ++ +Y++ A K+L D L   +  + ++IFF+SA ER  IF+++   +   P +  RN  F      L+ +++     K+   LN  +   L  FN     +D + +KR
Sbjct:   68 VVFGKTSSGKSSLINALLTEEILPTSCGSTSNSFVQIKAS-SSKKEYIRINNEVKTIESLRELTSLLCEGHIKDGSHVDLFYDPEKCSLLKENIEIVDTPGIDSDSKFDNSVVQYFKDVNLIILVVNSLSGISLIEKEFLRKFGGKFSKLHLLIVFNLWDFPDKAKNRDAVRKQYMESATKLLTDELGYSNENVSNRIFFLSAFERTNIFSSKAKTVRKDPLFKARNASFEQFLITLKDELATLEHKKESDCLNELHSLILKLFNNSNA-VDLIMNKR 343          
BLAST of EOG090X01A3 vs. Planmine SMEST
Match: SMESG000002973.1 (SMESG000002973.1)

HSP 1 Score: 154.066 bits (388), Expect = 4.650e-38
Identity = 104/278 (37.41%), Postives = 164/278 (58.99%), Query Frame = 3
Query:  297 VVLGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEEKDID---ELGVINCSQEMM-GSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRYIQEAKKILCDILRLPDNEIESKIFFISANERMAIFTNEVTAISA-PKWDERNNEFASLFSYLQTKMSESADCKKFADLNNTYLETLANFNKCRCLIDEMKDKR 1115
            VV GKTSSGKS+LINA LTE +LPT  GSTSN F++IK S  S + Y+ +NNE K I+   EL  + C   +  GS + ++YD  KC LL +++ I+D+PGID D+   N + QYF+D ++IILVV+S++GI++ E    ++   K +K ++ IV+N WD    +     ++ +Y++ A K+L D L   +  + ++IFF+SA ER  IF+++   +   P +  RN  F      L+ +++     K+   LN  +   L  FN     +D + +KR
Sbjct:   68 VVFGKTSSGKSSLINALLTEEILPTSCGSTSNSFVQIKAS-SSKKEYIRINNEVKTIESLRELTSLLCEGHIKDGSHVDLFYDPEKCSLLKENIEIVDTPGIDSDSKFDNSVVQYFKDVNLIILVVNSLSGISLIEKEFLRKFGGKFSKLHLLIVFNLWDFPDKAKNRDAVRKQYMESATKLLTDELGYSNENVSNRIFFLSAFERTNIFSSKAKTVRKDPLFKARNASFEQFLITLKDELATLEHKKESDCLNELHSLILKLFNNSNA-VDLIMNKR 343          
BLAST of EOG090X01A3 vs. Planmine SMEST
Match: SMESG000000387.1 (SMESG000000387.1)

HSP 1 Score: 114.775 bits (286), Expect = 1.096e-25
Identity = 89/277 (32.13%), Postives = 148/277 (53.43%), Query Frame = 3
Query:  303 LGKTSSGKSTLINAFLTENLLPTEFGSTSNCFIEIKGSLESNRNYLV------VNNEEKDIDELGVINCSQEMM----------GSLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRXXXXXXXXXXXXTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVL-IKPRYIQEAKKILCDILRL-PDNEIESKIFFISANERMAIFTNEV-----------TAISAPK----WDERNNEFASLFSYLQTKMSESADCKKFA 1034
             G+TS+GKST INA L   +LPT  G T++CF+EI+G+ + N+ ++       +N+E  D+ +   I+  +++            SLI +++   KCPLL  DV+I+DSPGID D     +ID Y  D+DV +LV +S + +  +E + F  + +KL+K N+ I+ N WD      + V  ++ ++ ++    L   L++    E ES++FF+SA+E + + + +             + S PK    W  R  EF +    L+  +SESA   KFA
Sbjct:   87 FGRTSNGKSTTINAMLGGKILPTGIGHTTSCFLEIQGT-DDNQGFIKISSPENINDESADVVDSKPIDSVKDLARDVSLNKLSSDSLIKIFWPNEKCPLLSQDVVILDSPGIDVDPDIDKWIDMYCLDADVFVLVANSESTLNHTEKSFFHNVSNKLSKPNIFILNNRWDASADQVEYVKEVREQHTEKCVAFLSKELKVCSKTEAESRVFFVSASEALNMRSRKAESSGGDSIAAGESPSLPKMREGWQSRLFEFTNFEKNLEKTLSESATKTKFA 362          
The following BLAST results are available for this feature:
BLAST of EOG090X01A3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MFN15.003e-2328.30mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262][more]
MFN21.105e-2232.56mitofusin 2 [Source:HGNC Symbol;Acc:HGNC:16877][more]
MFN21.105e-2232.56mitofusin 2 [Source:HGNC Symbol;Acc:HGNC:16877][more]
MFN15.052e-2228.30mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262][more]
MFN15.052e-2228.30mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262][more]
back to top
BLAST of EOG090X01A3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fzo-12.638e-2331.65Transmembrane GTPase fzo-1 [Source:UniProtKB/Swis... [more]
back to top
BLAST of EOG090X01A3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Marf1.602e-2231.60gene:FBgn0029870 transcript:FBtr0343373[more]
Marf6.570e-2231.73gene:FBgn0029870 transcript:FBtr0070910[more]
Marf6.570e-2231.73gene:FBgn0029870 transcript:FBtr0070909[more]
fzo1.701e-1627.34gene:FBgn0011596 transcript:FBtr0084399[more]
back to top
BLAST of EOG090X01A3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MFN11.030e-2530.94mitofusin 1a [Source:NCBI gene;Acc:100329462][more]
mfn1b8.270e-2332.09mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553... [more]
mfn1b9.285e-2332.09mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553... [more]
mfn21.944e-2229.96mitofusin 2 [Source:ZFIN;Acc:ZDB-GENE-081105-44][more]
mfn1b3.077e-2230.94mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553... [more]
back to top
BLAST of EOG090X01A3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfn16.484e-2532.17mitofusin 1 [Source:NCBI gene;Acc:548943][more]
mfn16.739e-2532.17mitofusin 1 [Source:NCBI gene;Acc:548943][more]
mfn17.777e-2532.17mitofusin 1 [Source:NCBI gene;Acc:548943][more]
mfn17.839e-2532.17mitofusin 1 [Source:NCBI gene;Acc:548943][more]
mfn18.148e-2532.17mitofusin 1 [Source:NCBI gene;Acc:548943][more]
back to top
BLAST of EOG090X01A3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mfn26.480e-2329.43mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230][more]
Mfn21.262e-2229.43mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230][more]
Mfn21.262e-2229.43mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230][more]
Mfn21.262e-2229.43mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230][more]
Mfn18.009e-2229.43mitofusin 1 [Source:MGI Symbol;Acc:MGI:1914664][more]
back to top
BLAST of EOG090X01A3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q23424|FZO1_CAEEL3.355e-2231.65Transmembrane GTPase fzo-1 OS=Caenorhabditis elega... [more]
sp|O95140|MFN2_HUMAN5.305e-2232.56Mitofusin-2 OS=Homo sapiens OX=9606 GN=MFN2 PE=1 S... [more]
sp|Q80U63|MFN2_MOUSE8.824e-2229.43Mitofusin-2 OS=Mus musculus OX=10090 GN=Mfn2 PE=1 ... [more]
sp|Q8IWA4|MFN1_HUMAN2.426e-2128.30Mitofusin-1 OS=Homo sapiens OX=9606 GN=MFN1 PE=1 S... [more]
sp|Q8R500|MFN2_RAT2.950e-2129.43Mitofusin-2 OS=Rattus norvegicus OX=10116 GN=Mfn2 ... [more]
back to top
BLAST of EOG090X01A3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y7NJU31.883e-2433.21EOG090X01A3 OS=Moina brachiata OX=675436 GN=EOG090... [more]
A0A4Y7NLE15.230e-2432.83EOG090X01A3 OS=Simocephalus serrulatus OX=117539 G... [more]
A0A1I7SVT75.738e-2437.21Dynamin-type G domain-containing protein OS=Bursap... [more]
A0A1D2MQ735.954e-2434.45Transmembrane GTPase Marf OS=Orchesella cincta OX=... [more]
A0A1B6IG397.140e-2431.27Dynamin-type G domain-containing protein (Fragment... [more]
back to top
BLAST of EOG090X01A3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mfn1b1.723e-2332.08mitofusin-1 [Source:NCBI gene;Acc:103030239][more]
mfn1b2.330e-2332.08mitofusin-1 [Source:NCBI gene;Acc:103030239][more]
mfn29.700e-2330.71mitofusin 2 [Source:ZFIN;Acc:ZDB-GENE-081105-44][more]
ENSAMXT00000043809.12.036e-2230.38mitofusin-1-like [Source:NCBI gene;Acc:103034819][more]
back to top
BLAST of EOG090X01A3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EOG090X01A3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EOG090X01A3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO423796.760e-2531.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of EOG090X01A3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mfn1b7.075e-2532.45mitofusin 1 [Source:NCBI gene;Acc:101158009][more]
mfn1b7.756e-2532.45mitofusin 1 [Source:NCBI gene;Acc:101158009][more]
mfn22.253e-2230.83mitofusin 2 [Source:NCBI gene;Acc:101170481][more]
ENSORLT00000009003.23.675e-2130.20pep primary_assembly:ASM223467v1:17:11595384:11602... [more]
back to top
BLAST of EOG090X01A3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003246.10.000e+098.30SMESG000003246.1[more]
SMESG000002973.13.583e-3937.99SMESG000002973.1[more]
SMESG000002973.11.828e-3837.41SMESG000002973.1[more]
SMESG000002973.14.650e-3837.41SMESG000002973.1[more]
SMESG000000387.11.096e-2532.13SMESG000000387.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032354 ID=SMED30032354|Name=EOG090X01A3|organism=Schmidtea mediterranea sexual|type=transcript|length=3265bp
CTGATTTTGAAATAATACAAATTATATAATTTATTTACTTGTATCGCGAA
TAATTTATAATGTCGCATAATGGATTTGAAAGCCGAAATAAAATTGTAAA
TAAACTATTCAAATTAACGAAAGATATTTATTGTGATGATGATAAAAATG
TTTCCTTATTTAATTTATGTAAAAATTATGAAAACGACTGGAATGTTGGA
ATTAATGTTGGAATTTTACCAGATATATCCGAAAGAAACATATGTGATGA
TTTTGATTTGTTGAAGTCAAAATTGAATAATAATGATAAAAAATTCGTGG
TTTTAGGAAAAACTTCATCGGGGAAATCAACTCTTATAAATGCTTTTTTG
ACAGAAAATTTGTTACCGACTGAGTTTGGGTCGACGTCTAACTGTTTCAT
TGAAATTAAGGGCAGCCTTGAGAGCAATAGAAATTACCTCGTGGTCAATA
ATGAAGAAAAAGACATTGATGAATTGGGTGTTATAAACTGCAGTCAAGAA
ATGATGGGTTCGCTCATTACCATGTATTATGACAGAGCGAAATGCCCCCT
CCTGGGGGATGATGTCATCATTATTGATTCTCCAGGAATTGATTTTGATA
ATTTATCGGTGAATTTTATTGATCAATACTTTAGAGATTCTGATGTGATC
ATATTGGTGGTCAGCTCAGTAACGGGGATTACCATATCTGAAATCAACCT
ATTTAAACGTTTACAATCAAAATTAACAAAATTTAATGTAGCAATTGTGT
ATAATTTTTGGGATGTCATCTGTTCAAGTCATAAAGATGTTTTGATAAAG
CCAAGATATATACAAGAAGCTAAAAAAATTCTTTGCGATATTTTGCGTCT
TCCTGACAATGAAATTGAGTCGAAAATATTTTTCATTTCCGCTAACGAAA
GAATGGCTATATTTACTAATGAAGTGACGGCGATTAGTGCTCCGAAATGG
GATGAACGCAACAACGAATTTGCTAGTCTTTTCTCATATTTGCAGACAAA
GATGAGCGAAAGTGCCGATTGCAAGAAATTTGCTGACTTGAATAATACAT
ATCTTGAAACGCTTGCCAATTTTAATAAATGCCGATGTTTAATAGACGAA
ATGAAAGATAAAAGGATAGAACTAGCTGCCAAATTAAAAAATGAGCTAAA
GAAATTAGAGGATTTCAATTCTAAAATTAATTCAGAAATTTCCGCAATAT
TTAATGACTCGTACACTGACTTACTTATAAAAGGAAAGGAACTTTTGAAA
AAAAACCCTCAACTTTTAAATAAAAATAATTCTAACGAAGAAAAGTATTC
TCTATTAGAACACGAGACTATACAAGACCAAACGGTGTACGGAGAAGGAT
TAAGATTGAGTGAAAACGAATTTGAGGAATTATTGCATCAAATAATCGAG
AATTCTATTCTTAAGTTAACAAAAAGAATCATTGAACTTTCTCAATCTGC
GGATGACATGGATTCATTCATGCTAAATAAAATTTTCGACATATATTTTT
CACAATATTTGAACTTGAGTGAGCAACTGAGTCATTTTGATGTCGGATCT
TTGGAAAACAATCTCATCGAAATAAATAGAAAAATCAAAATAGCGTCTGG
AGTTACTATTGGTTTGACTGCTGCAGTTACGGCGGCCGGAATTGCAACTG
GAGGAGCTGCGTTTGCTATTATCGGATTAGCGGAAGCAGCCATAGTTGGT
GCTGGAGCGGCCGGCGGAGGAGCTGTGGCTGGTGGTGTTCTTGGATCTGG
TGCAGCTTTCGGTGCTGTTAAAGCTGTGAAATTGCCTTTTCATTTCGCAT
GGAAAGAAAATGACTTGGCTATCAAAAACATGTGGAATTCATTCGAGTCG
GTACTGACCGACAGCTACAACAGATTCCGTGATAATATGACATCCAACAT
CACAGAAATTATTACAACAATTGAAGCAAAAGCAATGAAAATTCGAAACA
ATTTGAACAGTATAGCTGAAGATTTGAACAATTTCCCGAATAGGCCATAG
GCCAAAGAAAATGTCCATCGTCTGCCAATATAAAGTGATACCTGGCAATA
CTTTAAATTTACTTCACAACTGTAATAATCTATTTTATATTTTTTTAAAT
TCCAAGTTCTCTTCTCAATTACAGGAAATTAATTTTTTTGTAATTTGGTT
TACTTTATGAATGGTTATTAATGAGCAGCAACACAGGAGTCATTACCATG
GCTCAATCAAAACAGTTACACGGGTTTCAACTGAATAGCAACTCCTATAA
TAAAATGAAAAAATCAATAAAGTTATAATATAGGAACATACATACTTACC
CGTGTCTGCATGTAATTTGTTCAACTGAATAAAAACTTATATTATAGGAA
GGAAGGAATTTGAAGAAAATTTTTTTAAACATAAACACATAATACATAGT
AAATAATGCATGCAAACTTTCAAAATGTAGAAATGTTCAGTTCAATAAAA
ACTCTATATAAAACTATTTTTAGTAACTTTTTAGACAAGTTTTTTTTAAA
TTAAAGCCGAAAATTTTTGAAAAAAATACCAATAACTCTACTTTGAGTTG
TAGAGAAAATTAAGAAATAATTTCGTAAGATTTTTCATGAAATTCAATCA
ATTTAATATTTTTACAACTTTTCAGATATTTCAAAAATATCCATCGAAAC
TCTAGGTTTTTGAGGAGATGAAGAAATAACAATGTAACATTTAACTTGTA
CTTAAAATAAATTTATTTTTTACCTCATTTGCAATTTACCAGGAGCAGTG
GAACCAGAACCTTCAAATGAGGAGTTTAAATAACGGAAAACATAACTTAA
GTTTAAAAATAATATTTTTTATAGAATTATAAAAAGTCCAAATCATTAAT
ACCATTGAAAATGGGGAAGATTTTTATAAATTTGGGAAATTAACAGAAAT
TTCCAAAGCCTCATAAAATCAATAATTATCAAAAATTTGGATTTGTCAAA
AGGTAAAAAAGATGGCAGCCAAAACAAATTTCCAAGGAACAGAGGAATAG
TTTATTCGAATATAGAAACTTTTTAATAATAAATTTTAGTTTTCAATTAA
TCGGACTTACATTTATTCGAAAATAATTCCATTAATTTACATAAATTGGC
ATAAATTCCTAAAAAAAACCCAAGGAAAATTAATAAAAGTAAATTTAAAA
TACACGTTGATGAAAAGTATTATTTAAGAGCTTGAATAATGATCTCATAA
ATATACGAGATCACAATCCAAGCCTTAAAATATAGTTTATTAAAACATTT
ACCTGTTACCCATTT
back to top

protein sequence of SMED30032354-orf-1

>SMED30032354-orf-1 ID=SMED30032354-orf-1|Name=SMED30032354-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=647bp
MSHNGFESRNKIVNKLFKLTKDIYCDDDKNVSLFNLCKNYENDWNVGINV
GILPDISERNICDDFDLLKSKLNNNDKKFVVLGKTSSGKSTLINAFLTEN
LLPTEFGSTSNCFIEIKGSLESNRNYLVVNNEEKDIDELGVINCSQEMMG
SLITMYYDRAKCPLLGDDVIIIDSPGIDFDNLSVNFIDQYFRDSDVIILV
VSSVTGITISEINLFKRLQSKLTKFNVAIVYNFWDVICSSHKDVLIKPRY
IQEAKKILCDILRLPDNEIESKIFFISANERMAIFTNEVTAISAPKWDER
NNEFASLFSYLQTKMSESADCKKFADLNNTYLETLANFNKCRCLIDEMKD
KRIELAAKLKNELKKLEDFNSKINSEISAIFNDSYTDLLIKGKELLKKNP
QLLNKNNSNEEKYSLLEHETIQDQTVYGEGLRLSENEFEELLHQIIENSI
LKLTKRIIELSQSADDMDSFMLNKIFDIYFSQYLNLSEQLSHFDVGSLEN
NLIEINRKIKIASGVTIGLTAAVTAAGIATGGAAFAIIGLAEAAIVGAGA
AGGGAVAGGVLGSGAAFGAVKAVKLPFHFAWKENDLAIKNMWNSFESVLT
DSYNRFRDNMTSNITEIITTIEAKAMKIRNNLNSIAEDLNNFPNRP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005739mitochondrion
GO:0005741mitochondrial outer membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000105secretory cell
PLANA:0000231vitelline gland
PLANA:0000420parapharyngeal region
PLANA:0000463cholinergic neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR022812Dynamin_SF
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
Vocabulary: biological process
TermDefinition
GO:0008053mitochondrial fusion
GO:0048662negative regulation of smooth muscle cell proliferation