DNA/RNA polymerases superfamily protein

Overview
NameDNA/RNA polymerases superfamily protein
Smed IDSMED30032343
Length (bp)1633
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA/RNA polymerases superfamily protein (SMED30032343) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA/RNA polymerases superfamily protein (SMED30032343) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA/RNA polymerases superfamily protein (SMED30032343) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA/RNA polymerases superfamily protein (SMED30032343) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032343

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30032343 dd_Smed_v4_3787_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30032343 dd_Smed_v4_3787_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032343 dd_Smed_v4_3787_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA/RNA polymerases superfamily protein vs. Ensembl Zebrafish
Match: CABZ01030006.1 (pep scaffold:GRCz11:KN150258.1:33006:36502:-1 gene:ENSDARG00000114113.1 transcript:ENSDART00000182402.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01030006.1)

HSP 1 Score: 48.521 bits (114), Expect = 1.516e-6
Identity = 51/192 (26.56%), Postives = 85/192 (44.27%), Query Frame = 1
Query:  457 IYRFGKPMSILTDRGLKFEGKYLKGRLQKLGINQEFSSPYQHQSNGLAERPIRTVRDFITATLAGGCEE--KN*HEPLPRIEFSINISRQSATSFSPIKIIYGQSVN--LHANLN*ADISRG-----------ELMENAKHNSDKAAD-NMRAMDTTKRDTRVFEVGEKVLGRKEPHN--RHKDGRTSFPRW 978
            + R+G P  IL+DRG +F          K  I  + ++ Y  Q+N + ER  RT++  I    AG  E+  K     LP + F++N + Q +   +P ++  G+ ++  +   L+  D+S             +L   AK N  KA    +R+ D  +RD   F   E+V  R  P +  +H       P+W
Sbjct:   92 LTRWGVPDFILSDRGAQFVSSLFTELCGKWNITPKLTTAYHPQTN-MTERVNRTLKSMI----AGFVEDNHKTWDTYLPELRFALNSAIQESIGMTPAELHLGRKIHSPMDKLLHRRDLSPTKPAYNMVHKIIQLQRQAKENYTKAQKRQLRSYDKNRRDV-FFRERERVWVRNFPISSAQHHFSAKLAPKW 277          

HSP 2 Score: 23.483 bits (49), Expect = 1.516e-6
Identity = 19/64 (29.69%), Postives = 29/64 (45.31%), Query Frame = 2
Query:  215 LRCCDICSKRKIDQTRTKEIFIPRYSSEFLEQIVMDI-AYMERNTIKN-YMLVMVDRFSKLISL 400
            ++ C  C   K D  +         +S   E   +DI   M ++  +N Y+LV VD FSK + L
Sbjct:    9 VKNCAKCQVTKWDNRKPAGKLQQVTTSRPNEMWRVDIMGPMPKSGKQNEYLLVFVDYFSKWVEL 72          
BLAST of DNA/RNA polymerases superfamily protein vs. Ensembl Xenopus
Match: ENSXETT00000023851.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV461115.1:7997:9051:-1 gene:ENSXETG00000015824.1 transcript:ENSXETT00000023851.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 4.967e-12
Identity = 35/102 (34.31%), Postives = 57/102 (55.88%), Query Frame = 1
Query:  463 RFGKPMSILTDRGLKFEGKYLKGRLQKLGINQEFSSPYQHQSNGLAERPIRTVRDFITATLAGGCEEKN*HEPLPRIEFSINISRQSATSFSPIKIIYGQSV 768
            R G P  IL+D+G +F  + L+   Q+ G+    SSPY  Q+NGL ER   T+++ +   +  G  E +  + LP + F+     Q +T FSP +++YG+ V
Sbjct:  211 RVGFPSEILSDQGPQFMSQLLQCLWQRCGVTSLRSSPYHPQTNGLCERFNGTLKNMLRTFVEAG--EGDWEKFLPCLLFAYREVPQESTGFSPFELLYGRRV 310          

HSP 2 Score: 31.187 bits (69), Expect = 4.967e-12
Identity = 30/113 (26.55%), Postives = 46/113 (40.71%), Query Frame = 2
Query:  143 YWS*EIIPLYSKDILQAEDAGLLCLRCCDICSKRKIDQTRTKEIFIP-RYSSEFLEQIVMD-IAYMER--NTIKNYMLVMVDRFSKLISLTAIMKQDEGTIFKAMLTIKSIVS 469
            YW     P  S+ + Q       C R CD C +      R K    P     E  +++ +D I  + R   T K Y+L MVD  ++     A+ + D   +  A++ I S V 
Sbjct:  113 YW-----PGLSQQVAQ------FC-RSCDSCQRVGKSGERNKHTLRPLPVIGEPFQRVAVDLIGPLSRPSRTGKQYILTMVDYATRYPEAVALRRIDAPAVADALIQIFSRVG 213          
BLAST of DNA/RNA polymerases superfamily protein vs. Ensembl Xenopus
Match: anxa6 (annexin A6 [Source:Xenbase;Acc:XB-GENE-989741])

HSP 1 Score: 62.7734 bits (151), Expect = 1.136e-9
Identity = 36/102 (35.29%), Postives = 56/102 (54.90%), Query Frame = 1
Query:  463 RFGKPMSILTDRGLKFEGKYLKGRLQKLGINQEFSSPYQHQSNGLAERPIRTVRDFITATLAGGCEEKN*HEPLPRIEFSINISRQSATSFSPIKIIYGQSV 768
            R G P  IL+D+G +F  + L+   Q+ G+    SSPY  Q+NGL ER   T++  +   +  G  EK+    LP + F+     Q +T FSP +++YG+ V
Sbjct:   31 RVGFPSEILSDQGPQFTSQLLQCLWQRCGVRAIHSSPYHPQTNGLCERFNGTLKTMLRTFVESG--EKDWERYLPHLLFAYREVPQESTGFSPFELLYGRRV 130          
BLAST of DNA/RNA polymerases superfamily protein vs. Ensembl Xenopus
Match: ENSXETT00000035398.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:9869556:9871940:-1 gene:ENSXETG00000011182.1 transcript:ENSXETT00000035398.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 1.417e-9
Identity = 36/103 (34.95%), Postives = 61/103 (59.22%), Query Frame = 1
Query:  457 IYRF-GKPMSILTDRGLKFEGKYLKGRLQKLGINQEFSSPYQHQSNGLAERPIRTVRDFITATLAGGCEEKN*HEPLPRIEFSINISRQSATSFSPIKIIYGQ 762
            I+R  G P+ I++DRG +F  ++ +   + LG++ +FSS Y  Q+NG AER  + +  F+   ++  C++    + LP  EF+ N +R S+T  SP   +YGQ
Sbjct:  602 IFRLHGFPVEIVSDRGSQFVSRFWRSLCKSLGVSLQFSSAYHPQTNGAAERVNQALEQFLRNHVS-LCQDDW-SDLLPWAEFAHNNARHSSTGRSPFLSVYGQ 702          
BLAST of DNA/RNA polymerases superfamily protein vs. Ensembl Xenopus
Match: ENSXETT00000023941.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV463742.1:21:4282:-1 gene:ENSXETG00000015734.1 transcript:ENSXETT00000023941.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 1.803e-9
Identity = 36/102 (35.29%), Postives = 56/102 (54.90%), Query Frame = 1
Query:  463 RFGKPMSILTDRGLKFEGKYLKGRLQKLGINQEFSSPYQHQSNGLAERPIRTVRDFITATLAGGCEEKN*HEPLPRIEFSINISRQSATSFSPIKIIYGQSV 768
            R G P  IL+D+G +F  + L+   Q+ G+    SSPY  Q+NGL ER   T++  +   +  G  EK+    LP + F+     Q +T FSP +++YG+ V
Sbjct:  764 RVGFPSEILSDQGPQFTSQLLQCLWQRCGVRAIHSSPYHPQTNGLCERFNGTLKTMLRTFVESG--EKDWERYLPHLLFAYREVPQESTGFSPFELLYGRRV 863          
BLAST of DNA/RNA polymerases superfamily protein vs. Ensembl Xenopus
Match: ENSXETT00000031191.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460363.1:2287392:2288407:-1 gene:ENSXETG00000009772.1 transcript:ENSXETT00000031191.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 2.575e-9
Identity = 34/103 (33.01%), Postives = 60/103 (58.25%), Query Frame = 1
Query:  457 IYRF-GKPMSILTDRGLKFEGKYLKGRLQKLGINQEFSSPYQHQSNGLAERPIRTVRDFITATLAGGCEEKN*HEPLPRIEFSINISRQSATSFSPIKIIYGQ 762
            I+R  G P+ I++DRG +F  ++ +   + LG++ +FSS Y  Q+NG AER  + +  F+   ++   ++ +  + LP  EF+ N +  S+T  SP   +YGQ
Sbjct:   49 IFRLHGFPVEIVSDRGSQFVSRFWRSLCKSLGVSLQFSSAYHPQTNGAAERVNQALEQFLRNHVSLCQDDWS--DLLPWAEFAHNNASHSSTGRSPFLSVYGQ 149          
BLAST of DNA/RNA polymerases superfamily protein vs. TrEMBL
Match: A0A3P9PE55 (Integrase catalytic domain-containing protein OS=Poecilia reticulata OX=8081 PE=4 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.779e-13
Identity = 36/110 (32.73%), Postives = 63/110 (57.27%), Query Frame = 1
Query:  457 IYRFGKPMSILTDRGLKFEGKYLKGRLQKLGINQEFSSPYQHQSNGLAERPIRTVRDFITATLAGGCEEKN*HEPLPRIEFSINISRQSATSFSPIKIIYGQSVNLHANL 786
            I R G P S+ TD+G +F+   +K     +G+++  +SPY   SNG+ ER  R+++D +   L     E + H  + ++EF+ N    S T+F+PI +++G+   L A+L
Sbjct:  122 ICRHGVPHSLHTDQGRQFDSDLIKCLCLSMGVHKTRTSPYHSMSNGMVERANRSIKDQLAKYLYSKGGEWDVH--MKQVEFAYNTCVHSTTNFTPIFLVHGREARLPADL 229          

HSP 2 Score: 36.1946 bits (82), Expect = 1.779e-13
Identity = 32/107 (29.91%), Postives = 47/107 (43.93%), Query Frame = 2
Query:  143 YWS*EIIPLYSKDILQAEDAGLLCLRCCDICSKRK----IDQTRTKEIFIPRYSSEFLEQIVMDIAYMERNTIKN-YMLVMVDRFSKLISLTAIMKQDEGTIFKAML 448
            YW     P  S+DI +       CL C   C  R+      Q   K + +    S+  E+I MD   +   T  N YMLV++D F+K I+L  +  Q   T+ K + 
Sbjct:   28 YW-----PYMSRDITE------WCLECV-ACEARRPPTPCQQAPLKHVVV----SKPFEKIAMDFTELPLTTYGNRYMLVVMDYFTKYINLYVLPDQRAVTVAKCLF 118          
BLAST of DNA/RNA polymerases superfamily protein vs. TrEMBL
Match: A0A0R1E8A2 (Uncharacterized protein (Fragment) OS=Drosophila yakuba OX=7245 GN=Dyak\GE28019 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.753e-12
Identity = 31/106 (29.25%), Postives = 59/106 (55.66%), Query Frame = 1
Query:  457 IYRFGKPMSILTDRGLKFEGKYLKGRLQKLGINQEFSSPYQHQSNGLAERPIRTVRDFITATLAGGCEEKN*HEPLPRIEFSINISRQSATSFSPIKIIYGQSVNL 774
            + R+G P  +++D G++F G+  K  +++ GI Q+F++PY  Q N   ER  RT++  I      G ++ N    +P +  + N S   +T +SP +I+ G+ + +
Sbjct:  776 VTRYGAPKILISDNGVQFTGRKTKKEMERWGIRQQFTAPYTPQENP-TERTNRTIKTMIAQIT--GEDQTNWDNKIPELMLAFNSSTSESTKYSPAQIVLGKELRI 878          

HSP 2 Score: 39.6614 bits (91), Expect = 1.753e-12
Identity = 21/67 (31.34%), Postives = 37/67 (55.22%), Query Frame = 2
Query:  215 LRCCDICSKRKIDQTRTKEIFIPRYSSEFLEQIVMD-IAYMERNTIKNY-MLVMVDRFSKLISLTAI 409
            +R C+ C + K++Q +     + R +    E + +D +  + R+   N  +LVMVD+FSK + L AI
Sbjct:  693 VRSCESCQQYKVEQQKAAGKMLTRVAEAPWETVCVDFVGPLPRSKHGNTTLLVMVDKFSKWVELAAI 759          
BLAST of DNA/RNA polymerases superfamily protein vs. TrEMBL
Match: A0A2H2IH03 (Uncharacterized protein OS=Caenorhabditis japonica OX=281687 PE=4 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.306e-11
Identity = 37/105 (35.24%), Postives = 61/105 (58.10%), Query Frame = 1
Query:  469 GKPMSILTDRGLKFEGKYLKGRLQKLGINQEFSSPYQHQSNGLAERPIRTVRDFITATLAGGCEEKN*HEPLPRIEFSINISRQSATSFSPIKIIYGQSVNLHAN 783
            G P SI TDRG  F     +  ++K GIN + ++PY HQSNG+ ER  RT+ + ++A +     + +  + LP   F+IN +  + T F+P +I++G+  +L  N
Sbjct:  730 GVPRSITTDRGTAFTSNVFRESMEKFGINHKLTAPYHHQSNGIVERANRTIEECLSAYVNSTQSDWD--QYLPMTVFAINNAPSTTTGFAPAEIVFGRKPDLPEN 832          

HSP 2 Score: 24.6386 bits (52), Expect = 1.306e-11
Identity = 21/79 (26.58%), Postives = 31/79 (39.24%), Query Frame = 2
Query:  212 CLRCCDICSKRKID-QTRTKEIF-----IPRYSSEFLEQIVMDIAYMERNTIKNYMLVMVDRFSKLISLTAIMKQDEGT 430
             L+ C  C +RK +    TKE F       R    +    +  +   E      Y+LV  D FS+ +   A+  QD  T
Sbjct:  640 ALKSCVECQRRKTNPHETTKEPFEMTDKFERPGQHWNIDHIGPLPITENGN--RYILVFRDPFSRYLVAEAVKSQDAET 716          
BLAST of DNA/RNA polymerases superfamily protein vs. TrEMBL
Match: A0A2H2IQ09 (Uncharacterized protein OS=Caenorhabditis japonica OX=281687 PE=4 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.585e-11
Identity = 37/105 (35.24%), Postives = 61/105 (58.10%), Query Frame = 1
Query:  469 GKPMSILTDRGLKFEGKYLKGRLQKLGINQEFSSPYQHQSNGLAERPIRTVRDFITATLAGGCEEKN*HEPLPRIEFSINISRQSATSFSPIKIIYGQSVNLHAN 783
            G P SI TDRG  F     +  ++K GIN + ++PY HQSNG+ ER  RT+ + ++A +     + +  + LP   F+IN +  + T F+P +I++G+  +L  N
Sbjct: 1264 GVPRSITTDRGTAFTSNVFRESMEKFGINHKLTAPYHHQSNGIVERANRTIEECLSAYVNSTQSDWD--QYLPMTVFAINNAPSTTTGFAPAEIVFGRKPDLPEN 1366          

HSP 2 Score: 24.2534 bits (51), Expect = 1.585e-11
Identity = 21/79 (26.58%), Postives = 31/79 (39.24%), Query Frame = 2
Query:  212 CLRCCDICSKRKID-QTRTKEIF-----IPRYSSEFLEQIVMDIAYMERNTIKNYMLVMVDRFSKLISLTAIMKQDEGT 430
             L+ C  C +RK +    TKE F       R    +    +  +   E      Y+LV  D FS+ +   A+  QD  T
Sbjct: 1174 ALKSCVECQRRKTNPHETTKEPFEMTDKFERPGQHWNIDHIGPLPITENGN--RYILVFRDPFSRYLVAEAVKSQDAET 1250          
BLAST of DNA/RNA polymerases superfamily protein vs. TrEMBL
Match: A0A443RXF4 (Integrase catalytic domain-containing protein (Fragment) OS=Leptotrombidium deliense OX=299467 GN=B4U80_11281 PE=4 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.709e-11
Identity = 50/166 (30.12%), Postives = 82/166 (49.40%), Query Frame = 1
Query:  457 IYRFGKPMSILTDRGLKFEGKYLKGRLQKLGINQEFSSPYQHQSNGLAERPIRTVRDFITATLAGGCEEKN*HEPLPRIEFSINISRQSATSFSPIKIIYGQSVNLHANLN*ADI----SRGELMENAKHNSDKAADNMRAMD-------TTKRDTRVFEVGEKVL 921
            + +FG P+ +++DRG  F         +K GI    S PY  +SNGLAER ++T++D +   + G    K+    L R  F++N S  ++  FSP ++++G    +   L    +    SR E +E  K N  ++A N++            KR    F++GEKVL
Sbjct:   12 VTKFGAPLVLISDRGTCFTSFETYEYFEKKGITHSTSPPYFPESNGLAERAVKTLKDTLRRQMNGIANWKS---ELSRAIFAVNTSFNASIGFSPFEMLFGFQPQIENELLIGSVIENKSRMEQIEEMKRNRIQSATNLKISQERQEKSYNEKRSEATFQIGEKVL 174          
BLAST of DNA/RNA polymerases superfamily protein vs. Ensembl Cavefish
Match: ENSAMXT00000058127.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:35454045:35455481:1 gene:ENSAMXG00000038477.1 transcript:ENSAMXT00000058127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.4546 bits (132), Expect = 8.866e-14
Identity = 32/110 (29.09%), Postives = 59/110 (53.64%), Query Frame = 1
Query:  457 IYRFGKPMSILTDRGLKFEGKYLKGRLQKLGINQEFSSPYQHQSNGLAERPIRTVRDFITATLAGGCEEKN*HEPLPRIEFSINISRQSATSFSPIKIIYGQSVNLHANL 786
            I R+G P SI TD+G  FE        + L +++  +SPY+ QS+GL ER  RT+   +  +L     +++    LP +  +   S  ++T F+P ++++G  + L  ++
Sbjct:  127 ICRYGAPRSIHTDQGRNFESHLFSELCRLLNMHKSRTSPYRPQSDGLIERFNRTLLSML--SLFVDANQQDWDALLPFVMMAYRSSVHASTGFTPYRVLFGHEIVLPVDV 234          

HSP 2 Score: 41.2022 bits (95), Expect = 8.866e-14
Identity = 26/86 (30.23%), Postives = 40/86 (46.51%), Query Frame = 2
Query:  194 EDAGLLCLRCCDICSKRKIDQTRTKEIFIPRYSSEFLEQIVMDI-AYMERNTIKN-YMLVMVDRFSKLISLTAIMKQDEGTIFKAM 445
            ED    C  C D C+ RK      +   +P  +S   E+I +DI   +     KN Y+LV+ D FSK     ++  Q+  T+ K +
Sbjct:   38 EDVERWCRECTD-CASRKTSGPAPRAPLLPSVTSRPYERIALDILGPLPETPQKNRYILVVGDYFSKWTEAFSLPNQEAKTVAKVL 122          
BLAST of DNA/RNA polymerases superfamily protein vs. Ensembl Cavefish
Match: ENSAMXT00000031920.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:11094903:11101818:1 gene:ENSAMXG00000039354.1 transcript:ENSAMXT00000031920.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 1.301e-13
Identity = 31/110 (28.18%), Postives = 59/110 (53.64%), Query Frame = 1
Query:  457 IYRFGKPMSILTDRGLKFEGKYLKGRLQKLGINQEFSSPYQHQSNGLAERPIRTVRDFITATLAGGCEEKN*HEPLPRIEFSINISRQSATSFSPIKIIYGQSVNLHANL 786
            I R+G P SI TD+G  FE        + L +++  +SPY+ QS+GL ER  RT+   ++  +    ++ +    LP +  +   S  ++T F+P ++++G  + L  ++
Sbjct:   91 ICRYGAPRSIHTDQGRNFESHLFSELCRLLNMHKSRTSPYRPQSDGLIERFNRTLLSMLSLFVDANQQDWD--ALLPFVMMAYRSSVHASTGFTPYRVLFGHEIVLPVDV 198          

HSP 2 Score: 40.0466 bits (92), Expect = 1.301e-13
Identity = 25/82 (30.49%), Postives = 39/82 (47.56%), Query Frame = 2
Query:  206 LLCLRCCDICSKRKIDQTRTKEIFIPRYSSEFLEQIVMDI-AYMERNTIKN-YMLVMVDRFSKLISLTAIMKQDEGTIFKAM 445
            L C  C D C+ RK      +   +P  +S   E+I +DI   +     KN Y+LV+ D FSK     ++  Q+  T+ K +
Sbjct:    6 LWCRECTD-CASRKTSGPAPRAPLLPSVTSRPYERIALDILGPLPETPQKNRYILVVGDYFSKWTEAFSLPNQEAKTVAKVL 86          
BLAST of DNA/RNA polymerases superfamily protein vs. Ensembl Cavefish
Match: ENSAMXT00000039384.1 (pep primary_assembly:Astyanax_mexicanus-2.0:25:21146036:21149703:-1 gene:ENSAMXG00000035834.1 transcript:ENSAMXT00000039384.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 8.784e-13
Identity = 33/110 (30.00%), Postives = 58/110 (52.73%), Query Frame = 1
Query:  457 IYRFGKPMSILTDRGLKFEGKYLKGRLQKLGINQEFSSPYQHQSNGLAERPIRTVRDFITATLAGGCEEKN*HEPLPRIEFSINISRQSATSFSPIKIIYGQSVNLHANL 786
            + R+G P  I TD+G  FE    K   + L I++  +SPY  QS+GL ER  RT+   + + +     + +    LP +  +   S Q++T FSP +++ G+ + L  ++
Sbjct:  549 LLRWGMPQVIHTDQGRTFESSLFKELCRLLEIDKTRTSPYSPQSDGLVERLNRTIIGMLASFVEAN--QNSWDTLLPFVMMAYRSSSQASTKFSPYEVLLGREIRLPIDV 656          

HSP 2 Score: 38.891 bits (89), Expect = 8.784e-13
Identity = 27/97 (27.84%), Postives = 47/97 (48.45%), Query Frame = 2
Query:  164 PLYSKDILQAEDAGLLCLRCCDICSKRKIDQTRTKEIFIPRYSSEFLEQIVMDIA--YMERNTIKNYMLVMVDRFSKLISLTAIMKQDEGTIFKAML 448
            P +SKD+ +       C R C++C+  KI     +   +P  ++   ++I +DI        T   Y+LV+ D FSK     AI  Q+  T+ +A++
Sbjct:  457 PGWSKDVKE------WC-RVCEVCATHKIVGKTPRAPLMPSVATRPFQRIALDIVGPLPVTATGNKYILVIADYFSKWAESYAIPNQEATTVARAVV 546          
BLAST of DNA/RNA polymerases superfamily protein vs. Ensembl Cavefish
Match: ENSAMXT00000033562.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000701.1:49379:53741:-1 gene:ENSAMXG00000037931.1 transcript:ENSAMXT00000033562.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 1.982e-11
Identity = 29/102 (28.43%), Postives = 54/102 (52.94%), Query Frame = 1
Query:  463 RFGKPMSILTDRGLKFEGKYLKGRLQKLGINQEFSSPYQHQSNGLAERPIRTVRDFITATLAGGCEEKN*HEPLPRIEFSINISRQSATSFSPIKIIYGQSV 768
            RFG P  + +D+G  FE + +    + LGI++  ++P   QS+GL ER  RT+   +    + G  + + H  LP +  +   + Q  T F+P  +++G+ +
Sbjct:  223 RFGVPEELHSDQGRNFESEVMAEVCRILGIHKTRTTPLHPQSDGLVERFNRTLAAQLAMVASKGQRDWDKH--LPVVLLACRSAVQETTGFTPAMLMFGREL 322          

HSP 2 Score: 37.3502 bits (85), Expect = 1.982e-11
Identity = 19/85 (22.35%), Postives = 41/85 (48.24%), Query Frame = 2
Query:  209 LCLRCCDICSKRKIDQTRTKEIFIPRYSSEFLEQIVMDI--AYMERNTIKNYMLVMVDRFSKLISLTAIMKQDEGTIFKAMLTIK 457
            L + CCD+C+ +K      +    P      +E++ +D+   +   ++   Y+LV +D F+K     A+   D+G +  A + ++
Sbjct:  136 LFVHCCDVCAAKKGPARAPRAPLHPYQCGGPMERVAVDVLGPFPVTDSGNRYVLVAMDYFTKWPEAYAV--PDQGAVTTADVLVR 218          
BLAST of DNA/RNA polymerases superfamily protein vs. Ensembl Cavefish
Match: ENSAMXT00000036301.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:28817284:28820114:1 gene:ENSAMXG00000037673.1 transcript:ENSAMXT00000036301.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 2.154e-11
Identity = 36/142 (25.35%), Postives = 71/142 (50.00%), Query Frame = 1
Query:  463 RFGKPMSILTDRGLKFEGKYLKGRLQKLGINQEFSSPYQHQSNGLAERPIRTVRDFITATLAGGCEEKN*HEPLPRIEFSINISRQSATSFSPIKIIYGQSVNLHANLN*ADISRGELMENAKHNSDKAADNMRAMDTTKRD 888
            RFG P  + +D+G  FE + +    ++LG+ +  ++P   QS+GL ER  RT+   +  T +   ++ + H  LP +  S     Q +T F+P ++++G+ +    +L     +  ++ ENA       A+ + A+    R+
Sbjct:  524 RFGIPEELHSDQGRNFESQVMAEVCKRLGVRKTRTTPLHPQSDGLVERFNRTLATQLAITTSRHQKDWDRH--LPLVLLSCRAVVQESTGFTPAQLMFGRELRTPVDLAFGLPAGLDVPENAPEYVRDLAERLTAVHQAARE 663          

HSP 2 Score: 33.4982 bits (75), Expect = 2.154e-11
Identity = 19/76 (25.00%), Postives = 34/76 (44.74%), Query Frame = 2
Query:  209 LCLRCCDICSKRKIDQTRTKEIFIPRYSSEFLEQIVMDI--AYMERNTIKNYMLVMVDRFSKLISLTAIMKQDEGT 430
            L + CCD C+ +K    R++       S   +E++ +D+   +        Y+LV +D F+K     A+  Q   T
Sbjct:  437 LFVHCCDSCTAKKGPVGRSRAPLQSLRSGAPMERVAVDVLGPFPVTEDGNRYVLVAMDFFTKWPEAYAVPDQSAAT 512          
BLAST of DNA/RNA polymerases superfamily protein vs. Ensembl Medaka
Match: ENSORLT00000045127.1 (pep primary_assembly:ASM223467v1:10:587855:593081:1 gene:ENSORLG00000029202.1 transcript:ENSORLT00000045127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 2.359e-10
Identity = 40/144 (27.78%), Postives = 73/144 (50.69%), Query Frame = 1
Query:  457 IYRFGKPMSILTDRGLKFEGKYLKGRLQKLGINQEFSSPYQHQSNGLAERPIRTVRDFITATLAGGCEEKN*HEPLPRIEFSINISRQSATSFSPIKIIYGQSVNLHANLN*ADISRGELMENAKHNSDKAADNMRA-MDTTKR 885
            + RFG P SI +D+G  FE    K     L I++  +SPY  QS+GL ER  RT+   +   +     + N  + LP +  +   S  ++TSF+P ++++G+ + L  ++   +I + E   +A     +  + + + +D  KR
Sbjct:   92 VCRFGAPRSIHSDQGRNFESTLFKELCSLLSIHKSRTSPYHPQSDGLVERFNRTLLSLLALFVEDN--QLNWDKLLPYVMLAYRSSVHASTSFTPYRVLFGREIVLPVDIM-LNIDKHETFSSADEYVSRLQETLSSVVDAVKR 232          
BLAST of DNA/RNA polymerases superfamily protein vs. Ensembl Medaka
Match: ENSORLT00000030970.1 (pep primary_assembly:ASM223467v1:3:33050390:33054691:-1 gene:ENSORLG00000030124.1 transcript:ENSORLT00000030970.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.6766 bits (117), Expect = 2.881e-10
Identity = 42/162 (25.93%), Postives = 72/162 (44.44%), Query Frame = 1
Query:  451 N*IYRF-GKPMSILTDRGLKFEGKYLKGRLQKLGINQEFSSPYQHQSNGLAERPIRTVRDFITATLAGGCEEKN*HEPLPRIEFSINISRQSATSFSPIKIIYGQSVNLHANLN*ADISRGELMENAKHNSDKAADNMRAMDTTKRDTRVFEVGEKVLGRKE 933
            N I R+ G P  I++DRG +F  ++ K   + +G     +S Y  +SNG  ER  + +   +   ++      + H  L  +E++ N    SAT  SP K ++G    L A L                  D A  ++ A+   +R  R++E   +VL R++
Sbjct: 1129 NQIVRYHGFPKDIVSDRGPQFVSRFWKEFCRLIGATVSLTSGYHPESNGQTERLNQQLETGLRCLVSQNPSTWSRH--LIWVEYAHNTLPTSATGISPFKCVFGYEPPLFAAL----------------EPDVAVPSVHAL--VRRCRRIWEAARQVLVRQQ 1270          

HSP 2 Score: 27.7202 bits (60), Expect = 2.881e-10
Identity = 9/22 (40.91%), Postives = 15/22 (68.18%), Query Frame = 3
Query:  138 CHIGVKKLFHYIVKIFYRPKMQ 203
            CH GV++  H I + F+ P+M+
Sbjct: 1020 CHPGVRRTMHAISRRFWWPRME 1041          

HSP 3 Score: 26.5646 bits (57), Expect = 2.881e-10
Identity = 17/64 (26.56%), Postives = 30/64 (46.88%), Query Frame = 2
Query:  224 CDICSKRKIDQTRTKEIFIP-RYSSEFLEQIVMD-IAYMERNTIKNYMLVMVDRFSKLISLTAI 409
            C +C++ K   +R   +  P    S     I MD +  +  +     +L +VDRFSK++   A+
Sbjct: 1051 CSVCARNKSSTSRRMGLLQPLPVPSRPWADISMDFVTGLPVSRGHTTVLTVVDRFSKMVRFIAL 1114          
BLAST of DNA/RNA polymerases superfamily protein vs. Ensembl Medaka
Match: ENSORLT00000040498.1 (pep primary_assembly:ASM223467v1:12:19455035:19460205:-1 gene:ENSORLG00000026965.1 transcript:ENSORLT00000040498.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.6766 bits (117), Expect = 2.904e-10
Identity = 42/162 (25.93%), Postives = 72/162 (44.44%), Query Frame = 1
Query:  451 N*IYRF-GKPMSILTDRGLKFEGKYLKGRLQKLGINQEFSSPYQHQSNGLAERPIRTVRDFITATLAGGCEEKN*HEPLPRIEFSINISRQSATSFSPIKIIYGQSVNLHANLN*ADISRGELMENAKHNSDKAADNMRAMDTTKRDTRVFEVGEKVLGRKE 933
            N I R+ G P  I++DRG +F  ++ K   + +G     +S Y  +SNG  ER  + +   +   ++      + H  L  +E++ N    SAT  SP K ++G    L A L                  D A  ++ A+   +R  R++E   +VL R++
Sbjct: 1129 NQIVRYHGFPKDIVSDRGPQFVSRFWKEFCRLIGATVSLTSGYHPESNGQTERLNQQLETGLRCLVSQNPSTWSRH--LIWVEYAHNTLPTSATGISPFKCVFGYEPPLFAAL----------------EPDVAVPSVHAL--VRRCRRIWEAARQVLVRQQ 1270          

HSP 2 Score: 27.7202 bits (60), Expect = 2.904e-10
Identity = 9/22 (40.91%), Postives = 15/22 (68.18%), Query Frame = 3
Query:  138 CHIGVKKLFHYIVKIFYRPKMQ 203
            CH GV++  H I + F+ P+M+
Sbjct: 1020 CHPGVRRTMHAISRRFWWPRME 1041          

HSP 3 Score: 26.5646 bits (57), Expect = 2.904e-10
Identity = 17/64 (26.56%), Postives = 30/64 (46.88%), Query Frame = 2
Query:  224 CDICSKRKIDQTRTKEIFIP-RYSSEFLEQIVMD-IAYMERNTIKNYMLVMVDRFSKLISLTAI 409
            C +C++ K   +R   +  P    S     I MD +  +  +     +L +VDRFSK++   A+
Sbjct: 1051 CSVCARNKSSTSRRMGLLQPLPVPSRPWADISMDFVTGLPVSRGHTTVLTVVDRFSKMVRFIAL 1114          
BLAST of DNA/RNA polymerases superfamily protein vs. Ensembl Medaka
Match: ENSORLT00000032837.1 (pep primary_assembly:ASM223467v1:21:30117600:30122938:1 gene:ENSORLG00000024098.1 transcript:ENSORLT00000032837.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 3.046e-10
Identity = 42/162 (25.93%), Postives = 72/162 (44.44%), Query Frame = 1
Query:  451 N*IYRF-GKPMSILTDRGLKFEGKYLKGRLQKLGINQEFSSPYQHQSNGLAERPIRTVRDFITATLAGGCEEKN*HEPLPRIEFSINISRQSATSFSPIKIIYGQSVNLHANLN*ADISRGELMENAKHNSDKAADNMRAMDTTKRDTRVFEVGEKVLGRKE 933
            N I R+ G P  I++DRG +F  ++ K   + +G     +S Y  +SNG  ER  + +   +   ++      + H  L  +E++ N    SAT  SP K ++G    L A L                  D A  ++ A+   +R  R++E   +VL R++
Sbjct: 1129 NQIVRYHGFPKDIVSDRGPQFVSRFWKEFCRLIGATVSLTSGYHPESNGQTERLNQQLETGLRCLVSQNPSTWSRH--LIWVEYAHNTLPTSATGISPFKCVFGYEPPLFAAL----------------EPDVAVPSVHAL--VRRCRRIWEAARQVLVRQQ 1270          

HSP 2 Score: 27.7202 bits (60), Expect = 3.046e-10
Identity = 9/22 (40.91%), Postives = 15/22 (68.18%), Query Frame = 3
Query:  138 CHIGVKKLFHYIVKIFYRPKMQ 203
            CH GV++  H I + F+ P+M+
Sbjct: 1020 CHPGVRRTMHAISRRFWWPRME 1041          

HSP 3 Score: 26.5646 bits (57), Expect = 3.046e-10
Identity = 17/64 (26.56%), Postives = 30/64 (46.88%), Query Frame = 2
Query:  224 CDICSKRKIDQTRTKEIFIP-RYSSEFLEQIVMD-IAYMERNTIKNYMLVMVDRFSKLISLTAI 409
            C +C++ K   +R   +  P    S     I MD +  +  +     +L +VDRFSK++   A+
Sbjct: 1051 CSVCARNKSSTSRRMGLLQPLPVPSRPWADISMDFVTGLPVSRGHTTVLTVVDRFSKMVRFIAL 1114          
BLAST of DNA/RNA polymerases superfamily protein vs. Ensembl Medaka
Match: ENSORLT00000045907.1 (pep primary_assembly:ASM223467v1:21:15891837:15896927:1 gene:ENSORLG00000022632.1 transcript:ENSORLT00000045907.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 3.431e-10
Identity = 49/186 (26.34%), Postives = 79/186 (42.47%), Query Frame = 1
Query:  451 N*IYRF-GKPMSILTDRGLKFEGKYLKGRLQKLGINQEFSSPYQHQSNGLAERPIRTVRDFITATLAGGCEEKN*HEPLPRIEFSINISRQSATSFSPIKIIYGQSVNLHANL--N*ADISRGELMENAKHNSDKAADNM--------RAMDTTKRDTRVFEVGEKVLGRKEPHNRHKDGRTSFPR 975
            N I R+ G P  I++DRG +F  ++ K   + +G     +S Y  +SNG  ER  + +   +   ++      + H  L  +E++ N    SAT  SP K ++G    L A+L    +  S   L+   +H    A   +        +A D  +R   V+  G+KV       N H   R   PR
Sbjct: 1128 NQIVRYHGFPKDIVSDRGPQFVSRFWKEFCRLIGATVSLTSGYHPESNGQTERLNQQLETGLRCLVSQNPSTWSRH--LVWVEYAHNTLPTSATGLSPFKCVFGYEPPLFADLEPEVSVPSAHALVRRCRHIWAAARQVLVRQQDRVKKAADRRRRPAPVYRPGQKVWLSARDLNLHVPCRKLAPR 1311          

HSP 2 Score: 27.7202 bits (60), Expect = 3.431e-10
Identity = 9/22 (40.91%), Postives = 15/22 (68.18%), Query Frame = 3
Query:  138 CHIGVKKLFHYIVKIFYRPKMQ 203
            CH GV++  H I + F+ P+M+
Sbjct: 1019 CHPGVRRTMHAISRRFWWPRME 1040          

HSP 3 Score: 24.6386 bits (52), Expect = 3.431e-10
Identity = 16/67 (23.88%), Postives = 30/67 (44.78%), Query Frame = 2
Query:  215 LRCCDICSKRKIDQTRTKEIFIP-RYSSEFLEQIVMD-IAYMERNTIKNYMLVMVDRFSKLISLTAI 409
            +  C +C++ K        +  P    S    +I MD +  +  +     +L +VDRFSK++   A+
Sbjct: 1047 ISACSVCARNKTSTRNRMGLLQPLPIPSRPWAEISMDFVTGLPVSRGHTTVLTVVDRFSKMVRFIAL 1113          
BLAST of DNA/RNA polymerases superfamily protein vs. Planmine SMEST
Match: SMESG000040119.1 (SMESG000040119.1)

HSP 1 Score: 242.276 bits (617), Expect = 1.281e-79
Identity = 118/149 (79.19%), Postives = 127/149 (85.23%), Query Frame = 1
Query:  457 IYRFGKPMSILTDRGLKFEGKYLKGRLQKLGINQEFSSPYQHQSNGLAERPIRTVRDFITATLAGGCEEKN*HEPLPRIEFSINISRQSATSFSPIKIIYGQSVNLHANLN*ADISRGELMENAKHNSDKAADNMRAMDTTKRDTRVFE 903
            IYRFGKP SILTDRG  FE K+LK RLQKL INQEFSSPYQHQSNGLAER IRTVRD ITA LAGGCEEKN H+ LPRIEFSI+ SRQSATSFSP +IIYG+ VNLH+NL  AD+SR ELMENAKHNSDK ADNMRA+DTTKR  R  +
Sbjct:  323 IYRFGKPQSILTDRGRNFERKFLKERLQKLVINQEFSSPYQHQSNGLAERAIRTVRDLITAKLAGGCEEKNWHQLLPRIEFSISSSRQSATSFSPFEIIYGRRVNLHSNLKQADLSRRELMENAKHNSDKTADNMRAIDTTKRGARFLK 471          

HSP 2 Score: 60.8474 bits (146), Expect = 1.281e-79
Identity = 32/48 (66.67%), Postives = 36/48 (75.00%), Query Frame = 2
Query:  308 QIVMDIAYMERNTIKNYMLVMVDRFSKLISLTAIMKQDEGTIFKAMLT 451
            Q + DI Y E    K YMLV+VDRFSKLISLTAI  QDEGTIFKA++ 
Sbjct:  274 QELQDILYGE-EYYKKYMLVIVDRFSKLISLTAITNQDEGTIFKAIIN 320          

HSP 3 Score: 35.039 bits (79), Expect = 1.281e-79
Identity = 16/23 (69.57%), Postives = 18/23 (78.26%), Query Frame = 2
Query:  953 MVELHSQDGTKERRIVW-EELKK 1018
              ELHSQDGTKERR  W ++LKK
Sbjct:  477 QAELHSQDGTKERRTEWLKKLKK 499          

HSP 4 Score: 47.3654 bits (111), Expect = 4.516e-19
Identity = 19/30 (63.33%), Postives = 25/30 (83.33%), Query Frame = 1
Query: 1210 RDIEKWLLTNKQRLTSAFDALLVGDAKELW 1299
            ++ E+WLLT+ QRLTS FD LLV +AK+LW
Sbjct:   25 KEAEEWLLTSGQRLTSTFDVLLVAEAKKLW 54          

HSP 5 Score: 46.9802 bits (110), Expect = 4.516e-19
Identity = 32/65 (49.23%), Postives = 39/65 (60.00%), Query Frame = 3
Query: 1386 FAAFEIRLRKLLTEVLNSGQGKE------------ETRLREILL----TKIEETRTLAKIF*TNK 1532
            FAAFEIR+RK  TEVLN  + +E            + RLRE+LL    TKIE+ R  AKIF +NK
Sbjct:   57 FAAFEIRVRKCFTEVLNLRKKEENIVQDLLINKARDARLRELLLTKPETKIEKKRAAAKIFESNK 121          

HSP 6 Score: 39.6614 bits (91), Expect = 4.516e-19
Identity = 19/26 (73.08%), Postives = 20/26 (76.92%), Query Frame = 2
Query: 1535 GSNKTEPIKAIGQRTYANV---GQMR 1603
            GS KTE +KAIGQRTY NV   GQMR
Sbjct:  123 GSKKTEHVKAIGQRTYKNVTERGQMR 148          
BLAST of DNA/RNA polymerases superfamily protein vs. Planmine SMEST
Match: SMESG000018547.1 (SMESG000018547.1)

HSP 1 Score: 173.711 bits (439), Expect = 3.052e-64
Identity = 91/168 (54.17%), Postives = 111/168 (66.07%), Query Frame = 1
Query:  451 N*IYRFGKPMSILTDRGLKFEGKYLKGRLQKLGINQEFSSPYQHQSNGLAERPIRTVRDFITATLAGGCEEKN*HEPLPRIEFSINISRQSATSFSPIKIIYGQSVNLHANLN*ADISRGELMENAKHNSDKAADNMRAMDTTKRDTRVFEVGEKVLGRKEPHNRHKD 954
            N IYRFGKP+SILT++G  FE  + K  L KLGI QE SSPYQHQSNGL ER IRT+ D IT TLAG C EK+  E L +IEF IN ++QS+T  S  + I+G  +NLH  L     S+  +    K N+ KAA  M+ MD +KR +R+FEVGE  L  KEP NR KD
Sbjct:  133 NLIYRFGKPISILTEKGKCFESLFFKESLSKLGIKQELSSPYQHQSNGLVERVIRTMTDLITTTLAGECNEKHWVELLTKIEFMINATQQSSTGLSQFENIFGTQINLHFTLQPKPESQENINMGVKFNAGKAAVRMKNMDGSKRGSRLFEVGEDFLVIKEPQNRKKD 300          

HSP 2 Score: 91.6633 bits (226), Expect = 3.052e-64
Identity = 50/100 (50.00%), Postives = 68/100 (68.00%), Query Frame = 2
Query:  161 IPLYSKDIL---QAEDAGLLCLRCCDICSKRKIDQTRTKEIFIPRYSSEFLEQIVMDIAYMERNTIKNYMLVMVDRFSKLISLTAIMKQDEGTIFKAMLT 451
            +P Y  +I      +D+   CLR C  C+KRKIDQ   KEIF+ R SSEFL+QIV  IAYM ++  K Y++V++DRFSKL+SLT   KQD+ TIF+ ++ 
Sbjct:   35 LPHYISNIFFWPSIQDSIQECLRKCAECAKRKIDQKEIKEIFLQRGSSEFLKQIV--IAYMNQSVEKKYVVVIIDRFSKLVSLTVASKQDDQTIFRIIMN 132          
BLAST of DNA/RNA polymerases superfamily protein vs. Planmine SMEST
Match: SMESG000073986.1 (SMESG000073986.1)

HSP 1 Score: 159.458 bits (402), Expect = 1.384e-60
Identity = 84/163 (51.53%), Postives = 106/163 (65.03%), Query Frame = 1
Query:  451 N*IYRFGKPMSILTDRGLKFEGKYLKGRLQKLGINQEFSSPYQHQSNGLAERPIRTVRDFITATLAGGCEEKN*HEPLPRIEFSINISRQSATSFSPIKIIYGQSVNLHANLN*ADISRGELMENAKHNSDKAADNMRAMDTTKRDTRVFEVGEKVLGRKEPH 939
            N IYRFG+P SILTDRG  FEG      ++K GI QEFSSPYQHQSNGLAER IRTVRD +  +LA    + N    LP+IEFS+N + + +T FSP +IIY + +NL++ +      R E+ +  K N  KAA  M+  D   + TRVF VG+KVL R EPH
Sbjct:  410 NWIYRFGRPESILTDRGRIFEGSMFHDWMEKFGIKQEFSSPYQHQSNGLAERIIRTVRDMLATSLAKIKTKNNWCILLPKIEFSLNATIKISTKFSPFEIIYWRKINLYSGVGHIQKFREEIEDETKTNLVKAATTMKNRDLDNQGTRVFMVGKKVLVRLEPH 572          

HSP 2 Score: 93.5893 bits (231), Expect = 1.384e-60
Identity = 46/84 (54.76%), Postives = 58/84 (69.05%), Query Frame = 2
Query:  200 AGLLCLRCCDICSKRKIDQTRTKEIFIPRYSSEFLEQIVMDIAYMERNTIKNYMLVMVDRFSKLISLTAIMKQDEGTIFKAMLT 451
            A  LC++ C I + RKIDQ R KEI +PR    FLEQIV+DIAYME    KN M+V+++RFSKL+SL+A   QDE TI   +L 
Sbjct:  326 AKSLCIKKCKIYASRKIDQGRAKEILLPRTRKRFLEQIVVDIAYMETKESKNCMIVIINRFSKLVSLSAASTQDEATILNVILN 409          
BLAST of DNA/RNA polymerases superfamily protein vs. Planmine SMEST
Match: SMESG000057289.1 (SMESG000057289.1)

HSP 1 Score: 155.606 bits (392), Expect = 7.187e-60
Identity = 82/169 (48.52%), Postives = 106/169 (62.72%), Query Frame = 1
Query:  451 N*IYRFGKPMSILTDRGLKFEGKYLKGRLQKLGINQEFSSPYQHQSNGLAERPIRTVRDFITATLAGGCEEKN*HEPLPRIEFSINISRQSATSFSPIKIIYGQSVNLHANLN*ADISRGELMENAKHNSDKAADNMRAMDTTKRDTRVFEVGEKVLGRKEPHNRHKDG 957
            N IYRFG+P SILTD G  FEG   +  ++K  I QEF SPYQHQSNGLAER IRTVRD +  +L     + N    LP+IEFS+N + Q++T FSP +I+Y + +NL++ +      R E+ +  K N  KAA +M+  D     TRVF V EKVL R EP  R K+G
Sbjct:  136 NWIYRFGRPESILTDIGRTFEGSMFRDWMEKFDIKQEFCSPYQHQSNGLAERNIRTVRDMLATSLTEIKTKNNWCILLPKIEFSLNATIQNSTKFSPFEIVYCRKINLYSGVGHIQKCREEIEDETKTNLVKAATSMQNRDLDSLGTRVFMVEEKVLVRLEPQRRKKEG 304          

HSP 2 Score: 85.5001 bits (210), Expect = 7.187e-60
Identity = 41/76 (53.95%), Postives = 51/76 (67.11%), Query Frame = 2
Query:  224 CDICSKRKIDQTRTKEIFIPRYSSEFLEQIVMDIAYMERNTIKNYMLVMVDRFSKLISLTAIMKQDEGTIFKAMLT 451
            C IC+ RKI Q +TKEI +PR    FLEQIV+DIAYME      YM+V++D FSKL+SL+    QDE TI   +L 
Sbjct:   60 CKICASRKIYQGQTKEILLPRTGERFLEQIVVDIAYMETKESNKYMIVIIDSFSKLVSLSVASTQDEATILNFILN 135          

HSP 3 Score: 30.8018 bits (68), Expect = 7.187e-60
Identity = 11/24 (45.83%), Postives = 15/24 (62.50%), Query Frame = 3
Query:  132 ELCHIGVKKLFHYIVKIFYRPKMQ 203
            ELCH+G+KK   Y+   F+ P M 
Sbjct:   27 ELCHLGIKKTLFYLKDFFFWPSMN 50          
BLAST of DNA/RNA polymerases superfamily protein vs. Planmine SMEST
Match: SMESG000039920.1 (SMESG000039920.1)

HSP 1 Score: 160.999 bits (406), Expect = 4.821e-59
Identity = 76/152 (50.00%), Postives = 106/152 (69.74%), Query Frame = 1
Query:  448 YN*IYRFGKPMSILTDRGLKFEGKYLKGRLQKLGINQEFSSPYQHQSNGLAERPIRTVRDFITATLAGGCEEKN*HEPLPRIEFSINISRQSATSFSPIKIIYGQSVNLHANLN*ADISRGELMENAKHNSDKAADNMRAMDTTKRDTRVFE 903
            +N IYRF KP+SILTDRG  F+  Y+K R+ +L I QEF+SPYQHQSNGLAER IR VRD IT  L   CEE+N  E LPRIEF+IN ++Q++T  S  +I+YG+ +N+H+  N    S+ + +  A+ N DKA+  +  +++ KR +R F+
Sbjct:  276 HNWIYRFNKPISILTDRGRNFKSAYMKKRMAELNIKQEFASPYQHQSNGLAERVIRKVRDMITTYLKSKCEERNWFELLPRIEFNINDTQQNSTELSSFEIVYGRKINIHSKFNVQKTSKSDFINKARINLDKASIKLSQLESEKRVSREFK 427          

HSP 2 Score: 87.0409 bits (214), Expect = 4.821e-59
Identity = 44/80 (55.00%), Postives = 61/80 (76.25%), Query Frame = 2
Query:  212 CLRCCDICSKRKIDQTRTKEIFIPRYSSEFLEQIVMDIAYMERN-TIKNYMLVMVDRFSKLISLTAIMKQDEGTIFKAML 448
             L+ C +C+KRKI  ++TKE+ I R S  FLEQIV+DIAYM+R  T K Y++V++DRFSKL+SLTA+ + D+  IFK +L
Sbjct:  196 SLKKCMVCAKRKISPSKTKELMILRQSRNFLEQIVVDIAYMDRTETNKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVIL 275          
The following BLAST results are available for this feature:
BLAST of DNA/RNA polymerases superfamily protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA/RNA polymerases superfamily protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA/RNA polymerases superfamily protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA/RNA polymerases superfamily protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CABZ01030006.11.516e-626.56pep scaffold:GRCz11:KN150258.1:33006:36502:-1 gene... [more]
back to top
BLAST of DNA/RNA polymerases superfamily protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000023851.14.967e-1234.31pep primary_assembly:Xenopus_tropicalis_v9.1:KV461... [more]
anxa61.136e-935.29annexin A6 [Source:Xenbase;Acc:XB-GENE-989741][more]
ENSXETT00000035398.11.417e-934.95pep primary_assembly:Xenopus_tropicalis_v9.1:3:986... [more]
ENSXETT00000023941.11.803e-935.29pep primary_assembly:Xenopus_tropicalis_v9.1:KV463... [more]
ENSXETT00000031191.12.575e-933.01pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
back to top
BLAST of DNA/RNA polymerases superfamily protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA/RNA polymerases superfamily protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA/RNA polymerases superfamily protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P9PE551.779e-1332.73Integrase catalytic domain-containing protein OS=P... [more]
A0A0R1E8A21.753e-1229.25Uncharacterized protein (Fragment) OS=Drosophila y... [more]
A0A2H2IH031.306e-1135.24Uncharacterized protein OS=Caenorhabditis japonica... [more]
A0A2H2IQ091.585e-1135.24Uncharacterized protein OS=Caenorhabditis japonica... [more]
A0A443RXF41.709e-1130.12Integrase catalytic domain-containing protein (Fra... [more]
back to top
BLAST of DNA/RNA polymerases superfamily protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000058127.18.866e-1429.09pep primary_assembly:Astyanax_mexicanus-2.0:16:354... [more]
ENSAMXT00000031920.11.301e-1328.18pep primary_assembly:Astyanax_mexicanus-2.0:12:110... [more]
ENSAMXT00000039384.18.784e-1330.00pep primary_assembly:Astyanax_mexicanus-2.0:25:211... [more]
ENSAMXT00000033562.11.982e-1128.43pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000036301.12.154e-1125.35pep primary_assembly:Astyanax_mexicanus-2.0:15:288... [more]
back to top
BLAST of DNA/RNA polymerases superfamily protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA/RNA polymerases superfamily protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA/RNA polymerases superfamily protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA/RNA polymerases superfamily protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000045127.12.359e-1027.78pep primary_assembly:ASM223467v1:10:587855:593081:... [more]
ENSORLT00000030970.12.881e-1025.93pep primary_assembly:ASM223467v1:3:33050390:330546... [more]
ENSORLT00000040498.12.904e-1025.93pep primary_assembly:ASM223467v1:12:19455035:19460... [more]
ENSORLT00000032837.13.046e-1025.93pep primary_assembly:ASM223467v1:21:30117600:30122... [more]
ENSORLT00000045907.13.431e-1026.34pep primary_assembly:ASM223467v1:21:15891837:15896... [more]
back to top
BLAST of DNA/RNA polymerases superfamily protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040119.11.281e-7979.19SMESG000040119.1[more]
SMESG000018547.13.052e-6454.17SMESG000018547.1[more]
SMESG000073986.11.384e-6051.53SMESG000073986.1[more]
SMESG000057289.17.187e-6048.52SMESG000057289.1[more]
SMESG000039920.14.821e-5950.00SMESG000039920.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032343 ID=SMED30032343|Name=DNA/RNA polymerases superfamily protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1633bp
AATTTTAGTACAGTAGATTTCGCTTATAGAGAACTTGCTTAAAGAGAACA
AAATCGGTTAAAGAGAACTTTTTCGTTCAAAAATGGCATCAGAAACTTTT
TGCAGGCTTATTAACAACAACTTTACACCAAGAATTATGCCATATTGGAG
TTAAGAAATTATTCCATTATATAGTAAAGATATTTTACAGGCCGAAGATG
CAGGGCTACTTTGTCTACGATGTTGTGATATCTGTTCTAAGAGGAAGATT
GATCAGACAAGAACCAAGGAAATATTTATCCCCAGATATAGCTCTGAATT
CCTAGAACAAATTGTTATGGATATTGCCTATATGGAGAGGAATACTATAA
AAAATTATATGTTAGTAATGGTCGATCGTTTTAGTAAACTGATTTCTTTA
ACCGCAATAATGAAGCAAGACGAAGGAACAATTTTCAAGGCAATGCTTAC
AATTAAATCTATCGTTTCGGAAAACCAATGAGCATATTGACAGACAGAGG
TCTGAAATTTGAAGGAAAATATTTAAAGGGAAGACTACAGAAACTTGGTA
TCAATCAGGAATTTAGTTCACCTTACCAGCATCAATCAAATGGATTAGCT
GAAAGACCCATAAGAACGGTAAGAGATTTTATTACTGCGACATTGGCAGG
CGGGTGTGAAGAGAAGAACTGACATGAACCTTTACCTAGAATAGAGTTCA
GCATAAATATCAGTCGGCAGAGCGCGACCAGCTTTTCACCAATTAAGATA
ATTTATGGACAAAGTGTTAATTTACACGCAAATTTGAATTAAGCAGATAT
CTCTAGAGGAGAATTGATGGAAAATGCGAAACATAACTCAGATAAAGCTG
CAGATAATATGAGAGCTATGGACACAACAAAAAGAGACACTCGTGTTTTT
GAGGTGGGGGAGAAGGTATTAGGGCGTAAGGAACCGCATAACAGACACAA
AGATGGTCGAACTTCATTCCCAAGATGGAACTAAAGAAAGAAGAATCGTG
TGGGAAGAGTTAAAAAAAGGGACAGTTAAGACAGGGAGAGTTAAAATATT
TAAATTATCTTGTGTTTAATTAATTGATTATTTGCCATATTTTATGGAAT
AAATATTGATGGAAATTAATTCATTTAAAAATGAGTTGGATTTAACGAAT
AAGATATGCATTAGACGATATGATGGACGCGAAGATCAAAACAATCAGAA
GAATGGATCAGAGACATAGAAAAATGGCTGTTGACAAATAAACAGCGGTT
GACAAGCGCATTCGATGCATTATTAGTAGGAGATGCTAAGGAATTGTGGA
CTAGATCAGAGAATTAGAAATAACAAATTGAATGACTGACAAAATCAGAG
AATTTACAGATTTGCAGCAAGAAGATAATGAAAGATTTGCAGCTTTCGAA
ATTCGACTTAGGAAACTTTTAACTGAAGTTCTTAATTCAGGACAAGGAAA
AGAAGAAACGAGATTAAGAGAAATATTACTGACAAAAATTGAAGAAACGA
GAACGCTTGCTAAGATTTTCTGAACTAATAAAAGGGTAGCAATAAAACAG
AACCTATCAAGGCTATCGGCCAAAGAACATATGCTAACGTGGGGCAGATG
AGAGCACTAAAATACATTCACAATTACAAAATC
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR041588Integrase_H2C2
IPR012337RNaseH-like_sf
IPR001584Integrase_cat-core
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
Vocabulary: biological process
TermDefinition
GO:0015074DNA integration
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR041588Integrase zinc-binding domainPFAMPF17921Integrase_H2C2coord: 3..58
e-value: 3.6E-12
score: 46.2
NoneNo IPR availableGENE3DG3DSA:1.10.340.70coord: 1..58
e-value: 2.0E-7
score: 33.1