Tetratricopeptide repeat protein 27

Overview
NameTetratricopeptide repeat protein 27
Smed IDSMED30032346
Length (bp)2328
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tetratricopeptide repeat protein 27 (SMED30032346) t-SNE clustered cells

Violin plots show distribution of expression levels for Tetratricopeptide repeat protein 27 (SMED30032346) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tetratricopeptide repeat protein 27 (SMED30032346) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tetratricopeptide repeat protein 27 (SMED30032346) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032346

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30032346h1SMcG0020434 SmedASXL_006268SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30032346h1SMcG0020434 SmedASXL_006268SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30032346h1SMcG0020434 SmedASXL_006268SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30032346h1SMcG0020434 SmedASXL_006268SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30032346h1SMcG0020434 dd_Smed_v4_6638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032346h1SMcG0020434 dd_Smed_v4_6638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30032346h1SMcG0020434 dd_Smed_v4_6638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30032346h1SMcG0020434 dd_Smed_v4_6638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032346h1SMcG0020434 dd_Smed_v4_6638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30032346h1SMcG0020434 dd_Smed_v4_6638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Human
Match: TTC27 (tetratricopeptide repeat domain 27 [Source:HGNC Symbol;Acc:HGNC:25986])

HSP 1 Score: 321.627 bits (823), Expect = 5.426e-97
Identity = 213/716 (29.75%), Postives = 376/716 (52.51%), Query Frame = 2
Query:  152 SIELFLQINFTGP------KNNEIELILDNNAEIIKL---ISDDLTCEGEVPFIKTKGIILLWVAKLVTLKMRELKQDVYRSCLGYMKCIYLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINPVDELQFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQPSESADRINDILEGARVKNLPNDQMVXXXXXXXXXXXXXXXXNEKPLINKPTLA------------EQACLVLQASIHRLKHARDDTTME-QCSEILSCALGNNSTRSSTWSLITDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPSAENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAVVSGKHEE-------IRPKLKTLFARISSKDGRDPRIWMIYSDLLANDEDQSNEMKLKVLQCLSRAHHGMCASG-WELDKAQCKRAILSALRLVDKAIEYDINYASAKLAVKTVKAV 2209
            S++LF+Q N+TGP      ++    ++    +E+  L   +   LT +GE  +  T   ILL +A+++ + +R     +       ++C+ +HQ  L++ERS LL +  ++C +Q M+     ++       +QF L  +++ + +YEY K+++  +  + +  +  +  GALGKR + Q    +QL L + R+         D+L        P  Q         E     ++ N+  ++N   LA            E+  ++L    +  K+    T  E +     SC L    ++   W++ T AL+ R +L   S+RR E+++ Q + ++ QF     S   R+  F+  ++P  W +Q +   +L  +G T SAL +    + W  ++ C  + G  G+AE+I+RQ+++   ET  L C LGDV  D S Y++AW +S+ +SARA RS A+ ++  + +     ECFE+S+ I+P+Q+  WF+ GC  L L++Y+ +  AF++ + LEPDN EAWNN +++ + L  KV A   L+EA+K NYE+W++W+N  + S+  GEF+  IKAY++L+DL++ ++D   L +LV AV+ G  +        ++ KL+ LF R++S+   D  IW +Y+ +  N + +  +   K  QCLS+A+     S  WE D    K  +  AL L   AI+   N +S++ AV+ + +V
Sbjct:  100 SLQLFVQSNWTGPPVDLHPQDFLSSVLFQQFSEVKGLDAFVLSLLTLDGESIYSLTSKPILLLLARIILVNVRHKLTAIQSLPWWTLRCVNIHQH-LLEERSPLLFTLAENCIDQVMKLQNLFVDDSGRYLAIQFHLECAYVFLYYYEYRKAKDQLDIAKDISQLQIDLTGALGKRTRFQENYVAQLILDVRRE--------GDVLSNCEFTPAPTPQ---------EHLTKNLELNDDTILNDIKLADCEQFQMPDLCAEEIAIILGICTNFQKNNPVHTLTEVELLAFTSCLL----SQPKFWAIQTSALILRTKLEKGSTRRVERAMRQTQALADQFEDKTTSVLERLKIFYCCQVPPHWAIQRQLASLLFELGCTSSALQIFEKLEMWEDVVICYERAGQHGKAEEILRQELEK-KETPSLYCLLGDVLGDHSCYDKAWELSRYRSARAQRSKALLHL-RNKEFQECVECFERSVKINPMQLGVWFSLGCAYLALEDYQGSAKAFQRCVTLEPDNAEAWNNLSTSYIRLKQKVKAFRTLQEALKCNYEHWQIWENYILTSTDVGEFSEAIKAYHRLLDLRDKYKDVQVLKILVRAVIDGMTDRSGDVATGLKGKLQELFGRVTSRVTNDGEIWRLYAHVYGNGQSEKPDENEKAFQCLSKAYKCDTQSNCWEKDITSFKEVVQRALGLAHVAIKCSKNKSSSQEAVQMLSSV 791          
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Human
Match: TTC27 (tetratricopeptide repeat domain 27 [Source:HGNC Symbol;Acc:HGNC:25986])

HSP 1 Score: 71.633 bits (174), Expect = 1.228e-14
Identity = 37/88 (42.05%), Postives = 58/88 (65.91%), Query Frame = 2
Query: 1277 CLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQ 1540
            C  + G  G+AE+I+RQ+++   ET  L C LGDV  D S Y++AW +S+ +SARA RS A+ ++  + +     ECFE+S+ I+P+Q
Sbjct:    2 CYERAGQHGKAEEILRQELEKK-ETPSLYCLLGDVLGDHSCYDKAWELSRYRSARAQRSKALLHL-RNKEFQECVECFERSVKINPMQ 87          
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Human
Match: TTC27 (tetratricopeptide repeat domain 27 [Source:HGNC Symbol;Acc:HGNC:25986])

HSP 1 Score: 54.6842 bits (130), Expect = 3.140e-7
Identity = 50/194 (25.77%), Postives = 101/194 (52.06%), Query Frame = 2
Query:  152 SIELFLQINFTGP------KNNEIELILDNNAEIIKL---ISDDLTCEGEVPFIKTKGIILLWVAKLVTLKMRELKQDVYRSCLGYMKCIYLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINPVDELQFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQ 706
            S++LF+Q N+TGP      ++    ++    +E+  L   +   LT +GE  +  T   ILL +A+++ + +R     +       ++C+ +HQ  L++ERS LL +  ++C +Q M+     ++       +QF L  +++ + +YEY K+++  +  + +  +  +  GALGKR + Q    +QL L + R+
Sbjct:  100 SLQLFVQSNWTGPPVDLHPQDFLSSVLFQQFSEVKGLDAFVLSLLTLDGESIYSLTSKPILLLLARIILVNVRHKLTAIQSLPWWTLRCVNIHQH-LLEERSPLLFTLAENCIDQVMKLQNLFVDDSGRYLAIQFHLECAYVFLYYYEYRKAKDQLDIAKDISQLQIDLTGALGKRTRFQENYVAQLILDVRRE 292          
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Celegans
Match: trd-1 (Tetratricopeptide repeat-containing protein trd-1 [Source:UniProtKB/Swiss-Prot;Acc:P41842])

HSP 1 Score: 184.496 bits (467), Expect = 1.399e-48
Identity = 148/576 (25.69%), Postives = 261/576 (45.31%), Query Frame = 2
Query:  239 KLISDDLTCEGEVPFIKTKGIILLWVAKLVTLKMRELKQDVYRSCLGYMKCI--YLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINPVDELQFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQPSESADRINDILEGARVKNLPNDQMVXXXXXXXXXXXXXXXXNEKPLINKPTLAEQ--------------ACLVLQASIHRLKHARDDTTMEQCSEILSCALGNNSTRSSTWSLITDALLQRCELPTKSSRRTEKSLMQMEEI-----STQFTHLIPSAENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAVVSGKHE 1903
            +L    L+C   +P   +K    LW   L    + +LK       +GY   +  YL    L+ +    ++++++    +         +     D  Q  L  + +  +FYEY K++ +     +   ++ +  G +GKR + Q    +QL L + + PS +               LP D  +             +D N+  L+ +  + EQ              +CL+  A      H  D    E+CS +L   +         WS+   ALL R EL     R+ ++S  Q E +           LI     R  +   S L   W+  +    IL ++G T  AL +L   + W  +IDC  Q+G   +AE +IR+ I+     + L   LGD+T++  ++ +A  +S +++ARA RSL  H + +D     A +   +SL + P+Q+ TWF  G C  +L+ ++++   + + + L+PD+FEAWNN ++A +    K  A  LL+EA+KYNYE+  VW+N  ++S   GEF+  I+AY++L+D+ +   D   L ++   ++  + E
Sbjct:   61 ELARQKLSCGLNIPNAVSKS---LWALHLAHEHVEKLKDLSDIPPIGYRVILEFYLVWQQLLIDPEETIRTEIEPIMEKLRVLIAEENDAFTSEDRCQIQLEMAAVRFQFYEYDKADNLIKSASEECQLNMDLSGMMGKRTRFQQRDIAQLVL-IHKDPSTTG------------TPLPPDSDI----------PQSLDMNDDTLLEQVAITEQGARVDGRTLNACQLSCLLWIARHESATHRHDVLVHERCSPVLDTVIAAR----RYWSIQAAALLARAELERGRVRQVDRSCTQSELVVKLQQGVDDPVLIKDRLLRTSYILASGLTPFWQSSVLLAGILNSLGCTSEALLILEKLEMWDGVIDCYKQLGQMDKAETLIRRLIEQKPNDSMLHVYLGDITRNLEYFTKAIELSDDRNARAHRSLG-HLLLMDKKFEEAYKHLRRSLELQPIQLGTWFNAGYCAWKLENFKESTQCYHRCVSLQPDHFEAWNNLSAAYIRHGQKPKAWKLLQEALKYNYEHPNVWENYMLLSVDVGEFSQAIQAYHRLLDMNKRGADDEVLELIAQTLLRREAE 605          
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Fly
Match: CG5290 (gene:FBgn0036772 transcript:FBtr0075152)

HSP 1 Score: 196.052 bits (497), Expect = 2.461e-52
Identity = 207/746 (27.75%), Postives = 348/746 (46.65%), Query Frame = 2
Query:  164 FLQINFTGP--KNNEIELILDNNAEIIKLIS-DDLTCEGEVPFIKTKGIILLWVAKLVTLKMRELKQDVYRSCLGYMKCIYLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINPVDELQFLLLASHLHIKFYEYHKSE---EIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALS----RQPSESADRINDILEGARVKNLPNDQMVXXXXXXXXXXXXXXXXNEKPLINKPTLAEQACLVLQASIHRLKHA--RDDTTMEQCSEILSCALGNNSTRSSTWSLITDALLQRCELPTKSSRRTEKSLMQMEE----ISTQFTHLIPSAENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAVV----SGKHEEIRPKLKTLFARISSKDGRDPRIWMIYSDLLANDEDQSNEMKLKVLQCLSRAHHGMCASGWELDKAQCKRAILSALRLVDKAI---------EYDI----NYASAKLA--------VKTVKAVMESRKSKQVEQLDDEVQDLLTKI 2278
            F+Q +FTGP  K  E + I  +  E+ KL + + L   GE      K + LL +A+ +   + E   +        ++ I LHQ  L D+ +A L  Q +      ++ + N  E+      L   L   +L     ++H+SE   +I +E+ K L +  +  G LG R K Q     QL L +     +QP   A + N+  +  ++  L +D  +E    ++          +  ++  P++ +   LVL A + +LK +  +D    EQ        L         + +   ALL  C   +   R  E+S  Q EE    + T    L  S  +R+ + F + L   W+VQL+   +L ++GMT++ALD+ L    W  +I+C   +  R +A +IIRQ+++    TA L C LGD   D S YE+AW  SK+ S +A      H+ +  +D+  A + FE SL I+ LQ A     G C +QL+ +  AV  +     LEP+ FE+WNN A A+++L DK  A  +L EA+K NY NW+VW+N  +VS     +   ++AY ++ +LK+ + D   L  +V  V     +G    I+ +L  L  + S + G +P +W + + L+A    +  E  +K  +  +  H      GWE       +A+   L + D ++         E ++       SA+LA         + +   + + ++ +VEQL+  ++D LTKI
Sbjct:   77 FVQNSFTGPFDKLEEYQQI-HSELELEKLDALEKLKASGEELNPNVKSVELLLIAREILEGLLENHPESKVLIWWRLRLICLHQHVL-DDLAASLYEQFKSAAGH-LQAHFNQFESRELQSLLLLELANGYL-----QFHRSEIASQILDELCKHLQVELKVEGLLGVRTKFQQKALPQLCLKVEHLNEQQPLPPAVQTNETTKLPKLLLLEDDTRLERIRFVEL--------KDNEVMTLPSVLQ--ALVL-AKVKQLKRSTPKDRLADEQLEPYTQTLLYQEH---GPFQVRQSALLLNCLQESNQRRTVERSWKQCEECVKLLDTSEEEL--SLRSRLSYGFAAHLSPKWQVQLQLVDLLRSLGMTKTALDICLRIHAWQQVIECYTSLELRHKAAEIIRQELEK-KPTALLYCLLGDAIDDPSFYEQAWLYSKKTSGKAQAYWGNHF-YRSADYAQAMDHFEISLEINNLQEAILLRCGYCAIQLERWEPAVKYYLAYTHLEPNGFESWNNLAKALIKLGDKQRAHRVLGEALKCNYSNWKVWENYMLVSVDTSHWDDAMRAYQRMAELKQHYLDQEVLTRIVYGVSKEDPAGSSALIK-RLIKLLGQQSIQHGNEPLVWEL-AALVAQTPLKKAEKLVKSYRAYTPKH-----LGWETKSEHALKALDLCLEVCDLSVAAITEHIQEESEVMITSQLNSARLAGTSCLNALKRAINVDVSAEQTAKVEQLEKRIED-LTKI 788          
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Zebrafish
Match: ttc27 (tetratricopeptide repeat domain 27 [Source:ZFIN;Acc:ZDB-GENE-030102-1])

HSP 1 Score: 303.523 bits (776), Expect = 1.498e-90
Identity = 221/718 (30.78%), Postives = 365/718 (50.84%), Query Frame = 2
Query:  155 IELFLQINFTGP------KNNEIELILDNNAEIIKLIS---DDLTCEGEVPF---------IKTKGIILLWVAKLVTLKMRELKQDVYRSCLGYMKCIYLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINPVDELQFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQPSESADRINDILEGARVKNL-PNDQMVXXXXXXXXXXXXXXXXNEKPLINKPTLAEQACLVLQASIHRLKHARDDTTMEQCSEILSCALGNNSTRSSTWSLITDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPSAENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAVVS------GKHEEI-RPKLKTLFARISSKDGRDPRIWMIYSDLLANDEDQSNEMKLKVLQCLSRAHHGMC-ASGWELDKAQCKRAILSALRLVDKAIEYDINYASAKLAVKTVKAVMESRKS 2227
            + LF Q N+TGP       +   E +L N ++   L +     L  +GE  +         + T+ I +   AKL +L++              ++ + LHQ  +++ERS  L + M  C  +  + +E      +    +QF L  S++ + +YEYHK++E     + L G+     GALGKR + Q    +QL L + R+ +               K L P D  + D+T+L++    E  ++E P ++     EQA ++   +  +  +       E+     +C L    ++   W++   +L  R +L   SSRR E+++MQ + +   F+        R+  F+  R P +W++Q +   +L  +G+T SAL +    + W   + CL ++G  G+AE+I+R++++   ET  L C LGDV KD  +Y+RAW +SK +SARA RS A+H++    +     ECFE+SL I+ +Q+  WF+ GC    L+ Y  A  AF++ + LEPDN EAWNN ++A ++L  K  A   L+EA+K NYE W++W+N   V    GEF+  I+AY++LM+LK+ ++D   L +LV AVV       G+   I RPKL+ L  R+SS+   D +IW  Y+ L  +    + E   K LQ LS+AH     A+GWE D    K  +  A  + + +I    +  S + A++ + +   S KS
Sbjct:   96 LNLFAQSNWTGPPVELHVSDVLPEALLQNFSQPAALSTALLSSLQLDGESVYSLVSNPLLLLLTRVIFVNCAAKLESLQLLPW---------WTLRYVALHQ-QILEERSPQLLNLMLSCIEKVCKCDELFSSNAHRNLAIQFHLECSYICLTYYEYHKAKEHLQTARDLSGLDVNMTGALGKRTRFQENFLAQLILDVKRKDNSPFYNSESPSSTPTPKELLPKDHQLSDDTVLNQINLAEPSEHELPDLSA---EEQAFILATCTDFQKNNPVHKLNDEELLAFTTCLL----SQPKFWAVEVTSLCLRTKLERGSSRRVERAMMQTQTLVDFFSEKDCPVTERLKMFYSCRAPPLWDLQRQLASLLTDLGLTSSALLIYERLELWEDAVVCLERMGQHGKAEEILRRELEK-KETPSLYCLLGDVLKDPQYYDRAWELSKHRSARAQRSKALHHL-RHREFQQCVECFERSLQINSMQLGVWFSLGCAYFALESYEGAARAFQRCVGLEPDNSEAWNNLSTAYIKLRVKEKAFRTLQEALKCNYERWQIWENFIAVCVDLGEFSEAIRAYHRLMELKDKYKDVEVLEILVQAVVDNLTDHRGEQASILRPKLQELLGRVSSRCSTDAQIWKQYARLYGDGHSNNAEDNEKALQFLSKAHRCETQAAGWEKDTGSFKSVVKGARDMANVSISCSRSKRSPQEALQLLSSARLSLKS 794          
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Zebrafish
Match: ttc27 (tetratricopeptide repeat domain 27 [Source:ZFIN;Acc:ZDB-GENE-030102-1])

HSP 1 Score: 51.2174 bits (121), Expect = 3.599e-6
Identity = 33/108 (30.56%), Postives = 57/108 (52.78%), Query Frame = 2
Query:  383 MKCIYLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINPVDELQFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQ 706
            ++ + LHQ  +++ERS  L + M  C  +  + +E      +    +QF L  S++ + +YEYHK++E     + L G+     GALGKR + Q    +QL L + R+
Sbjct:  181 LRYVALHQ-QILEERSPQLLNLMLSCIEKVCKCDELFSSNAHRNLAIQFHLECSYICLTYYEYHKAKEHLQTARDLSGLDVNMTGALGKRTRFQENFLAQLILDVKRK 287          
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Zebrafish
Match: BX004877.1 (pep chromosome:GRCz11:CHR_ALT_CTG17_1_15:22762959:22812792:1 gene:ENSDARG00000110340.1 transcript:ENSDART00000187140.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX004877.1)

HSP 1 Score: 50.8322 bits (120), Expect = 3.728e-6
Identity = 33/108 (30.56%), Postives = 57/108 (52.78%), Query Frame = 2
Query:  383 MKCIYLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINPVDELQFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQ 706
            ++ + LHQ  +++ERS  L + M  C  +  + +E      +    +QF L  S++ + +YEYHK++E     + L G+     GALGKR + Q    +QL L + R+
Sbjct:  181 LRYVALHQ-QILEERSPQLLNLMLSCIEKVCKCDELFSSNAHRNLAIQFHLECSYICLTYYEYHKAKEHLQTARDLSGLDVNMTGALGKRTRFQENFLAQLILDVKRK 287          
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Xenopus
Match: adamts6 (ADAM metallopeptidase with thrombospondin type 1 motif 6 [Source:Xenbase;Acc:XB-GENE-951750])

HSP 1 Score: 345.895 bits (886), Expect = 9.248e-107
Identity = 232/742 (31.27%), Postives = 390/742 (52.56%), Query Frame = 2
Query:   89 SFELFNFISSCDLIPFDVYNQSIELFLQINFTGPKNNEI------ELILDNNAEIIKLISDDLTC---EGEVPFIKTKGIILLWVAKLVTLKMRELKQDVYRSCLGYMKCIYLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINPVDELQFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQPSESADRINDIL--EGARVKNLPNDQMVXXXXXXXXXXXXXXXXNEKPLINKPTL-AEQACLVLQASIHRLKH-ARDDTTMEQCSEILSCALGNNSTRSSTWSLITDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPSAENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAVVSGKHEE-------IRPKLKTLFARISSKDGRDPRIWMIYSDLLANDEDQSNEMKLKVLQCLSRAHHGMC-ASGWELDKAQCKRAILSALRLVDKAIEYDINYASAKLAVKTVKAVM-----ESRKSKQV 2236
            +F  +    S  L+ F +    + LF+Q N+TGP    I        + ++ +E   + +  L+C   +GE  +  T   I L +A+++ +K+R    +        ++CI +HQ  L+DERS  L +  Q C N+  +     LE       +Q  L  S+  + +Y+Y  ++E  N  + +  +     GALGKR + Q    +QL L + R+         D+   +G      P + + +++ L D+T   +I   +    + P L AE+  ++L   I   K+      T E+     SC L    ++   W+L T ALL R +L   S+RR E+++MQ + ++ QF    P+   R+  F+ S++P+IW++Q +   +L  +G T SAL +    + W  ++ C  ++G  G+AE+I+RQ+++   ET +L C LGDV KD  +Y++AW +S  +SAR+ RS  + ++  + +    AECFEKS+ I+P+Q+  WF+ GC  + L+EY  A  AF++ + LEPDN EAWNN +SA + L  K+ A   L+EA+K NYE+W++W+N  + S+  GEF   +KAY++LMDL++  +D   L +LV AVV G  +        ++PKL  L  R++S+D  D  IW +Y+ L  N   + ++   K LQ L +AH      +GWE D +  K  I  A+ L   A++     ++ + AV+ + +        S K+KQV
Sbjct:   17 TFLAYPRFPSRQLMVFLLGVSCLHLFVQSNWTGPPIISIPQDFLPSSLFEHFSEQKAVSATILSCLILDGESAYSLTANPIFLLIARVIFVKLRNKLTEFQMLPWWTLRCINVHQ-QLLDERSPELFAIAQTCTNEIQKCKNFFLEEAAQDLSVQQCLECSYTCLYYYDYKNAKEHLNAAKDMTTLQINLTGALGKRTRFQENNVAQLILDVQRK--------GDLFLRQGLTPAPTPIEYLPKNQDLEDDTVLNQIKLEDPEQFHIPDLCAEELAVILGVCIDFQKNNPVHKLTEEELLAFNSCLL----SQPKFWALQTTALLMRTKLEKGSARRVERAMMQTQALADQFQQKEPNCTERLKMFYCSQMPAIWDIQRQLASLLFDLGCTSSALQIFEKLEMWEDVVICYERLGQHGKAEEILRQELEK-KETPRLYCLLGDVLKDHQYYDKAWELSNHRSARSQRSKGLLHL-RNKEFKQCAECFEKSVKINPIQLGVWFSLGCAYITLQEYEGAAKAFQRCVTLEPDNAEAWNNLSSAYIRLKQKIKAFRTLQEAIKCNYEHWQIWENYLLTSTDVGEFAEAVKAYHRLMDLRDKFKDVQVLKILVRAVVEGIEDHKGESTSNLKPKLLELMGRVTSRDSSDAEIWKVYARLCGNGASEKDDENDKALQYLIKAHKCETQKTGWESDVSSFKEIIRGAVELAHVAMKCSERKSNPQEAVQILSSARLNLRSLSSKAKQV 743          
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Xenopus
Match: adamts6 (ADAM metallopeptidase with thrombospondin type 1 motif 6 [Source:Xenbase;Acc:XB-GENE-951750])

HSP 1 Score: 345.125 bits (884), Expect = 1.081e-106
Identity = 228/720 (31.67%), Postives = 382/720 (53.06%), Query Frame = 2
Query:  155 IELFLQINFTGPKNNEI------ELILDNNAEIIKLISDDLTC---EGEVPFIKTKGIILLWVAKLVTLKMRELKQDVYRSCLGYMKCIYLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINPVDELQFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQPSESADRINDIL--EGARVKNLPNDQMVXXXXXXXXXXXXXXXXNEKPLINKPTL-AEQACLVLQASIHRLKH-ARDDTTMEQCSEILSCALGNNSTRSSTWSLITDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPSAENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAVVSGKHEE-------IRPKLKTLFARISSKDGRDPRIWMIYSDLLANDEDQSNEMKLKVLQCLSRAHHGMC-ASGWELDKAQCKRAILSALRLVDKAIEYDINYASAKLAVKTVKAVM-----ESRKSKQV 2236
            + LF+Q N+TGP    I        + ++ +E   + +  L+C   +GE  +  T   I L +A+++ +K+R    +        ++CI +HQ  L+DERS  L +  Q C N+  +     LE       +Q  L  S+  + +Y+Y  ++E  N  + +  +     GALGKR + Q    +QL L + R+         D+   +G      P + + +++ L D+T   +I   +    + P L AE+  ++L   I   K+      T E+     SC L    ++   W+L T ALL R +L   S+RR E+++MQ + ++ QF    P+   R+  F+ S++P+IW++Q +   +L  +G T SAL +    + W  ++ C  ++G  G+AE+I+RQ+++   ET +L C LGDV KD  +Y++AW +S  +SAR+ RS  + ++  + +    AECFEKS+ I+P+Q+  WF+ GC  + L+EY  A  AF++ + LEPDN EAWNN +SA + L  K+ A   L+EA+K NYE+W++W+N  + S+  GEF   +KAY++LMDL++  +D   L +LV AVV G  +        ++PKL  L  R++S+D  D  IW +Y+ L  N   + ++   K LQ L +AH      +GWE D +  K  I  A+ L   A++     ++ + AV+ + +        S K+KQV
Sbjct:   20 LHLFVQSNWTGPPIISIPQDFLPSSLFEHFSEQKAVSATILSCLILDGESAYSLTANPIFLLIARVIFVKLRNKLTEFQMLPWWTLRCINVHQ-QLLDERSPELFAIAQTCTNEIQKCKNFFLEEAAQDLSVQQCLECSYTCLYYYDYKNAKEHLNAAKDMTTLQINLTGALGKRTRFQENNVAQLILDVQRK--------GDLFLRQGLTPAPTPIEYLPKNQDLEDDTVLNQIKLEDPEQFHIPDLCAEELAVILGVCIDFQKNNPVHKLTEEELLAFNSCLL----SQPKFWALQTTALLMRTKLEKGSARRVERAMMQTQALADQFQQKEPNCTERLKMFYCSQMPAIWDIQRQLASLLFDLGCTSSALQIFEKLEMWEDVVICYERLGQHGKAEEILRQELEK-KETPRLYCLLGDVLKDHQYYDKAWELSNHRSARSQRSKGLLHL-RNKEFKQCAECFEKSVKINPIQLGVWFSLGCAYITLQEYEGAAKAFQRCVTLEPDNAEAWNNLSSAYIRLKQKIKAFRTLQEAIKCNYEHWQIWENYLLTSTDVGEFAEAVKAYHRLMDLRDKFKDVQVLKILVRAVVEGIEDHKGESTSNLKPKLLELMGRVTSRDSSDAEIWKVYARLCGNGASEKDDENDKALQYLIKAHKCETQKTGWESDVSSFKEIIRGAVELAHVAMKCSERKSNPQEAVQILSSARLNLRSLSSKAKQV 724          
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Xenopus
Match: adamts6 (ADAM metallopeptidase with thrombospondin type 1 motif 6 [Source:Xenbase;Acc:XB-GENE-951750])

HSP 1 Score: 345.51 bits (885), Expect = 4.746e-106
Identity = 232/738 (31.44%), Postives = 387/738 (52.44%), Query Frame = 2
Query:  131 PFDVYNQSI----------ELFLQINFTGPKNNEI------ELILDNNAEIIKLISDDLTC---EGEVPFIKTKGIILLWVAKLVTLKMRELKQDVYRSCLGYMKCIYLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINPVDELQFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQPSESADRINDIL--EGARVKNLPNDQMVXXXXXXXXXXXXXXXXNEKPLINKPTL-AEQACLVLQASIHRLKH-ARDDTTMEQCSEILSCALGNNSTRSSTWSLITDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPSAENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAVVSGKHEE-------IRPKLKTLFARISSKDGRDPRIWMIYSDLLANDEDQSNEMKLKVLQCLSRAHHGMC-ASGWELDKAQCKRAILSALRLVDKAIEYDINYASAKLAVKTVKAVM-----ESRKSKQV 2236
            P DV N+ +           LF+Q N+TGP    I        + ++ +E   + +  L+C   +GE  +  T   I L +A+++ +K+R    +        ++CI +HQ  L+DERS  L +  Q C N+  +     LE       +Q  L  S+  + +Y+Y  ++E  N  + +  +     GALGKR + Q    +QL L + R+         D+   +G      P + + +++ L D+T   +I   +    + P L AE+  ++L   I   K+      T E+     SC L    ++   W+L T ALL R +L   S+RR E+++MQ + ++ QF    P+   R+  F+ S++P+IW++Q +   +L  +G T SAL +    + W  ++ C  ++G  G+AE+I+RQ+++   ET +L C LGDV KD  +Y++AW +S  +SAR+ RS  + ++  + +    AECFEKS+ I+P+Q+  WF+ GC  + L+EY  A  AF++ + LEPDN EAWNN +SA + L  K+ A   L+EA+K NYE+W++W+N  + S+  GEF   +KAY++LMDL++  +D   L +LV AVV G  +        ++PKL  L  R++S+D  D  IW +Y+ L  N   + ++   K LQ L +AH      +GWE D +  K  I  A+ L   A++     ++ + AV+ + +        S K+KQV
Sbjct:   76 PADVQNRQLMVFLLGVSCLHLFVQSNWTGPPIISIPQDFLPSSLFEHFSEQKAVSATILSCLILDGESAYSLTANPIFLLIARVIFVKLRNKLTEFQMLPWWTLRCINVHQ-QLLDERSPELFAIAQTCTNEIQKCKNFFLEEAAQDLSVQQCLECSYTCLYYYDYKNAKEHLNAAKDMTTLQINLTGALGKRTRFQENNVAQLILDVQRK--------GDLFLRQGLTPAPTPIEYLPKNQDLEDDTVLNQIKLEDPEQFHIPDLCAEELAVILGVCIDFQKNNPVHKLTEEELLAFNSCLL----SQPKFWALQTTALLMRTKLEKGSARRVERAMMQTQALADQFQQKEPNCTERLKMFYCSQMPAIWDIQRQLASLLFDLGCTSSALQIFEKLEMWEDVVICYERLGQHGKAEEILRQELEK-KETPRLYCLLGDVLKDHQYYDKAWELSNHRSARSQRSKGLLHL-RNKEFKQCAECFEKSVKINPIQLGVWFSLGCAYITLQEYEGAAKAFQRCVTLEPDNAEAWNNLSSAYIRLKQKIKAFRTLQEAIKCNYEHWQIWENYLLTSTDVGEFAEAVKAYHRLMDLRDKFKDVQVLKILVRAVVEGIEDHKGESTSNLKPKLLELMGRVTSRDSSDAEIWKVYARLCGNGASEKDDENDKALQYLIKAHKCETQKTGWESDVSSFKEIIRGAVELAHVAMKCSERKSNPQEAVQILSSARLNLRSLSSKAKQV 798          
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Xenopus
Match: adamts6 (ADAM metallopeptidase with thrombospondin type 1 motif 6 [Source:Xenbase;Acc:XB-GENE-951750])

HSP 1 Score: 344.739 bits (883), Expect = 4.748e-106
Identity = 227/724 (31.35%), Postives = 381/724 (52.62%), Query Frame = 2
Query:  131 PFDVYNQSI----------ELFLQINFTGPKNNEI------ELILDNNAEIIKLISDDLTC---EGEVPFIKTKGIILLWVAKLVTLKMRELKQDVYRSCLGYMKCIYLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINPVDELQFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQPSESADRINDIL--EGARVKNLPNDQMVXXXXXXXXXXXXXXXXNEKPLINKPTL-AEQACLVLQASIHRLKH-ARDDTTMEQCSEILSCALGNNSTRSSTWSLITDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPSAENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAVVSGKHEE-------IRPKLKTLFARISSKDGRDPRIWMIYSDLLANDEDQSNEMKLKVLQCLSRAHHGMC-ASGWELDKAQCKRAILSALRLVDKAIEYDINYASAKLAVKTVKAV 2209
            P DV N+ +           LF+Q N+TGP    I        + ++ +E   + +  L+C   +GE  +  T   I L +A+++ +K+R    +        ++CI +HQ  L+DERS  L +  Q C N+  +     LE       +Q  L  S+  + +Y+Y  ++E  N  + +  +     GALGKR + Q    +QL L + R+         D+   +G      P + + +++ L D+T   +I   +    + P L AE+  ++L   I   K+      T E+     SC L    ++   W+L T ALL R +L   S+RR E+++MQ + ++ QF    P+   R+  F+ S++P+IW++Q +   +L  +G T SAL +    + W  ++ C  ++G  G+AE+I+RQ+++   ET +L C LGDV KD  +Y++AW +S  +SAR+ RS  + ++  + +    AECFEKS+ I+P+Q+  WF+ GC  + L+EY  A  AF++ + LEPDN EAWNN +SA + L  K+ A   L+EA+K NYE+W++W+N  + S+  GEF   +KAY++LMDL++  +D   L +LV AVV G  +        ++PKL  L  R++S+D  D  IW +Y+ L  N   + ++   K LQ L +AH      +GWE D +  K  I  A+ L   A++     ++ + AV+ + + 
Sbjct:   79 PADVQNRQLMVFLLGVSCLHLFVQSNWTGPPIISIPQDFLPSSLFEHFSEQKAVSATILSCLILDGESAYSLTANPIFLLIARVIFVKLRNKLTEFQMLPWWTLRCINVHQ-QLLDERSPELFAIAQTCTNEIQKCKNFFLEEAAQDLSVQQCLECSYTCLYYYDYKNAKEHLNAAKDMTTLQINLTGALGKRTRFQENNVAQLILDVQRK--------GDLFLRQGLTPAPTPIEYLPKNQDLEDDTVLNQIKLEDPEQFHIPDLCAEELAVILGVCIDFQKNNPVHKLTEEELLAFNSCLL----SQPKFWALQTTALLMRTKLEKGSARRVERAMMQTQALADQFQQKEPNCTERLKMFYCSQMPAIWDIQRQLASLLFDLGCTSSALQIFEKLEMWEDVVICYERLGQHGKAEEILRQELEK-KETPRLYCLLGDVLKDHQYYDKAWELSNHRSARSQRSKGLLHL-RNKEFKQCAECFEKSVKINPIQLGVWFSLGCAYITLQEYEGAAKAFQRCVTLEPDNAEAWNNLSSAYIRLKQKIKAFRTLQEAIKCNYEHWQIWENYLLTSTDVGEFAEAVKAYHRLMDLRDKFKDVQVLKILVRAVVEGIEDHKGESTSNLKPKLLELMGRVTSRDSSDAEIWKVYARLCGNGASEKDDENDKALQYLIKAHKCETQKTGWESDVSSFKEIIRGAVELAHVAMKCSERKSNPQEAVQILSSA 787          
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Xenopus
Match: adamts6 (ADAM metallopeptidase with thrombospondin type 1 motif 6 [Source:Xenbase;Acc:XB-GENE-951750])

HSP 1 Score: 345.51 bits (885), Expect = 4.968e-106
Identity = 232/738 (31.44%), Postives = 387/738 (52.44%), Query Frame = 2
Query:  131 PFDVYNQSI----------ELFLQINFTGPKNNEI------ELILDNNAEIIKLISDDLTC---EGEVPFIKTKGIILLWVAKLVTLKMRELKQDVYRSCLGYMKCIYLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINPVDELQFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQPSESADRINDIL--EGARVKNLPNDQMVXXXXXXXXXXXXXXXXNEKPLINKPTL-AEQACLVLQASIHRLKH-ARDDTTMEQCSEILSCALGNNSTRSSTWSLITDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPSAENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAVVSGKHEE-------IRPKLKTLFARISSKDGRDPRIWMIYSDLLANDEDQSNEMKLKVLQCLSRAHHGMC-ASGWELDKAQCKRAILSALRLVDKAIEYDINYASAKLAVKTVKAVM-----ESRKSKQV 2236
            P DV N+ +           LF+Q N+TGP    I        + ++ +E   + +  L+C   +GE  +  T   I L +A+++ +K+R    +        ++CI +HQ  L+DERS  L +  Q C N+  +     LE       +Q  L  S+  + +Y+Y  ++E  N  + +  +     GALGKR + Q    +QL L + R+         D+   +G      P + + +++ L D+T   +I   +    + P L AE+  ++L   I   K+      T E+     SC L    ++   W+L T ALL R +L   S+RR E+++MQ + ++ QF    P+   R+  F+ S++P+IW++Q +   +L  +G T SAL +    + W  ++ C  ++G  G+AE+I+RQ+++   ET +L C LGDV KD  +Y++AW +S  +SAR+ RS  + ++  + +    AECFEKS+ I+P+Q+  WF+ GC  + L+EY  A  AF++ + LEPDN EAWNN +SA + L  K+ A   L+EA+K NYE+W++W+N  + S+  GEF   +KAY++LMDL++  +D   L +LV AVV G  +        ++PKL  L  R++S+D  D  IW +Y+ L  N   + ++   K LQ L +AH      +GWE D +  K  I  A+ L   A++     ++ + AV+ + +        S K+KQV
Sbjct:   79 PADVQNRQLMVFLLGVSCLHLFVQSNWTGPPIISIPQDFLPSSLFEHFSEQKAVSATILSCLILDGESAYSLTANPIFLLIARVIFVKLRNKLTEFQMLPWWTLRCINVHQ-QLLDERSPELFAIAQTCTNEIQKCKNFFLEEAAQDLSVQQCLECSYTCLYYYDYKNAKEHLNAAKDMTTLQINLTGALGKRTRFQENNVAQLILDVQRK--------GDLFLRQGLTPAPTPIEYLPKNQDLEDDTVLNQIKLEDPEQFHIPDLCAEELAVILGVCIDFQKNNPVHKLTEEELLAFNSCLL----SQPKFWALQTTALLMRTKLEKGSARRVERAMMQTQALADQFQQKEPNCTERLKMFYCSQMPAIWDIQRQLASLLFDLGCTSSALQIFEKLEMWEDVVICYERLGQHGKAEEILRQELEK-KETPRLYCLLGDVLKDHQYYDKAWELSNHRSARSQRSKGLLHL-RNKEFKQCAECFEKSVKINPIQLGVWFSLGCAYITLQEYEGAAKAFQRCVTLEPDNAEAWNNLSSAYIRLKQKIKAFRTLQEAIKCNYEHWQIWENYLLTSTDVGEFAEAVKAYHRLMDLRDKFKDVQVLKILVRAVVEGIEDHKGESTSNLKPKLLELMGRVTSRDSSDAEIWKVYARLCGNGASEKDDENDKALQYLIKAHKCETQKTGWESDVSSFKEIIRGAVELAHVAMKCSERKSNPQEAVQILSSARLNLRSLSSKAKQV 801          
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Mouse
Match: Ttc27 (tetratricopeptide repeat domain 27 [Source:MGI Symbol;Acc:MGI:1921446])

HSP 1 Score: 300.827 bits (769), Expect = 1.994e-89
Identity = 227/741 (30.63%), Postives = 388/741 (52.36%), Query Frame = 2
Query:   59 KSVVNFKSLDSFELFNFISSCDLIPFDVYNQSIELFLQINFTGP------KNNEIELILDNNAEIIKL---ISDDLTCEGEVPFIKTKGIILLWVAKLVTLKMRELKQDVYRSCLGYMKCIYLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINP-VDELQFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQ---PSESADRINDILEGARVKNLP-NDQMVXXXXXXXXXXXXXXXXNEKPLINKPTL-AEQACLVLQASIHRLKH-ARDDTTMEQCSEILSCALGNNSTRSSTWSLITDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPSAENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAVV------SGK-HEEIRPKLKTLFARISSKDGRDPRIWMIYSDLLANDEDQSNEMKLKVLQCLSRAHH-GMCASGWELDKAQCKRAILSALRLVDKAIEYDINYASAKLAVKTVKAV 2209
            K +VNF  LD       I    L+ F +   S++LF+Q N+TGP      ++     +L+  +E+  L   I   L  +GE  +  T   ILL +A+++ + +R     +       ++ + +HQ  L++ERS  L +  ++C +Q M+  EN  E  +  +  +QF L  +H+ + +YEY ++++ F+  + +  +  +  GALGKR + Q    +QL + + R+   P           +    KNL  ND  V +E  L           +      P L AE+  +VL    +  K+      T E+     SC L    ++   W++   AL+ R +L   S+RR E+++ Q + ++ QF     S   R+  F+  ++P  W VQ +   +L  +G T SAL +    + W  ++ C  + G  G+AE+I+RQ+++   ET  L C LGDV +D S Y++AW +S+ +SARA RS A+ ++  + +     ECFE+S+ I+P+Q+  WF+ GC  L L++Y  +  AF++ + LEPDN EAWNN +++ + L  KV A   L+EA+K NYE+W++W+N  + S+  GEF   IKAY++L+DL++ ++D   L +LV AVV      SG     ++ KL+ LF RI+S+   D  +W +Y+ +  N + +  +   K  QCLS+A+     +S WE D    K  +  A+ L   A++   + +  + AV+T+ +V
Sbjct:   76 KQIVNF--LDCSTDLEEIERQQLV-FLLGVSSLQLFVQSNWTGPLVDLHPQDFLPSGLLEQFSEVKGLDAIIMGLLILDGESVYSLTSKPILLLIARIILVNIRHKLTALQSLPWWTLRYVNIHQ-QLLEERSPQLFALAKNCIDQVMK-QENLFEGDSGRLLAIQFHLECAHVFLYYYEYKEAKDQFSTAKDISKLEIDLTGALGKRTRFQENYVAQLIVDVRRKEAVPFSCEFSPAPTPQECLAKNLELNDDTVLNEIKLA----------DSERFQMPDLCAEELAVVLGVCTNFQKNNPVHKLTEEELLAFTSCLL----SQPKFWAIQMSALILRTKLERGSTRRVERAMRQTQALADQFEDKATSVLERLKIFYCCQVPPHWAVQRQLAGLLFELGCTSSALQIFEKLEMWEDVVICHERAGRHGKAEEILRQELEK-KETPGLYCLLGDVLQDHSCYDKAWELSRHRSARAQRSKALLHL-RNKEFRECVECFERSVKINPMQLGVWFSLGCAYLALEDYGGSAKAFQRCVTLEPDNAEAWNNLSTSYIRLKQKVKAFRTLQEALKCNYEHWQIWENYILTSTDVGEFGEAIKAYHRLLDLRDKYKDIQVLKILVQAVVNDMTDRSGAVASSLKGKLQELFGRITSRVTNDGEVWRLYAQVHGNGQSEKPDENDKAFQCLSKAYKCDTQSSCWEKDATAFKEVVQRAIGLAHVAMKCAESKSIPQEAVQTLSSV 795          
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Mouse
Match: Ttc27 (tetratricopeptide repeat domain 27 [Source:MGI Symbol;Acc:MGI:1921446])

HSP 1 Score: 300.442 bits (768), Expect = 2.717e-89
Identity = 225/741 (30.36%), Postives = 388/741 (52.36%), Query Frame = 2
Query:   59 KSVVNFKSLDSFELFNFISSCDLIPFDVYNQSIELFLQINFTGP------KNNEIELILDNNAEIIKL---ISDDLTCEGEVPFIKTKGIILLWVAKLVTLKMRELKQDVYRSCLGYMKCIYLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINP-VDELQFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQ---PSESADRINDILEGARVKNLP-NDQMVXXXXXXXXXXXXXXXXNEKPLINKPTL-AEQACLVLQASIHRLKH-ARDDTTMEQCSEILSCALGNNSTRSSTWSLITDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPSAENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAVVSGKHEE-------IRPKLKTLFARISSKDGRDPRIWMIYSDLLANDEDQSNEMKLKVLQCLSRAHH-GMCASGWELDKAQCKRAILSALRLVDKAIEYDINYASAKLAVKTVKAV 2209
            K +VNF  LD       I    L+ F +   S++LF+Q N+TGP      ++     +L+  +E+  L   I   L  +GE  +  T   ILL +A+++ + +R     +       ++ + +HQ  L++ERS  L +  ++C +Q M+  EN  E  +  +  +QF L  +H+ + +YEY ++++ F+  + +  +  +  GALGKR + Q    +QL + + R+   P           +    KNL  ND  V +E  L           +      P L AE+  +VL    +  K+      T E+     SC L    ++   W++   AL+ R +L   S+RR E+++ Q + ++ QF     S   R+  F+  ++P  W VQ +   +L  +G T SAL +    + W  ++ C  + G  G+AE+I+RQ+++   ET  L C LGDV +D S Y++AW +S+ +SARA RS A+ ++  + +     ECFE+S+ I+P+Q+  WF+ GC  L L++Y  +  AF++ + LEPDN EAWNN +++ + L  KV A   L+EA+K NYE+W++W+N  + S+  GEF   IKAY++L+DL++ ++D   L +LV AVV+   +        ++ KL+ LF RI+S+   D  +W +Y+ +  N + +  +   K  QCLS+A+     +S WE D    K  +  A+ L   A++   + +  + AV+T+ +V
Sbjct:   76 KQIVNF--LDCSTDLEEIERQQLV-FLLGVSSLQLFVQSNWTGPLVDLHPQDFLPSGLLEQFSEVKGLDAIIMGLLILDGESVYSLTSKPILLLIARIILVNIRHKLTALQSLPWWTLRYVNIHQ-QLLEERSPQLFALAKNCIDQVMK-QENLFEGDSGRLLAIQFHLECAHVFLYYYEYKEAKDQFSTAKDISKLEIDLTGALGKRTRFQENYVAQLIVDVRRKEAVPFSCEFSPAPTPQECLAKNLELNDDTVLNEIKLA----------DSERFQMPDLCAEELAVVLGVCTNFQKNNPVHKLTEEELLAFTSCLL----SQPKFWAIQMSALILRTKLERGSTRRVERAMRQTQALADQFEDKATSVLERLKIFYCCQVPPHWAVQRQLAGLLFELGCTSSALQIFEKLEMWEDVVICHERAGRHGKAEEILRQELEK-KETPGLYCLLGDVLQDHSCYDKAWELSRHRSARAQRSKALLHL-RNKEFRECVECFERSVKINPMQLGVWFSLGCAYLALEDYGGSAKAFQRCVTLEPDNAEAWNNLSTSYIRLKQKVKAFRTLQEALKCNYEHWQIWENYILTSTDVGEFGEAIKAYHRLLDLRDKYKDIQVLKILVQAVVNDMTDRSGAVASSLKGKLQELFGRITSRVTNDGEVWRLYAQVHGNGQSEKPDENDKAFQCLSKAYKCDTQSSCWEKDATAFKEVVQRAIGLAHVAMKCAESKSIPQEAVQTLSSV 795          
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Mouse
Match: Ttc27 (tetratricopeptide repeat domain 27 [Source:MGI Symbol;Acc:MGI:1921446])

HSP 1 Score: 171.785 bits (434), Expect = 1.485e-47
Identity = 90/259 (34.75%), Postives = 149/259 (57.53%), Query Frame = 2
Query:  932 TMEQCSEILSCALGNNSTRSSTWSLITDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPSAENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALA 1708
            T E+     SC L    ++   W++   AL+ R +L   S+RR E+++ Q + ++ QF     S   R+  F+  ++P  W VQ +   +L  +G T SAL +    + W  ++ C  + G  G+AE+I+RQ+++   ET  L C LGDV +D S Y++AW +S+ +SARA RS A+ ++  + +     ECFE+S+ I+P+Q+  WF+ GC  L L++Y  +  AF++ + LEPDN EAWNN +++ + L  K   L 
Sbjct:   47 TEEELLAFTSCLL----SQPKFWAIQMSALILRTKLERGSTRRVERAMRQTQALADQFEDKATSVLERLKIFYCCQVPPHWAVQRQLAGLLFELGCTSSALQIFEKLEMWEDVVICHERAGRHGKAEEILRQELEK-KETPGLYCLLGDVLQDHSCYDKAWELSRHRSARAQRSKALLHL-RNKEFRECVECFERSVKINPMQLGVWFSLGCAYLALEDYGGSAKAFQRCVTLEPDNAEAWNNLSTSYIRLKQKAHKLG 299          
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Mouse
Match: Ttc27 (tetratricopeptide repeat domain 27 [Source:MGI Symbol;Acc:MGI:1921446])

HSP 1 Score: 91.2781 bits (225), Expect = 9.628e-20
Identity = 46/139 (33.09%), Postives = 79/139 (56.83%), Query Frame = 2
Query:  998 WSLITDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPSAENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAW 1414
            W++   AL+ R +L   S+RR E+++ Q + ++ QF     S   R+  F+  ++P  W VQ +   +L  +G T SAL +    + W  ++ C  + G  G+AE+I+RQ+++   ET  L C LGDV +D S Y++A+
Sbjct:   28 WAIQMSALILRTKLERGSTRRVERAMRQTQALADQFEDKATSVLERLKIFYCCQVPPHWAVQRQLAGLLFELGCTSSALQIFEKLEMWEDVVICHERAGRHGKAEEILRQELEK-KETPGLYCLLGDVLQDHSCYDKAF 165          
BLAST of Tetratricopeptide repeat protein 27 vs. UniProt/SwissProt
Match: sp|Q6P3X3|TTC27_HUMAN (Tetratricopeptide repeat protein 27 OS=Homo sapiens OX=9606 GN=TTC27 PE=1 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 2.606e-96
Identity = 213/716 (29.75%), Postives = 376/716 (52.51%), Query Frame = 2
Query:  152 SIELFLQINFTGP------KNNEIELILDNNAEIIKL---ISDDLTCEGEVPFIKTKGIILLWVAKLVTLKMRELKQDVYRSCLGYMKCIYLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINPVDELQFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQPSESADRINDILEGARVKNLPNDQMVXXXXXXXXXXXXXXXXNEKPLINKPTLA------------EQACLVLQASIHRLKHARDDTTME-QCSEILSCALGNNSTRSSTWSLITDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPSAENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAVVSGKHEE-------IRPKLKTLFARISSKDGRDPRIWMIYSDLLANDEDQSNEMKLKVLQCLSRAHHGMCASG-WELDKAQCKRAILSALRLVDKAIEYDINYASAKLAVKTVKAV 2209
            S++LF+Q N+TGP      ++    ++    +E+  L   +   LT +GE  +  T   ILL +A+++ + +R     +       ++C+ +HQ  L++ERS LL +  ++C +Q M+     ++       +QF L  +++ + +YEY K+++  +  + +  +  +  GALGKR + Q    +QL L + R+         D+L        P  Q         E     ++ N+  ++N   LA            E+  ++L    +  K+    T  E +     SC L    ++   W++ T AL+ R +L   S+RR E+++ Q + ++ QF     S   R+  F+  ++P  W +Q +   +L  +G T SAL +    + W  ++ C  + G  G+AE+I+RQ+++   ET  L C LGDV  D S Y++AW +S+ +SARA RS A+ ++  + +     ECFE+S+ I+P+Q+  WF+ GC  L L++Y+ +  AF++ + LEPDN EAWNN +++ + L  KV A   L+EA+K NYE+W++W+N  + S+  GEF+  IKAY++L+DL++ ++D   L +LV AV+ G  +        ++ KL+ LF R++S+   D  IW +Y+ +  N + +  +   K  QCLS+A+     S  WE D    K  +  AL L   AI+   N +S++ AV+ + +V
Sbjct:  100 SLQLFVQSNWTGPPVDLHPQDFLSSVLFQQFSEVKGLDAFVLSLLTLDGESIYSLTSKPILLLLARIILVNVRHKLTAIQSLPWWTLRCVNIHQH-LLEERSPLLFTLAENCIDQVMKLQNLFVDDSGRYLAIQFHLECAYVFLYYYEYRKAKDQLDIAKDISQLQIDLTGALGKRTRFQENYVAQLILDVRRE--------GDVLSNCEFTPAPTPQ---------EHLTKNLELNDDTILNDIKLADCEQFQMPDLCAEEIAIILGICTNFQKNNPVHTLTEVELLAFTSCLL----SQPKFWAIQTSALILRTKLEKGSTRRVERAMRQTQALADQFEDKTTSVLERLKIFYCCQVPPHWAIQRQLASLLFELGCTSSALQIFEKLEMWEDVVICYERAGQHGKAEEILRQELEK-KETPSLYCLLGDVLGDHSCYDKAWELSRYRSARAQRSKALLHL-RNKEFQECVECFERSVKINPMQLGVWFSLGCAYLALEDYQGSAKAFQRCVTLEPDNAEAWNNLSTSYIRLKQKVKAFRTLQEALKCNYEHWQIWENYILTSTDVGEFSEAIKAYHRLLDLRDKYKDVQVLKILVRAVIDGMTDRSGDVATGLKGKLQELFGRVTSRVTNDGEIWRLYAHVYGNGQSEKPDENEKAFQCLSKAYKCDTQSNCWEKDITSFKEVVQRALGLAHVAIKCSKNKSSSQEAVQMLSSV 791          
BLAST of Tetratricopeptide repeat protein 27 vs. UniProt/SwissProt
Match: sp|Q5RBW9|TTC27_PONAB (Tetratricopeptide repeat protein 27 OS=Pongo abelii OX=9601 GN=TTC27 PE=2 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 9.395e-96
Identity = 212/716 (29.61%), Postives = 376/716 (52.51%), Query Frame = 2
Query:  152 SIELFLQINFTGP------KNNEIELILDNNAEIIKL---ISDDLTCEGEVPFIKTKGIILLWVAKLVTLKMRELKQDVYRSCLGYMKCIYLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINPVDELQFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQPSESADRINDILEGARVKNLPNDQMVXXXXXXXXXXXXXXXXNEKPLINKPTLA------------EQACLVLQASIHRLKHARDDT-TMEQCSEILSCALGNNSTRSSTWSLITDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPSAENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAVVSGKHEE-------IRPKLKTLFARISSKDGRDPRIWMIYSDLLANDEDQSNEMKLKVLQCLSRAHHGMCASG-WELDKAQCKRAILSALRLVDKAIEYDINYASAKLAVKTVKAV 2209
            S++LF+Q N+TGP      ++    ++    +E+  L   +   L  +GE  +  T   ILL +A+++ + +R     +       ++C+ +HQ  L++ERS LL +  ++C +Q M+     ++       +QF L  +++ + +YEY K+++  +  + +  + T+  GALGKR + Q    +QL L + R+         D+L        P  Q         E     ++ N+  ++N   LA            E+  ++L    +  K+    T T E+     SC L    ++   W++ T AL+ R +L   S+RR E+++ Q + ++ QF     S   R+  F+  ++P  W +Q +   +L  +G T SAL +    + W  ++ C  + G  G+AE+I+RQ+++   +T  L C LGDV  D S Y++AW +S+ +SARA RS A+ ++  + +     ECFE+S+ I+P+Q+  WF+ GC  L L++Y+ +  AF++ + LEPDN EAWNN +++ + L  KV A   L+EA+K NYE+W++W+N  + S+  GEF+  IKAY++L+DL++ ++D   L +L+ AV+ G  +        ++ KL+ LF R++S+   D  IW +Y+ +  N + +  +   K  QCLS+A+     S  WE D    K  +  AL L   AI+   N +S + AV+ + +V
Sbjct:  100 SLQLFVQSNWTGPPVDLHPQDFLSSVLFQQFSEVKGLDAFVLSLLILDGESIYSLTSKPILLLLARIILVNVRHKLTAIQSLPWWTLRCVNIHQH-LLEERSPLLFTLAENCIDQVMKLQNLFVDDSGRYLAIQFHLECAYVFLYYYEYRKAKDQLDIAKDISQLQTDLTGALGKRTRFQENYVAQLILDVRRE--------GDVLSNCEFTPAPTPQ---------EHLTKNLELNDDTILNDIKLADCEQFQMPDLCAEELAIILGICTNFQKNNPVHTLTEEELLAFTSCLL----SQPKFWAIQTSALILRTKLEKGSTRRVERAMRQTQALADQFEDKTTSVLERLKIFYCCQVPPHWAIQRQLASLLFELGCTSSALQIFEKLEMWEDVVICYERAGQHGKAEEILRQELEK-KQTPSLYCLLGDVLGDHSCYDKAWELSRYRSARAQRSKALLHL-RNKEFQECVECFERSVKINPMQLGVWFSLGCAYLALEDYQGSAKAFQRCVTLEPDNAEAWNNLSTSYIRLKQKVKAFRTLQEALKCNYEHWQIWENYILTSTDVGEFSEAIKAYHRLLDLRDKYKDVQVLKILLRAVIDGMTDRSGDVATGLKGKLQELFGRVTSRVTNDGEIWRLYAHVYGNGQSEKPDENEKAFQCLSKAYKCDTQSNCWEKDITSFKEVVQRALGLAHVAIKCSKNKSSPQEAVQMLSSV 791          
BLAST of Tetratricopeptide repeat protein 27 vs. UniProt/SwissProt
Match: sp|Q5F3K0|TTC27_CHICK (Tetratricopeptide repeat protein 27 OS=Gallus gallus OX=9031 GN=TTC27 PE=2 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 5.387e-95
Identity = 233/767 (30.38%), Postives = 383/767 (49.93%), Query Frame = 2
Query:  152 SIELFLQINFTGPKNN-EIELILDN------------NAEIIKLISDDLTCEGEVPFIKTKGIILLWVAKLVTLKMRELKQDVYRSCLGYMKCIYLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINPVDE-----LQFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQ-----PSESADRINDILEGARVKNLPNDQMVXXXXXXXXXXXXXXXXNEKPLINK-----PTL-AEQACLVLQASIHRLKHAR-DDTTMEQCSEILSCALGNNSTRSSTWSLITDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPSAENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAVVSGKHEE-------IRPKLKTLFARISSKDGRDPRIWMIYSDLLANDEDQSNEMKLKVLQCLSRAHHGMCASG-WELDKAQCKRAILSALRLVDKAIEYDINYASAKLAVKTVKAVM-----ESRKSKQ------VEQLDDEVQDLLTKIDEADIQLAE 2305
            S++LF+Q N+TGP  + +++  L +            +A I+K+    L  + E  +  T   ILL +A++V +  R     +       ++C+ +HQ  L++ERS  L +  Q C  Q  E      E +   DE     +QF L  ++  + +YEY K+++ F   + +  +     GALGKR + Q    +QL L + R      P          LE   +    ND  V                NE  L +      P L AE+  ++L   I   K+      T E+     SC L    ++   W++ T ALL R +L   S+RR E+++ Q + ++ QF  +  S   R+  F+  ++P  W +Q +   +L  +G T SAL +    + W   + C  + G  G+AE+I+R++++   ET  L C LGDV KD   Y++AW +S+ +SARA RS  + ++  + +     ECFE+S+ I+P+Q+  WF+ GC  + L+ Y  A  AF++ + LEPDN EAWNN ++A + L  K+ A   L+EA+K NYE+W++W+N  + S+  GEF+  IKAY++LMDL+E ++D   LA+LV AVV G  +        ++ KL+ L  R++S+   D  IW +Y+ L  N    S+E   K LQCL++AH     S  WE D +  K     A+ +   AI+     ++ + A++ + +        S K+KQ        ++ +EV D +T +D    +L E
Sbjct:  100 SLQLFVQSNWTGPPVHLQLQGFLPSALLQKCLEPKMLHATILKM----LVLDAESVYTLTSHPILLLIARVVLVNSRHKLSSLQTLPWWTLRCVNIHQ-QLLEERSPELFTLAQMCIRQMTE-----AEALFAGDEGWHLAVQFNLECAYTFLYYYEYKKAKQCFCTAKDIAKLQINLTGALGKRTRFQEKYVAQLILDVQRSEEFIPPHSELTPAPTPLENLTMNCDLNDDTVL---------------NEIKLADADQYQVPDLCAEELAVILGICIDFQKNNPIHKLTEEELLAFTSCLL----SQPKFWAIQTSALLLRTKLEKGSTRRMERAMKQTQALADQFEDVNTSVSERMKIFYCCQVPPHWAIQRQLASLLFELGCTSSALQIYEELEMWEDAVICYERAGQHGKAEEILRRELEK-KETPVLYCLLGDVLKDHQCYDKAWELSRHRSARAQRSKGLLHL-RNREFRECVECFERSVQINPMQLGVWFSLGCAYIALEGYEGAAKAFQRCVTLEPDNAEAWNNLSTAYIRLKQKIKAFRTLQEALKCNYEHWQIWENYLLTSTDVGEFSEAIKAYHRLMDLREKYKDTQVLAILVRAVVDGMADRTGEAASGLKGKLRELLGRVTSRVTNDGEIWRLYARLYGNGHSDSSEDIEKSLQCLTKAHKCEIQSNDWEKDVSSFKEVAKGAIEIAHVAIKCSKKKSNNQEALQILSSARLNLRGLSSKAKQRFVDVGSHEICNEVTDEVTTMDNLIAELQE 835          
BLAST of Tetratricopeptide repeat protein 27 vs. UniProt/SwissProt
Match: sp|Q17QZ7|TTC27_BOVIN (Tetratricopeptide repeat protein 27 OS=Bos taurus OX=9913 GN=TTC27 PE=2 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 2.186e-93
Identity = 212/723 (29.32%), Postives = 373/723 (51.59%), Query Frame = 2
Query:  152 SIELFLQINFTGP------KNNEIELILDNNAEIIKL---ISDDLTCEGEVPFIKTKGIILLWVAKLVTLKMRELKQDVYRSCLGYMKCIYLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINPVDELQFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQPSESADRINDILEGARVKNLPNDQMVXXXXXXXXXXXXXXXXNEKPLINKPTLA------------EQACLVL--------QASIHRLKHARDDTTMEQCSEILSCALGNNSTRSSTWSLITDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPSAENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAVVSGKHEE-------IRPKLKTLFARISSKDGRDPRIWMIYSDLLANDEDQSNEMKLKVLQCLSRAHH-GMCASGWELDKAQCKRAILSALRLVDKAIEYDINYASAKLAVKTVKAV 2209
            S++LF+Q N+TGP      ++    ++    +EI  L   +   L  +GE  +  T   ILL +A+++ + +R     +       ++C+ +HQ  L++ERS  L +  +DC +Q M+  +  ++       +QF L  +++ + +YEY K+++ F+  + +  +     GALGKR + Q    +QL L + R+ +        +         P  Q         E     ++ N+  ++N+  LA            E+  ++L           +H+L       T E+     SC L    ++   W++ T AL+ R +L   S+RR E+++ Q + ++ QF     S   R+  F+  ++P  W VQ +   +L  +G T SAL +    + W  ++ C  + G  G+AE+I+RQ+++   ET  L C LGDV +D S+Y++AW +S+ +SARA RS  + ++    +     ECFE+SL I+P+Q+  WF+ GC  L L++Y  +  AF++ + LEPDN EAWNN +++ + L  KV A   L+EA+K NYE+W++W+N  + S+  GEF+  IKAY++L+DL++ ++D   L +LV AV+ G  +        +R KL+ LF R++S+   D  IW +Y+ +  N +    +   K  Q LS+A+     +S WE +    K  +  AL L   AI+   N +S + A++ + +V
Sbjct:  104 SLQLFVQSNWTGPLVDLHPQDFLPSVLFQQFSEIKALDAFLLSLLVLDGESIYSLTTKPILLLLARIILVNIRHKLTAIQSLPWWTLRCVNIHQ-QLLEERSPQLFALAEDCIDQVMKLEDLFVDDSGQCLAVQFHLECAYIFLYYYEYKKAKDQFSIAKDICRLQIGLTGALGKRTRFQENYVAQLILDVRREGT--------VFSNCEFTPAPTPQ---------EYLTKNLELNDDTVLNEIKLADCEQFQMPDLCAEELAVILGICTDFQKNNPVHKL-------TEEELLAFTSCLL----SQPKFWAIQTSALILRTKLERGSTRRVERAMRQTQALADQFEDKTASVLERLKIFYCCQVPPHWAVQRQLAGLLFELGCTNSALQIFEKLEMWEDVVICYERAGQHGKAEEILRQELEK-KETPSLYCLLGDVLRDHSYYDQAWELSRHRSARAQRSKGLLHL-RSREFKECVECFERSLKINPMQLGVWFSLGCAYLALEDYGGSARAFQRCVTLEPDNAEAWNNLSTSYIRLKQKVKAFRTLQEALKCNYEHWQIWENYILTSTDVGEFSEAIKAYHRLLDLRDKYKDTQVLKILVRAVMDGMADRSGDVATGLRGKLQELFGRVTSRVTNDGEIWRLYAQVYGNGQSDKPDENEKAFQYLSKAYKCDTQSSCWEKNITSFKEVVQRALGLAHVAIKCSKNKSSPQEAIQVLSSV 795          
BLAST of Tetratricopeptide repeat protein 27 vs. UniProt/SwissProt
Match: sp|Q8CD92|TTC27_MOUSE (Tetratricopeptide repeat protein 27 OS=Mus musculus OX=10090 GN=Ttc27 PE=1 SV=2)

HSP 1 Score: 300.827 bits (769), Expect = 1.395e-88
Identity = 227/741 (30.63%), Postives = 388/741 (52.36%), Query Frame = 2
Query:   59 KSVVNFKSLDSFELFNFISSCDLIPFDVYNQSIELFLQINFTGP------KNNEIELILDNNAEIIKL---ISDDLTCEGEVPFIKTKGIILLWVAKLVTLKMRELKQDVYRSCLGYMKCIYLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINP-VDELQFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQ---PSESADRINDILEGARVKNLP-NDQMVXXXXXXXXXXXXXXXXNEKPLINKPTL-AEQACLVLQASIHRLKH-ARDDTTMEQCSEILSCALGNNSTRSSTWSLITDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPSAENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAVV------SGK-HEEIRPKLKTLFARISSKDGRDPRIWMIYSDLLANDEDQSNEMKLKVLQCLSRAHH-GMCASGWELDKAQCKRAILSALRLVDKAIEYDINYASAKLAVKTVKAV 2209
            K +VNF  LD       I    L+ F +   S++LF+Q N+TGP      ++     +L+  +E+  L   I   L  +GE  +  T   ILL +A+++ + +R     +       ++ + +HQ  L++ERS  L +  ++C +Q M+  EN  E  +  +  +QF L  +H+ + +YEY ++++ F+  + +  +  +  GALGKR + Q    +QL + + R+   P           +    KNL  ND  V +E  L           +      P L AE+  +VL    +  K+      T E+     SC L    ++   W++   AL+ R +L   S+RR E+++ Q + ++ QF     S   R+  F+  ++P  W VQ +   +L  +G T SAL +    + W  ++ C  + G  G+AE+I+RQ+++   ET  L C LGDV +D S Y++AW +S+ +SARA RS A+ ++  + +     ECFE+S+ I+P+Q+  WF+ GC  L L++Y  +  AF++ + LEPDN EAWNN +++ + L  KV A   L+EA+K NYE+W++W+N  + S+  GEF   IKAY++L+DL++ ++D   L +LV AVV      SG     ++ KL+ LF RI+S+   D  +W +Y+ +  N + +  +   K  QCLS+A+     +S WE D    K  +  A+ L   A++   + +  + AV+T+ +V
Sbjct:   76 KQIVNF--LDCSTDLEEIERQQLV-FLLGVSSLQLFVQSNWTGPLVDLHPQDFLPSGLLEQFSEVKGLDAIIMGLLILDGESVYSLTSKPILLLIARIILVNIRHKLTALQSLPWWTLRYVNIHQ-QLLEERSPQLFALAKNCIDQVMK-QENLFEGDSGRLLAIQFHLECAHVFLYYYEYKEAKDQFSTAKDISKLEIDLTGALGKRTRFQENYVAQLIVDVRRKEAVPFSCEFSPAPTPQECLAKNLELNDDTVLNEIKLA----------DSERFQMPDLCAEELAVVLGVCTNFQKNNPVHKLTEEELLAFTSCLL----SQPKFWAIQMSALILRTKLERGSTRRVERAMRQTQALADQFEDKATSVLERLKIFYCCQVPPHWAVQRQLAGLLFELGCTSSALQIFEKLEMWEDVVICHERAGRHGKAEEILRQELEK-KETPGLYCLLGDVLQDHSCYDKAWELSRHRSARAQRSKALLHL-RNKEFRECVECFERSVKINPMQLGVWFSLGCAYLALEDYGGSAKAFQRCVTLEPDNAEAWNNLSTSYIRLKQKVKAFRTLQEALKCNYEHWQIWENYILTSTDVGEFGEAIKAYHRLLDLRDKYKDIQVLKILVQAVVNDMTDRSGAVASSLKGKLQELFGRITSRVTNDGEVWRLYAQVHGNGQSEKPDENDKAFQCLSKAYKCDTQSSCWEKDATAFKEVVQRAIGLAHVAMKCAESKSIPQEAVQTLSSV 795          
BLAST of Tetratricopeptide repeat protein 27 vs. TrEMBL
Match: A0A3Q0KQ57 (TPR_REGION domain-containing protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 448.743 bits (1153), Expect = 8.851e-143
Identity = 268/722 (37.12%), Postives = 397/722 (54.99%), Query Frame = 2
Query:   56 IKSVVNFKSLDSFELFNFISSCDLIPFDVYNQSIELFLQINFTGPKNNEIELILDNNAEI---IKLISDDLTCEGEVPFIKTKGIILLWVAKLVTLKMRELKQDV-YRSCLGYMKCIYLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINPVDELQFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQPSESADRINDILEGARVK---NLPNDQMVXXXXXXXXXXXXXXXXNEKPLINKPTLAEQACLVLQASIHRLKHARDDTTMEQCSEILSCAL-------GNNSTRSSTWSLITDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPS-AENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAVV-------SGKHEEIRPKLKTLFARISSKDGRDPRIWMIYSDLLANDEDQSNEMKL-KVLQCLSRAHHGMCASG---WELDKAQCKRAILSALRLVD 2143
            I S +    LD   L N +    +    V + ++  F+ +NF       I+  +D + E     +L  +DL CEGE PF  TK + L W+ K +  KM  + Q + +   L Y+KCIYLHQ  + DERS  LKS+ QD  N   E  ++   T    D +Q+L+L+S+L   +YEY  S+       + L I  +F GALGK  + Q            ++ +    ++N ++E    K   N P  Q++     +     +     E+ +++     EQ+ ++L   +HR  + RDD T +QC   ++  +        N    SS+W + T+ L +R  L   S RRTE++L Q+EE+S QF    PS +E     FFLSR+PSIW +Q++ GR+L+ +G  +SALD+ L W +W  II+C I +  R +AE++IR ++    E+A+L C LGDVT DR HY +AW VS  KSARA+RSLAV YM+ D D+  A ECFEKSL I+ LQV  WFT+GCCCLQ KE+ KA +AF+  +RL+PDNFEAWNNCA+A++    K  AL L+KEA KY+YENWR+W+NI ++S+    F  TI AY++L+DL+  + +P  L+V+V  V+             +R KL  LF R+++    D  IW  Y+ LL ++  Q+      + + CL  AH     S    WE    +C+  I     L+D
Sbjct:   21 IFSDIPLSELDDDTLVNNLLERSVSVLQVIDYAMSYFVAVNF-------IDGSVDESYEFDGCFQLALEDLCCEGEYPFRLTKSLSLFWLCKRLCRKMSMVSQTLSFLYHLNYLKCIYLHQYLIGDERSPKLKSEFQDIINVCEECLDS---THTTEDVIQYLMLSSYLSAFYYEYEASKTFATRCSQYLNIDVKFCGALGKCTRFQ-----------EKEVATLTVKVNRVVESKDNKTSGNCPLPQIISLGDDVLLNNVIFSTIEEQIILSN---TEQSFILLLCELHRRHYPRDDITEQQCLAYINTVIRAIYPDSENEIKSSSSWPIATETLFRRSLLEHNSVRRTERALSQLEELSCQFKRTSPSFSERSPSTFFLSRMPSIWTLQVEQGRLLMKIGCYKSALDIFLLWDKWSEIIECYIHLNKREKAEEVIRSRLNSGDESAELYCSLGDVTNDRQHYLKAWDVSGCKSARAIRSLAVTYMYTDKDYQKAIECFEKSLEINTLQVNVWFTFGCCCLQAKEFVKAENAFRSCVRLDPDNFEAWNNCATAVLIQGKKNIALKLMKEACKYSYENWRIWENILLISADVKAFHETIYAYHRLLDLQGKYANPQVLSVMVKGVILNEMDSTGNPASNLRAKLLELFGRVTASTPNDAVIWNEYAHLLVDELPQTTYTTYQRAVHCLQAAHRCRIQSSEGPWEQSTKKCETIIDGLKALLD 718          
BLAST of Tetratricopeptide repeat protein 27 vs. TrEMBL
Match: G4V5K8 (TPR_REGION domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_152860 PE=4 SV=1)

HSP 1 Score: 446.817 bits (1148), Expect = 6.590e-142
Identity = 267/722 (36.98%), Postives = 395/722 (54.71%), Query Frame = 2
Query:   56 IKSVVNFKSLDSFELFNFISSCDLIPFDVYNQSIELFLQINFTGPKNNEIELILDNNAEI---IKLISDDLTCEGEVPFIKTKGIILLWVAKLVTLKMRELKQDV-YRSCLGYMKCIYLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINPVDELQFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQPSESADRINDILEGARVK---NLPNDQMVXXXXXXXXXXXXXXXXNEKPLINKPTLAEQACLVLQASIHRLKHARDDTTMEQCSEILSCAL-------GNNSTRSSTWSLITDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPS-AENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAVV-------SGKHEEIRPKLKTLFARISSKDGRDPRIWMIYSDLLANDEDQSNEMKL-KVLQCLSRAHHGMCASG---WELDKAQCKRAILSALRLVD 2143
            I S +    LD   L N +    +    V + ++  F+ +NF G         +D + E     +L  +DL CEGE PF  TK + L W+ K +  KM  + Q + +   L Y+KCIYLHQ  + DERS  LKS+ QD  N   E  ++   T    D +Q+L+L+S+L   +YEY  S+       + L I  +F GALGK  + Q            ++ +    ++N ++E    K   N P  Q++     +     +     E+ +++     EQ+ ++L   +HR  + RDD T +QC   ++  +        N    SS+W + T+ L +R  L   S RRTE++L Q+EE+S QF    PS +E     FFLSR+PSIW +Q++ GR+L+ +G  +SALD+ L W +W  II+C I +  R +AE++IR ++    E+A+L C LGDVT DR HY +AW VS  KSARA+RSLAV YM+ D D+  A ECFEKSL I+ LQV  WFT+GCCCLQ KE+ KA +AF+  +RL+PDNFEAWNNCA+A++    K  AL L+KEA KY+YENWR+W+NI ++S+    F  TI AY++L+DL+  + +   L+V+V  V+             +R KL  LF R+++    D  IW  Y+ LL ++  Q+      + + CL  AH     S    WE    +C+  I     L+D
Sbjct:   21 IFSDIPLSELDDDTLVNNLLERSVSVLQVIDYAMSYFVAVNFIGGS-------VDESYEFDGCFQLALEDLCCEGEYPFRLTKSLSLFWLCKRLCRKMSMVSQTLSFLYHLNYLKCIYLHQYLIGDERSPKLKSEFQDIINVCEECLDS---THTTEDVIQYLMLSSYLSAFYYEYEASKTFATRCSQYLNIDVKFCGALGKCTRFQ-----------EKEVATLTVKVNRVVESKDNKTSGNCPLPQIISLGDDVLLNNVIFSTIEEQIILSN---TEQSFILLLCELHRRHYPRDDITEQQCLAYINTVIRAIYPDSENEIKSSSSWPIATETLFRRSLLEHNSVRRTERALSQLEELSCQFKRTSPSFSERSPSTFFLSRMPSIWTLQVEQGRLLMKIGCYKSALDIFLLWDKWSEIIECYIHLNKREKAEEVIRSRLNSGDESAELYCSLGDVTNDRQHYLKAWDVSGCKSARAIRSLAVTYMYTDKDYQKAIECFEKSLEINTLQVNVWFTFGCCCLQAKEFVKAENAFRSCVRLDPDNFEAWNNCATAVLIQGKKNIALKLMKEACKYSYENWRIWENILLISADVKAFHETIYAYHRLLDLQGKYANLQVLSVMVKGVILNEMDSTGNPASNLRAKLLELFGRVTASTPNDAVIWNEYAHLLVDELPQTTYTTYQRAVHCLQAAHRCRIQSSEGPWEQSTKKCETIIDGLKALLD 718          
BLAST of Tetratricopeptide repeat protein 27 vs. TrEMBL
Match: A0A4Z2DTW2 (Tetratricopeptide repeat protein OS=Schistosoma japonicum OX=6182 GN=EWB00_005960 PE=4 SV=1)

HSP 1 Score: 440.654 bits (1132), Expect = 7.708e-140
Identity = 265/692 (38.29%), Postives = 392/692 (56.65%), Query Frame = 2
Query:   56 IKSVVNFKSLDSFELFNFISSCDLIPFDVYNQSIELFLQINFTGPKNNEIELILDNNAEIIKLISDDLTCEGEVPFIKTKGIILLWVAKLVTLKMRELKQDV-YRSCLGYMKCIYLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINPVDE-LQFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQPSESADRINDILEGARVKNLP-----NDQMVXXXXXXXXXXXXXXXXNEKPLINKPTLAEQACLVLQASIHRLKHARDDTTMEQCSEILSCALG-------NNSTRSSTWSLITDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPS-AENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAVVSGKHEE-------IRPKLKTLFARISSKDGRDPRIWMIYSDLLANDEDQSNEMKL-KVLQCLSRAH 2062
            I S +N   LD   L N +    +    V   ++  F+ +NF G   NE     D      +L  ++L CEGE PF  TK + LLW+ + +  ++  + Q + +   L Y+KCIYLHQ  + DERS  LK +  +  N   +F    L++I+  +E LQ+L+L+++L   +YEY  S    ++  + L I   F GALGK  + Q    + L + ++R   E+ D      E +R   LP     ND ++ +  L   TE       + PL N     EQ+ ++L   +HR  H RDD T +QC   ++  +        N +  SS+W + T+ L +R  L   S RRTE++L Q+EE+  QF    P  +E  ++ FFLSR+PSIW +Q++ GR+L+ +G  +SALD  L W +WP II+C   +  R +AE++IR ++    E+A L C LGDVT DR +Y +AW VS  KSARAMRSLAV YM+ D D++NA ECF+KSL I+ +Q   WFT+GCCCLQ KEY KA +AF+  +RL+PDNFEAWNNCA+A++    K  AL L+KEA KY+YENWR+W+NI ++S++   F  TI AY++L+D+   + +   L +LV AV+S   +        I  KL  LF R+++    D  IW  Y+ LL +   +S      + +QCL  A+
Sbjct:   25 IFSEINLPHLDDDSLVNILLERSVSVLKVIEYAMSYFIAVNFIGGSANE-SYEFDG---CYQLALEELCCEGEYPFRLTKSLSLLWLCRRLCKRLSTVSQTLSFLYHLNYLKCIYLHQYLIGDERSPKLKGEFLEISNLYGKF----LDSIHSSEEILQYLMLSAYLSAFYYEYENSITFASKCAQYLNIEVNFSGALGKCTRFQEKEVANLTVKVNRT-YETKDN-----ETSRSYALPQIISLNDDVLLNSVLFSMTE------KQSPLSN----TEQSFILLLCELHRRHHPRDDLTAQQCLAYINTVIQAVYPDSENETKSSSSWPIATEMLFRRSLLEHNSVRRTERALSQLEELCCQFGRTNPPLSERSINSFFLSRMPSIWTLQIEQGRLLMKIGCYKSALDSFLLWDKWPEIIECYTHLNKREKAEEVIRSRLNAGDESADLYCVLGDVTNDRQYYLKAWDVSGCKSARAMRSLAVVYMYTDKDYINAIECFQKSLEINTMQANLWFTFGCCCLQAKEYLKAENAFRSCVRLDPDNFEAWNNCATAVLLQGKKNIALTLMKEACKYSYENWRIWENILMISAEVKAFQDTILAYHRLLDICGKYANAQVLGILVKAVLSNDMDSTGHPARNIHAKLLELFGRVTASTPNDAVIWDEYAHLLVDVPSKSVYTSYQRAVQCLQTAY 692          
BLAST of Tetratricopeptide repeat protein 27 vs. TrEMBL
Match: A0A4S2LNX3 (TPR_REGION domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007390 PE=4 SV=1)

HSP 1 Score: 422.165 bits (1084), Expect = 2.265e-132
Identity = 255/661 (38.58%), Postives = 373/661 (56.43%), Query Frame = 2
Query:  155 IELFLQINFTGPKNNEIELI-----LDNNAEIIKLISDDLTCEGEVPFIKTKGIILLWVAKLVTLKMRELKQDV-YRSCLGYMKCIYLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINPVDELQFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQPSESADRINDILEGARVKNLPNDQMVXXXXXXXXXXXXXXXXNEKPLINKPTLAEQACLVLQASIHRLKHARDDTTMEQ----CSEILSCALGNNSTRS------STWSLITDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPSAENR-VDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAVV------SGKHE-EIRPKLKTLFARISSKDGRDPRIWMIYSDLLANDEDQSNEMKL-KVLQCLSRAH 2062
            +  F++ NF G  +++ +++     LD+ A I       L CEGE PF KTK + L W+ K ++L+M E+ + + +   L  +KC+YLHQ  L  ERSA L ++ Q     A E     +++I   D   F LLAS+L + +Y Y+ ++E      K L +S +  G L KR + Q    SQL++   R         +      ++ +L +D ++      +         + K      TL EQ+ ++L   +HRL +  D+ T EQ     + IL  A  ++   +      S W L T+AL +R  L   S RR+E++L Q+EE+  QF    P   +R ++ FFL+R+PS+W +Q +  R+L  MG  +SALD+ L W QW  IIDC   +  R +AE++IR+Q+    ++ +L C LGDVT +R HY  AW VS  +SARAMRSLAV YM+VD D+  A ECFEKSLSI+ LQVA WFTYGCCCLQ + Y KA +AF++ ++L+P+NFEAWNNCASA V    K  AL LLKEA K+N+ENWR+W+NI I+S+  G F  TI+A ++L+DL+E + D   L VL  AVV      SG     +R K+  LF R++S    +  IW  Y+ LL  ++         K ++ L  AH
Sbjct:   45 LNYFIRANFLGGHSDQEDVVPNLKQLDSEALIY------LICEGETPFKKTKHLGLFWLCKRLSLRMCEVSRHLLFPYLLTALKCVYLHQYLLGQERSAQLDAEFQHLLELA-ESEITAVDSIPSEDLTIFYLLASYLSVFYYRYNMADEYSTRCAKHLHLSLQLSGGLAKRTRFQSTNVSQLWIKADRSMESDYTFPDHPPALPKLVSLDDDTLLNAVVFCE---------DVKNQFRVLTLEEQSLVLLLCDLHRLAYPNDEITNEQRLVYLNTILQQAYPDSKGAAVAHASFSCWPLATEALFRRSLLEHTSVRRSERALSQLEELVNQFDRTDPPVADRAIEHFFLARMPSVWVLQAEQARLLKKMGCFKSALDIFLRWNQWSDIIDCYTHLNKREKAEEVIREQLAAGDQSPELYCALGDVTDNREHYLTAWEVSGHRSARAMRSLAVVYMYVDKDYEKAMECFEKSLSINNLQVALWFTYGCCCLQARNYPKAETAFRRCVQLDPENFEAWNNCASAAVLRGKKDVALQLLKEACKHNFENWRIWENISIISADVGAFGDTIQACHRLLDLREKYSDAEILGVLSKAVVEDVPSTSGTSAGSLRSKVLELFGRVTSVTSTNAEIWKEYAILLLGEKPSPKTTTFQKAVKNLQTAH 689          
BLAST of Tetratricopeptide repeat protein 27 vs. TrEMBL
Match: A0A074ZUJ9 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_03894 PE=4 SV=1)

HSP 1 Score: 420.624 bits (1080), Expect = 1.647e-127
Identity = 265/659 (40.21%), Postives = 382/659 (57.97%), Query Frame = 2
Query:  164 FLQINFTGPKNNEIELILDNNAEIIKLISDDL---TCEGEVPFIKTKGIILLWVAKLVTLKMRELKQDV-YRSCLGYMKCIYLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINPV---DELQFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQPSESADRINDILEGARVKNLPNDQMVXXXXXXXXXXXXXXXXNEKPLINKPTLAEQACLVLQASIHRLKHARDDTTMEQ----CSEILSCALGNNSTRS------STWSLITDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPSAENR-VDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAVV------SGKHE-EIRPKLKTLFARISSKDGRDPRIWMIYSDLLANDEDQSNEMKL-KVLQCLSRAH 2062
            F++ NF G  +++ E I    A + KL S+ L    CEGE PF K K + L W+ K ++L+M E+ + + +   L  +KCIYLHQ  L  ERSA L ++ Q      +E  E+ +  ++ +   D   F LLAS+L + +Y Y+ ++E      K L +S +F G L K  + Q    SQL++ + R   ES     D     R   LP    ++D+TLL+   F E   N+  ++   TL EQ+ ++L   +HRL +  D+ T EQ     + IL  A  ++   +      S W L T+AL +R  L   S RR+E++L Q+EE+  QF    P   +R ++ FFL+R+PS+W +Q +  R+L  MG  +SALD+ L W QW  IIDC   +  R +AE++IR+Q+    ++ +L C LGDVT +R HY  AW VS  +SARAMRSLAV +M+VD D+  A ECFEKSLSI+ LQVA WFTYGCCCLQ + Y KA +AF++ ++L+P+NFEAWNNCASA V    K  AL LLKEA K+N+ENWR+W+NI I+S+  G F  TI+A ++L+DL+E + D   L VL  AVV      SG     +R K+  LF R++S    +  IW  Y+ LL  ++         K ++ L  AH
Sbjct:   48 FIRANFLGGHSDQEEDI----ANLKKLDSEALICLVCEGETPFKKAKHLGLFWLCKRLSLRMCEVSRHLLFPYLLTALKCIYLHQYLLGQERSAQLDAEFQ----HLLELAESEITVVDSIPSEDLTTFYLLASYLSVFYYRYNMADEYSTRCSKHLHLSLQFSGGLAKCTRFQSTNVSQLWIKVDRS-VESEYTFPD-----RAPALPKLVSLDDDTLLNTVVFCEDVKNQFRVL---TLEEQSLVLLLCDLHRLAYPNDEITNEQRLVYLNTILQQAYPDSKDATVAHAPFSCWPLATEALFRRSLLEHTSVRRSERALSQLEELVNQFDRTDPPVADRAIEHFFLARMPSVWVLQAEQARLLKKMGCFKSALDIFLRWNQWSDIIDCYTHLNKREKAEEVIREQLAAGDQSPELYCALGDVTNNREHYLTAWEVSDRRSARAMRSLAVVFMYVDKDYEKAMECFEKSLSINNLQVALWFTYGCCCLQARNYPKAETAFRRCVQLDPENFEAWNNCASAAVLRGKKDVALQLLKEACKHNFENWRIWENISIISADVGAFGDTIQACHRLLDLREKYSDAEILGVLSKAVVDDVPSTSGTSAGSLRQKVLELFGRVTSVTSTNAEIWKEYALLLLGEKPSPKTTTFQKAVKNLQTAH 689          
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Cavefish
Match: ttc27 (tetratricopeptide repeat domain 27 [Source:NCBI gene;Acc:103024107])

HSP 1 Score: 287.345 bits (734), Expect = 7.988e-84
Identity = 190/596 (31.88%), Postives = 313/596 (52.52%), Query Frame = 2
Query:  383 MKCIYLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINPVDELQFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQPSESADRINDILEGARVKN--LPNDQMVXXXXXXXXXXXXXXXXNEKPLINKPTLAEQACLVLQASIHRLK----HARDDTTMEQCSEILSCALGNNSTRSSTWSLITDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPSAENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAVVSG-------KHEEIRPKLKTLFARISSKDGRDPRIWMIYSDLLANDEDQSNEMKLKVLQCLSRAHHGMC-ASGWELDKAQCKRAILSA 2128
            ++ + LHQ  L +E+S  L    + C  +  +  E      +    L F L  S+  + +Y++ K++E   + + L  +     GALGKR + Q    +QL L + R+ +            A      LP D  + D+T+L++    E  +++ P ++    AE+  L+L   I   K    H  +D   E+     +C L    ++   WS+   +L  R ++   SSRR E+++MQ + +   FT        R+  F+  R P  WE+Q +   +L  +G+T SAL +    + W   + CL ++G  G+AE+I+R++++   ET  L C LGDV KD  +Y++AW +SK +SARA RS A+ ++  + +     ECFE+SL I+P+Q+  WF+ GC    L+ Y  A  AF++ ++LEPDN EAWNN ++A ++L  K  A   L+EA++ N+E W++W+N   V    GEF+  I+AY++LMDL++ ++D   L +LV AVV         +   +R KL+ LF R+S++   D +IW  Y+ L  N +  S +   K LQ LS+AH      +GWE D +  K  +  A
Sbjct:  283 LRYVALHQQVL-EEKSPQLFDLAKSCMEKVCKREELFSSQTHKNLSLLFHLECSYTCLTYYDFLKAKERLQKARDLAELDINMTGALGKRTRFQENFLAQLILDVKRKENSPFIESESSFSPAPTPKDLLPKDHQLSDDTVLNQINLAEPCEHQLPDLS----AEEQALILGVCIDFQKNNPVHKLND---EELLAFTTCLL----SQPKFWSVEVTSLCLRTKMERTSSRRVERAMMQTQTLVDFFTETSCPVLERLKMFYSCRAPPHWEIQRQLASLLTDLGLTSSALLIYERLELWEDAVICLERLGQHGKAEEILRRELEK-KETPSLFCLLGDVLKDPQYYDQAWELSKHRSARAQRSRALFHL-RNKEFQQCVECFERSLRINPMQLGVWFSLGCAYFALEGYEGAAKAFQRCVKLEPDNSEAWNNLSTAYIKLRQKEKAFRTLQEALRCNFERWQIWENFIAVCIDVGEFSEAIRAYHRLMDLRDKYKDVEVLEILVRAVVENLTDHRGEQASSLRAKLQELFGRVSARFSTDAQIWRKYAQLYGNGQSNSKKDNEKALQFLSKAHRCETQTAGWEKDISSFKAVLKGA 864          
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Sea Lamprey
Match: ttc27 (tetratricopeptide repeat domain 27 [Source:ZFIN;Acc:ZDB-GENE-030102-1])

HSP 1 Score: 301.212 bits (770), Expect = 1.240e-90
Identity = 225/785 (28.66%), Postives = 391/785 (49.81%), Query Frame = 2
Query:   59 KSVVNFKSLDSFELF---NFISS-CDLIPFDVYNQSIELFLQINFTGPKNNEIELILDNNAEIIKLISDDLTCEGEVPFIKTKGIILLWVAKLVTLKMR--ELKQDVYRSCLGYMKCIYLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINPVDEL--QFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQPSESADRINDILEGARVKNLPNDQMVXXXXXXXXXXXXXXXXNEKPLINKPTL-AEQACLVL--------QASIHRLKHARDDTTMEQCSEILSCALGNNSTRSSTWSLITDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPSAENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAVVSG-------KHEEIRPKLKTLFARISSKDGRDPRIWMIYSDLLANDEDQSNEMKLKVLQCLSRAHH-GMCASGWELDKAQCKRAILSALRLVDKAIEYDINYASAKLAVKTVKAVM-----ESRKSKQ------VEQLDDEVQDLLTKIDEADIQLAE 2305
            +SVV F ++   +LF   N++    D+IP D++  +++      FT    + +++   N   +  L++         PF+     +LL    LVT + R    K   + +    ++C+ +HQ  L+ +RS +L +  Q C  Q  +  E  L+T      L  QF L A++  + +Y+Y +++E F+  QK+ G++    GALGKR + Q    +QL + + R+ +     +            P+  M +D  L D+    ++       ++ P L AE+  +VL         + +HRL       T E+ S      L    ++   W +   AL+ R +L   S+RR E+++MQ + +        P+   R+  FF  ++P  W ++ +   +L ++G   +AL V    + W  +I C  + G  G+AE++++Q++    ET  LLC LGDVT+    YERAW VS  +SARA RS  + ++  + + L    CFE+S++I+PLQ+  WF+ GC  +  + Y  A  AF++ + LEPDN EAWNN ++A + L+ K+ A   L+EA++ NYE+W++W+N  + S+  G+F   IKAY+++MDLKE + D   L ++V AV  G           +  K + L  R++S+   +  +W +Y+ L ++    S E   KVLQ LS+AH     +S WE D    K     A+ L   +I+      SA+ A++ + +        S K+KQ        +L  ++ D++  +D   ++L E
Sbjct:   70 QSVVFFSAVACLQLFVQSNWVGPPVDIIPADIFPAAVDKCGIQKFTEATLSALQV---NGEPVYDLVA--------YPFL-----LLLARTILVTCQARLEHFKMAPWWT----LRCLNVHQ-NLLGDRSPVLYAAAQSCIEQVGK--EEELQTSEECRHLAIQFHLEAAYTFLFYYDYKRAKEGFSAAQKMAGLAINLIGALGKRTQFQQTDVAQLIVEVKREDNPLPPSV------LSPSPTPSQHMPKDVQLGDDLLLNKVKLAHPEEVHMPELCAEELAVVLGVCTDLQKNSPVHRL-------TTEEISAFAVLIL----SQPKFWPIQVTALMLRTKLEKMSTRRVERAMMQTQALLDHLEDSTPNVTERLKVFFCCQVPPKWAIKRELASLLFSLGCNSAALQVYEKLEMWEDVIVCYERTGQHGKAEEVVQQELAK-KETPTLLCLLGDVTRQYEPYERAWEVSGHRSARAQRSKGLLHL-RNKEFLECIACFERSVTINPLQLGVWFSLGCAYMATEGYDGAARAFQRCVTLEPDNSEAWNNLSTAYIRLNQKLKAYRALQEALRCNYESWQIWENYILTSADVGDFADVIKAYHRMMDLKEGYNDEEVLHIVVRAVTEGLPDFKGDSAAALLGKARELMGRVTSRVTSNGNVWRLYAKLYSDGTSPSQEDNDKVLQFLSKAHRCDTLSSDWEKDVNSFKVVANRAVELAQVSIQCAKKKGSAQEAMQLLSSARLSLRGLSAKAKQQHTDMSTGELQGDLMDIVRAMDSLGLELQE 812          
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Yeast
Match: EMW1 (Essential conserved protein with a role in cell wall integrity; contains six TPR (tetratricopeptide repeat) domains clustered in the C-terminal region; conditional mutant is suppressed by overexpression of GFA1; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000005257])

HSP 1 Score: 124.79 bits (312), Expect = 8.923e-30
Identity = 93/379 (24.54%), Postives = 189/379 (49.87%), Query Frame = 2
Query:  851 NKPTLAEQACLVLQASIHRLKH---ARDDTTMEQCSEILSCALGNNSTRSSTWSLITDALLQRCELPTKSSRRTEKSLMQMEEISTQF-----THLIPSAE-----NRVDWFFLSRLPSI--WEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYM------FVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYE-NWRVWDNICIVSSQAGEFTTTIKAYNQLMDLK-----ETHRDPATLAVLVNAVVSGKHEE 1906
            ++PTL++   + L   ++ +K+   A+D    E+ + +LS  L  N  ++  WS+   +L +R  + T  ++  E+ L+QM+ +  +      + L+PS+      +R+   ++ +LP I  W++        +++G+ +SA+++            C   +GD  +AE+I+ Q+I +    A+    LGD+ +D S +E++W + K  +A+   SLA +Y           ++    +    SL   PL   TW+ YGC  LQ  + + A  AF + + L+P +  +W+N ++A  ++D    A + LK A+  + + NW++W+N  +V+ +  E+   + A  QL+ ++     E   D   +  LV  +V+ ++ E
Sbjct:  392 DQPTLSDYDNIQLLLRLYTIKNTTPAKDPLVEEELTALLSRILYQNGDKN--WSIFARSLWERSIIETTKAKTIERGLLQMQSLVEELDLKIKSKLVPSSSEINVASRLS--YIHQLPFIPRWQLDATLAEKYMSLGILKSAVEIYERLGMACETALCYAAVGDEKKAEEILLQRINENDSDARAYSILGDIKQDPSLWEKSWEIGKYVNAK--NSLAKYYFNPPPKSGAQPNYSATLKHLNDSLRQYPLSFETWYFYGCVGLQCGKMQIAAEAFTRCVSLDPYHALSWSNLSAAYTKMDKLKEAYSCLKRAISCDAQKNWKIWENYMLVAVKLNEWEDVLTACKQLVSIRRDKSGEGSIDLPIIEKLVELLVTSEYPE 764          
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Nematostella
Match: EDO46799 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP58])

HSP 1 Score: 254.218 bits (648), Expect = 2.993e-75
Identity = 165/526 (31.37%), Postives = 280/526 (53.23%), Query Frame = 2
Query:  530 LLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQPSESADRINDILEGARV-KNLP-NDQMVXXXXXXXXXXXXXXXXNEKPLINKPTLAEQACLVLQASIHRLKHARDDTTMEQCSEILSCALGNNSTRSSTWSLITDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPSAENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAE------CFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAV------VSG-KHEEIRPKLKTLFARISSKDGRDPRIWMIYSDLLANDEDQSNEMKLKVLQCLSRAH 2062
            +L   HL + +++  +++E F+++Q+ +GI+    GALGKR K Q    +QL + +  + S+  +   D L G  + KN+  +D  V +  +  E + +  D    PL       EQA ++ Q        A D+ +    S+ L   + + +   +TW +   AL  R +L    +R+ ++S+MQ+E +        P A +R   F+ + LP  W+V+ +  ++L+++   +SALDV L  + W  +I C   +G   +AEK++RQQ+  + ET  L C LGD+TK+  HYE+AW +S  +S+RA RSL +        HL A        CF+KSL I+ +Q   WF+ GC  +   +   A  AF + + L+  N EAWNN A+  ++L++K  A + L+EA++  Y++W +W+N  ++S   G F   ++AY++LMDLK+ ++D   L  LV  V      V+G    ++RP+L  L  R++S+   +  IW +Y+DL  N +  S E   K L  L + H
Sbjct:    1 MLELGHLSLYYWKISQAKEYFSKVQEKIGITFNLTGALGKRTKFQENFIAQLKIQVDSKASKDNEPSLDHLVGHGLPKNVALDDDTVLESVMFKERDKVVKDVQLLPL-------EQAMMLSQCVFWNKSKAHDNLS----SQELVTYIESVTRYPTTWCVHFLALFMRSKLEEDKTRKKQRSMMQLETLVNATREATPKASSRHYLFYCTPLPPKWKVERELAQVLVSLHAFKSALDVFLRLELWEDVISCYQILGKHEKAEKLVRQQLA-VNETVTLWCLLGDITKEAEHYEKAWELSNHRSSRAQRSLGLL-------HLRAVRFAECIPCFKKSLKINAIQDGVWFSLGCAAMATNDLELANKAFHRCVNLDFSNGEAWNNLANVCIKLNNKPKAHSALQEALRCKYDSWHMWENFLLISMDIGAFRDAMRAYHRLMDLKDKYKDVEVLGYLVKVVTDEAPDVNGVSASKLRPELLQLMGRVTSQITTNAAIWKMYADLYMNKD--SAEDTEKALGFLVKGH 505          
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Medaka
Match: ttc27 (tetratricopeptide repeat domain 27 [Source:NCBI gene;Acc:101172798])

HSP 1 Score: 294.664 bits (753), Expect = 1.552e-87
Identity = 234/745 (31.41%), Postives = 370/745 (49.66%), Query Frame = 2
Query:  155 IELFLQINFTGP--KNNEIELI----LDNNAEIIKLISDDLTCEGEVPFIKTKGIILLWVAKLVTLKMRELKQDVYRSCLGYMKCIYLHQATLMDERSALLKSQMQDCYNQAME--FNENGLETINPVDELQFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQPSESADRINDILEGARVKNLPNDQMVXXXXXXXXXXXXXXXXNEKPLINKPTLAEQACLVL--------QASIHRLKHARDDTTMEQCSEILSCALGNNSTRSSTWSLITDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPSAENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAVVSGKHEE-------IRPKLKTLFARISSKDGRDPRIWMIYSDLLANDEDQSNEMKLKVLQCLSRAHHGMCASG-WELDKAQCKRAILSALRLVDKAI---EYDINYASAKLAVKTVKAVMES--RKSKQVE------QLDDEVQDLLTKIDE 2284
            + +F Q N+TGP    N   L+    L +   +++ I   L  +GE  +      +LL +A+++  K     Q +       ++ I LHQ  L      LL     D  +  ME  F    L +      LQ  L  ++L + +YEY  ++E   + Q+L G+S    GALGKR + Q    +QL L +++       R+++      +  LP D  ++D+T+LDE    E D  + P ++    AE+  L+L           +H+L       T E+     SC L    ++   W++   AL  R +L    +R  E+++MQ + I   F      A  R+  F+  + P  W VQ     +LI +G T SAL +    + W   + C  ++G  G+AE+I+R++++   ET  L C LGD+ KD  +Y++AW +S  +SARAMRS A+ ++  + +     ECFE+SL I+ +Q+  WF+ GC    L+ Y  A  AF++ + LEPDN EAWNN ++A + L  K  A   L+EA+K NYE+W++W+N  +VS+  GEF   IK Y++LMDL+E ++D   L +LV AVV   ++        + PKLK L  R+SS+   D  IW  Y+ L  +    S E   K LQ L++AH     +G WE D A  K  I  A+ +    I   E   N A A   + + +  + S   K+KQ+       QL  E+QD +  ++E
Sbjct:   75 LHMFAQSNWTGPPLSLNLCNLLPAARLSSQKPLVEEIHSHLLLDGESVYSLVANPLLLLLARVILCKCSIKMQSLQLLPWWTLRYINLHQQILEAPSPQLL-----DLAHSCMEKVFKHPSLLSAQRTLTLQLHLECAYLSLTYYEYQAAKEHIRKAQELSGLSINLTGALGKRTRFQQKFLAQLILEVTKNQDGPDQRVDEA-SPTPLAILPKDCHLQDDTVLDEINLAEPDSYKLPDLS----AEEQALILGICTDFQRNNPVHKL-------TEEELLAFTSCLL----SQPKFWAVEVTALCLRTKLERGRTRCVERAMMQTQAIVDHFEDKTCPATERLKVFYCCQAPPRWAVQKVLASLLIDLGCTSSALLLYEKLELWEDAVICYERLGQHGKAEEIVRRELEK-KETPTLYCLLGDILKDHQYYDQAWELSGRRSARAMRSKALLHL-RNKELQRCVECFEQSLKINTMQLGVWFSLGCAYFALEGYEGAARAFQRCVGLEPDNAEAWNNLSTAYIRLQMKNKAFRTLQEALKCNYEHWQIWENFIVVSTDIGEFAEAIKTYHRLMDLRENYKDVQILQILVRAVVENLNDSQGVPAGALSPKLKELLGRVSSRHSSDAEIWRQYALLYGDGCSDSPEDNDKALQFLTKAHRCEVQAGSWEKDPALFKEVIKRAVHMGQVTISCSEKKSNPAEALQMLSSTRLSLRSLVTKAKQLHTDAGTGQLPAELQDGIATLEE 796          
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Medaka
Match: ttc27 (tetratricopeptide repeat domain 27 [Source:NCBI gene;Acc:101172798])

HSP 1 Score: 293.893 bits (751), Expect = 3.620e-87
Identity = 232/744 (31.18%), Postives = 369/744 (49.60%), Query Frame = 2
Query:  155 IELFLQINFTGPK-----NNEIELILDNNAEIIKLISDDLTCEGEVPFIKTKGIILLWVAKLVTLKMRELKQDVYRSCLGYMKCIYLHQATLMDERSALLKSQMQDCYNQAME--FNENGLETINPVDELQFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQPSESADRINDILEGARVKNLPNDQMVXXXXXXXXXXXXXXXXNEKPLINKPTLAEQACLVL--------QASIHRLKHARDDTTMEQCSEILSCALGNNSTRSSTWSLITDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPSAENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAVVSGKHEE-------IRPKLKTLFARISSKDGRDPRIWMIYSDLLANDEDQSNEMKLKVLQCLSRAHHGMCASG-WELDKAQCKRAILSALRLVDKAI---EYDINYASAKLAVKTVKAVMES--RKSKQVE------QLDDEVQDLLTKIDE 2284
            + +F Q N+TGP       N +     ++  +++ I   L  +GE  +      +LL +A+++  K     Q +       ++ I LHQ  L      LL     D  +  ME  F    L +      LQ  L  ++L + +YEY  ++E   + Q+L G+S    GALGKR + Q    +QL L +++       R+++      +  LP D  ++D+T+LDE    E D  + P ++    AE+  L+L           +H+L       T E+     SC L    ++   W++   AL  R +L    +R  E+++MQ + I   F      A  R+  F+  + P  W VQ     +LI +G T SAL +    + W   + C  ++G  G+AE+I+R++++   ET  L C LGD+ KD  +Y++AW +S  +SARAMRS A+ ++  + +     ECFE+SL I+ +Q+  WF+ GC    L+ Y  A  AF++ + LEPDN EAWNN ++A + L  K  A   L+EA+K NYE+W++W+N  +VS+  GEF   IK Y++LMDL+E ++D   L +LV AVV   ++        + PKLK L  R+SS+   D  IW  Y+ L  +    S E   K LQ L++AH     +G WE D A  K  I  A+ +    I   E   N A A   + + +  + S   K+KQ+       QL  E+QD +  ++E
Sbjct:   79 LHMFAQSNWTGPPLSLNLCNLLPAARLSSQPLVEEIHSHLLLDGESVYSLVANPLLLLLARVILCKCSIKMQSLQLLPWWTLRYINLHQQILEAPSPQLL-----DLAHSCMEKVFKHPSLLSAQRTLTLQLHLECAYLSLTYYEYQAAKEHIRKAQELSGLSINLTGALGKRTRFQQKFLAQLILEVTKNQDGPDQRVDEA-SPTPLAILPKDCHLQDDTVLDEINLAEPDSYKLPDLS----AEEQALILGICTDFQRNNPVHKL-------TEEELLAFTSCLL----SQPKFWAVEVTALCLRTKLERGRTRCVERAMMQTQAIVDHFEDKTCPATERLKVFYCCQAPPRWAVQKVLASLLIDLGCTSSALLLYEKLELWEDAVICYERLGQHGKAEEIVRRELEK-KETPTLYCLLGDILKDHQYYDQAWELSGRRSARAMRSKALLHL-RNKELQRCVECFEQSLKINTMQLGVWFSLGCAYFALEGYEGAARAFQRCVGLEPDNAEAWNNLSTAYIRLQMKNKAFRTLQEALKCNYEHWQIWENFIVVSTDIGEFAEAIKTYHRLMDLRENYKDVQILQILVRAVVENLNDSQGVPAGALSPKLKELLGRVSSRHSSDAEIWRQYALLYGDGCSDSPEDNDKALQFLTKAHRCEVQAGSWEKDPALFKEVIKRAVHMGQVTISCSEKKSNPAEALQMLSSTRLSLRSLVTKAKQLHTDAGTGQLPAELQDGIATLEE 799          
BLAST of Tetratricopeptide repeat protein 27 vs. Planmine SMEST
Match: SMESG000020023.1 (SMESG000020023.1)

HSP 1 Score: 1516.9 bits (3926), Expect = 0.000e+0
Identity = 751/760 (98.82%), Postives = 754/760 (99.21%), Query Frame = 2
Query:   32 MLPNYLNFIKSVVNFKSLDSFELFNFISSCDLIPFDVYNQSIELFLQINFTGPKNNEIELILDNNAEIIKLISDDLTCEGEVPFIKTKGIILLWVAKLVTLKMRELKQDVYRSCLGYMKCIYLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINPVDELQFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQPSESADRINDILEGARVKNLPNDQMVXXXXXXXXXXXXXXXXNEKPLINKPTLAEQACLVLQASIHRLKHARDDTTMEQCSEILSCALGNNSTRSSTWSLITDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPSAENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAVVSGKHEEIRPKLKTLFARISSKDGRDPRIWMIYSDLLANDEDQSNEMKLKVLQCLSRAHHGMCASGWELDKAQCKRAILSALRLVDKAIEYDINYASAKLAVKTVKAVMESRKSKQVEQLDDEVQDLLTKIDEADIQLAEKI 2311
            MLPNYLNFIKSVVNFKSLDS ELFNFISSCDLIPFDVYNQSIELFLQINFTGPKNNEIELILDNNAEI KLIS+DLTCEGEVPFIKTKGIILLWVAK VTLKMRELKQDVYRSCLGYMKCIYLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINPVDELQFLLLASHLHIK+YEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQPSESADRINDILEGARVKNLPNDQMVEDETLLDETEFLEIDDNEKPLINKPTLAEQACLVLQASIHRLKHARDDTTMEQCSEILSCALGNNS RSSTWSL TDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPSAENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAVVSGKHEEIRPKLKTLFARISSKDGRDPRIWMIYSDLLANDEDQSNEMKLKVLQCLSRAHHGMCASGWELDKAQCKRAILSALRLVDKAIEYDINYASAKLAVKTVKAV+ESRKS QVEQLDDEVQDLLTKIDEADIQLAEKI
Sbjct:    1 MLPNYLNFIKSVVNFKSLDSLELFNFISSCDLIPFDVYNQSIELFLQINFTGPKNNEIELILDNNAEISKLISNDLTCEGEVPFIKTKGIILLWVAKSVTLKMRELKQDVYRSCLGYMKCIYLHQATLMDERSALLKSQMQDCYNQAMEFNENGLETINPVDELQFLLLASHLHIKYYEYHKSEEIFNEIQKLLGISTEFRGALGKRLKTQYFIHSQLYLALSRQPSESADRINDILEGARVKNLPNDQMVEDETLLDETEFLEIDDNEKPLINKPTLAEQACLVLQASIHRLKHARDDTTMEQCSEILSCALGNNSARSSTWSLTTDALLQRCELPTKSSRRTEKSLMQMEEISTQFTHLIPSAENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSALDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDVTKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSISPLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVELDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMDLKETHRDPATLAVLVNAVVSGKHEEIRPKLKTLFARISSKDGRDPRIWMIYSDLLANDEDQSNEMKLKVLQCLSRAHHGMCASGWELDKAQCKRAILSALRLVDKAIEYDINYASAKLAVKTVKAVLESRKSSQVEQLDDEVQDLLTKIDEADIQLAEKI 760          
The following BLAST results are available for this feature:
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
TTC275.426e-9729.75tetratricopeptide repeat domain 27 [Source:HGNC Sy... [more]
TTC271.228e-1442.05tetratricopeptide repeat domain 27 [Source:HGNC Sy... [more]
TTC273.140e-725.77tetratricopeptide repeat domain 27 [Source:HGNC Sy... [more]
back to top
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
trd-11.399e-4825.69Tetratricopeptide repeat-containing protein trd-1 ... [more]
back to top
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG52902.461e-5227.75gene:FBgn0036772 transcript:FBtr0075152[more]
back to top
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ttc271.498e-9030.78tetratricopeptide repeat domain 27 [Source:ZFIN;Ac... [more]
ttc273.599e-630.56tetratricopeptide repeat domain 27 [Source:ZFIN;Ac... [more]
BX004877.13.728e-630.56pep chromosome:GRCz11:CHR_ALT_CTG17_1_15:22762959:... [more]
back to top
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adamts69.248e-10731.27ADAM metallopeptidase with thrombospondin type 1 m... [more]
adamts61.081e-10631.67ADAM metallopeptidase with thrombospondin type 1 m... [more]
adamts64.746e-10631.44ADAM metallopeptidase with thrombospondin type 1 m... [more]
adamts64.748e-10631.35ADAM metallopeptidase with thrombospondin type 1 m... [more]
adamts64.968e-10631.44ADAM metallopeptidase with thrombospondin type 1 m... [more]
back to top
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Ttc271.994e-8930.63tetratricopeptide repeat domain 27 [Source:MGI Sym... [more]
Ttc272.717e-8930.36tetratricopeptide repeat domain 27 [Source:MGI Sym... [more]
Ttc271.485e-4734.75tetratricopeptide repeat domain 27 [Source:MGI Sym... [more]
Ttc279.628e-2033.09tetratricopeptide repeat domain 27 [Source:MGI Sym... [more]
back to top
BLAST of Tetratricopeptide repeat protein 27 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P3X3|TTC27_HUMAN2.606e-9629.75Tetratricopeptide repeat protein 27 OS=Homo sapien... [more]
sp|Q5RBW9|TTC27_PONAB9.395e-9629.61Tetratricopeptide repeat protein 27 OS=Pongo abeli... [more]
sp|Q5F3K0|TTC27_CHICK5.387e-9530.38Tetratricopeptide repeat protein 27 OS=Gallus gall... [more]
sp|Q17QZ7|TTC27_BOVIN2.186e-9329.32Tetratricopeptide repeat protein 27 OS=Bos taurus ... [more]
sp|Q8CD92|TTC27_MOUSE1.395e-8830.63Tetratricopeptide repeat protein 27 OS=Mus musculu... [more]
back to top
BLAST of Tetratricopeptide repeat protein 27 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KQ578.851e-14337.12TPR_REGION domain-containing protein OS=Schistosom... [more]
G4V5K86.590e-14236.98TPR_REGION domain-containing protein OS=Schistosom... [more]
A0A4Z2DTW27.708e-14038.29Tetratricopeptide repeat protein OS=Schistosoma ja... [more]
A0A4S2LNX32.265e-13238.58TPR_REGION domain-containing protein OS=Opisthorch... [more]
A0A074ZUJ91.647e-12740.21Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ttc277.988e-8431.88tetratricopeptide repeat domain 27 [Source:NCBI ge... [more]
back to top
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ttc271.240e-9028.66tetratricopeptide repeat domain 27 [Source:ZFIN;Ac... [more]
back to top
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
EMW18.923e-3024.54Essential conserved protein with a role in cell wa... [more]
back to top
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO467992.993e-7531.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tetratricopeptide repeat protein 27 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ttc271.552e-8731.41tetratricopeptide repeat domain 27 [Source:NCBI ge... [more]
ttc273.620e-8731.18tetratricopeptide repeat domain 27 [Source:NCBI ge... [more]
back to top
BLAST of Tetratricopeptide repeat protein 27 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000020023.10.000e+098.82SMESG000020023.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032346 ID=SMED30032346|Name=Tetratricopeptide repeat protein 27|organism=Schmidtea mediterranea sexual|type=transcript|length=2328bp
CCAGTATTAATTAACAATTTAGTTAATTCACATGCTTCCAAATTATTTAA
ATTTTATAAAATCTGTTGTAAATTTTAAATCCTTAGATTCTTTCGAGTTA
TTTAATTTTATTTCCTCATGCGATTTAATTCCATTCGATGTCTACAACCA
ATCCATTGAATTATTTTTACAAATTAATTTTACTGGTCCAAAAAATAACG
AAATTGAATTAATACTGGATAACAATGCTGAAATAATTAAGTTGATTAGT
GATGATTTAACTTGCGAAGGAGAAGTTCCTTTCATTAAAACTAAAGGAAT
TATTCTTTTATGGGTAGCAAAATTAGTTACATTGAAAATGCGAGAACTGA
AACAAGATGTTTACAGAAGCTGTTTAGGTTATATGAAATGTATATATTTA
CATCAAGCTACATTGATGGATGAAAGATCAGCTCTATTAAAATCTCAAAT
GCAAGATTGTTATAATCAAGCTATGGAATTTAATGAAAATGGATTGGAAA
CAATTAATCCCGTCGATGAATTACAATTTTTATTGCTTGCAAGTCATCTT
CATATAAAATTCTATGAATATCATAAATCCGAAGAAATTTTTAATGAGAT
CCAAAAACTATTAGGAATATCAACTGAATTTCGAGGTGCATTAGGGAAGC
GGTTGAAAACCCAATATTTCATCCATAGCCAGCTGTATTTGGCCCTCTCC
AGACAGCCTTCGGAATCCGCAGATAGGATTAATGATATTTTAGAAGGAGC
TCGAGTGAAGAATTTACCAAACGATCAAATGGTTGAAGATGAAACTTTGC
TCGACGAAACTGAATTTCTCGAAATCGACGACAACGAAAAACCTCTAATC
AATAAACCGACACTCGCAGAACAAGCATGTCTCGTATTGCAAGCATCGAT
TCATCGATTGAAGCACGCAAGAGATGACACAACGATGGAACAATGCTCAG
AGATTCTCTCGTGCGCCCTTGGAAATAATTCCACCAGATCGTCGACGTGG
TCATTGATAACAGATGCGCTTTTGCAGCGCTGTGAACTGCCAACGAAATC
GTCGAGGCGAACCGAGAAATCCTTGATGCAAATGGAGGAAATTTCCACCC
AATTCACTCATTTGATTCCGAGTGCCGAAAATCGAGTCGATTGGTTTTTT
TTGTCGCGATTGCCATCGATTTGGGAAGTGCAGTTGAAATTCGGTCGAAT
TCTAATAGCGATGGGAATGACGCGGTCCGCTCTCGACGTTCTGTTGCCAT
GGCAACAGTGGCCAACTATTATCGATTGCCTTATTCAGATTGGTGATCGT
GGACGAGCTGAGAAGATTATTCGACAGCAAATTCAGGATATCGGCGAAAC
CGCTCAACTTCTCTGTTGCCTTGGTGACGTTACAAAAGATCGCTCGCATT
ACGAGCGAGCCTGGACGGTTTCAAAGGAGAAATCAGCTCGGGCTATGCGT
AGTCTCGCTGTCCATTACATGTTTGTTGATTCCGATCATCTCAATGCAGC
CGAATGCTTCGAGAAATCTCTCTCAATCAGCCCGTTGCAAGTGGCAACCT
GGTTCACTTATGGCTGTTGCTGCCTGCAACTGAAAGAATATCGCAAGGCC
GTTTCCGCTTTCAAGCAGTCCCTGCGACTGGAGCCAGACAATTTCGAGGC
CTGGAATAATTGTGCCAGTGCAATGGTTGAGCTCGATGACAAAGTGAGCG
CTCTGGCATTGTTGAAGGAAGCAGTAAAATACAACTATGAAAACTGGAGG
GTTTGGGACAACATTTGCATCGTCTCGTCACAAGCTGGGGAATTTACCAC
AACGATTAAGGCCTACAATCAATTGATGGACCTTAAAGAGACTCATCGTG
ATCCGGCTACATTAGCTGTTCTTGTAAATGCAGTTGTCAGTGGGAAACAC
GAGGAAATTCGTCCGAAACTCAAAACGTTATTTGCCCGAATCTCCAGCAA
AGACGGAAGGGATCCTCGAATTTGGATGATTTATTCGGACTTATTGGCAA
ATGATGAGGATCAATCCAATGAAATGAAACTGAAAGTTTTACAGTGTTTA
TCACGTGCTCATCATGGAATGTGTGCCAGTGGTTGGGAACTCGACAAGGC
TCAATGCAAGCGTGCTATTCTCTCGGCGTTACGACTAGTCGACAAGGCTA
TTGAATACGACATAAATTATGCCTCAGCGAAACTGGCAGTCAAAACGGTA
AAAGCTGTTATGGAAAGTCGGAAAAGTAAACAAGTAGAGCAGTTGGACGA
TGAAGTCCAAGATTTACTAACAAAAATTGATGAAGCTGATATACAATTAG
CAGAAAAAATTTAATTAATAAATTCTTC
back to top

protein sequence of SMED30032346-orf-1

>SMED30032346-orf-1 ID=SMED30032346-orf-1|Name=SMED30032346-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=761bp
MLPNYLNFIKSVVNFKSLDSFELFNFISSCDLIPFDVYNQSIELFLQINF
TGPKNNEIELILDNNAEIIKLISDDLTCEGEVPFIKTKGIILLWVAKLVT
LKMRELKQDVYRSCLGYMKCIYLHQATLMDERSALLKSQMQDCYNQAMEF
NENGLETINPVDELQFLLLASHLHIKFYEYHKSEEIFNEIQKLLGISTEF
RGALGKRLKTQYFIHSQLYLALSRQPSESADRINDILEGARVKNLPNDQM
VEDETLLDETEFLEIDDNEKPLINKPTLAEQACLVLQASIHRLKHARDDT
TMEQCSEILSCALGNNSTRSSTWSLITDALLQRCELPTKSSRRTEKSLMQ
MEEISTQFTHLIPSAENRVDWFFLSRLPSIWEVQLKFGRILIAMGMTRSA
LDVLLPWQQWPTIIDCLIQIGDRGRAEKIIRQQIQDIGETAQLLCCLGDV
TKDRSHYERAWTVSKEKSARAMRSLAVHYMFVDSDHLNAAECFEKSLSIS
PLQVATWFTYGCCCLQLKEYRKAVSAFKQSLRLEPDNFEAWNNCASAMVE
LDDKVSALALLKEAVKYNYENWRVWDNICIVSSQAGEFTTTIKAYNQLMD
LKETHRDPATLAVLVNAVVSGKHEEIRPKLKTLFARISSKDGRDPRIWMI
YSDLLANDEDQSNEMKLKVLQCLSRAHHGMCASGWELDKAQCKRAILSAL
RLVDKAIEYDINYASAKLAVKTVKAVMESRKSKQVEQLDDEVQDLLTKID
EADIQLAEKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR019734TPR_repeat
IPR011990TPR-like_helical_dom_sf
IPR013105TPR_2
IPR013026TPR-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0004812aminoacyl-tRNA ligase activity
GO:0004828serine-tRNA ligase activity
GO:0005524ATP binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006418tRNA aminoacylation for protein translation
GO:0006434seryl-tRNA aminoacylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 735..760
NoneNo IPR availablePANTHERPTHR16193UNCHARACTERIZEDcoord: 41..750
IPR019734Tetratricopeptide repeatSMARTSM00028tpr_5coord: 504..537
e-value: 0.0019
score: 27.5
coord: 538..571
e-value: 64.0
score: 7.9
coord: 572..605
e-value: 160.0
score: 4.4
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 504..537
score: 11.269
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 538..571
score: 5.871
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 572..605
score: 5.664
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 294..724
e-value: 1.8E-27
score: 98.2
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 480..600
IPR013105Tetratricopeptide repeat 2PFAMPF07719TPR_2coord: 506..537
e-value: 8.6E-6
score: 25.5
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 469..605
score: 23.004