Hsc70-interacting protein

Overview
NameHsc70-interacting protein
Smed IDSMED30032342
Length (bp)1520
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Hsc70-interacting protein (SMED30032342) t-SNE clustered cells

Violin plots show distribution of expression levels for Hsc70-interacting protein (SMED30032342) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Hsc70-interacting protein (SMED30032342) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Hsc70-interacting protein (SMED30032342) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032342

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30032342SMESG000040419.1 SMESG000040416.1 SmedASXL_005971SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30032342SMESG000005563.1 SmedASXL_003767SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30032342SMESG000040419.1 SMESG000040416.1 SMESG000005563.1 dd_Smed_v4_19613_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30032342SMESG000040419.1 SMESG000040416.1 SMESG000005563.1 dd_Smed_v4_19613_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032342SMESG000040419.1 SMESG000040416.1 SMESG000005563.1 dd_Smed_v4_19613_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032342SMESG000040419.1 SMESG000040416.1 SMESG000005563.1 dd_Smed_v4_19613_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30032342SMESG000040419.1 SMESG000040416.1 SMESG000005563.1 dd_Smed_v6_19613_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Hsc70-interacting protein vs. Ensembl Human
Match: CNBD2 (cyclic nucleotide binding domain containing 2 [Source:HGNC Symbol;Acc:HGNC:16145])

HSP 1 Score: 74.7146 bits (182), Expect = 9.261e-14
Identity = 58/233 (24.89%), Postives = 116/233 (49.79%), Query Frame = 1
Query:  265 EISSPLMFDSSIYKADKQLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLE-------KGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIFMSGGVKMIMDPDHDEFIKSSFLSEFPQELLANNPNKFFFQYFRDNEILSRDTNNSNWIYLVKSGEISVV 942
            ++ S + FD+  + A++    P+ I+ I++K+   +T+DE++ V   L+ + + R Y   +Q  +AK   +E++  +R+++++G + +SFY I  G+V +     TK   G  A+L+       KG  FGE+ ++H + R+ST++  E  E L +  +DF    +   V+       + F K    + +  E L         + F   +++S+D   S +I  +  G   V+
Sbjct:   65 KMQSRVTFDTMDFIAEEGHFPPKAIQ-IMQKKPSWRTEDEIQAVCNILQVLDSYRNYAEPLQLLLAKVMRFERFGRRRVIIKKGQKGNSFYFIYLGTVAI-----TKDEDGSSAFLDPHPKLLHKGSCFGEMDVLHASVRRSTIVCMEETEFLVVDREDFFANKLDQEVQKDAQYRFEFFRKMELFASWSDEKLWQLVAMAKIERFSYGQLISKDFGESPFIMFISKGSCEVL 291          
BLAST of Hsc70-interacting protein vs. Ensembl Human
Match: CNBD2 (cyclic nucleotide binding domain containing 2 [Source:HGNC Symbol;Acc:HGNC:16145])

HSP 1 Score: 74.7146 bits (182), Expect = 1.255e-13
Identity = 58/233 (24.89%), Postives = 116/233 (49.79%), Query Frame = 1
Query:  265 EISSPLMFDSSIYKADKQLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLE-------KGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIFMSGGVKMIMDPDHDEFIKSSFLSEFPQELLANNPNKFFFQYFRDNEILSRDTNNSNWIYLVKSGEISVV 942
            ++ S + FD+  + A++    P+ I+ I++K+   +T+DE++ V   L+ + + R Y   +Q  +AK   +E++  +R+++++G + +SFY I  G+V +     TK   G  A+L+       KG  FGE+ ++H + R+ST++  E  E L +  +DF    +   V+       + F K    + +  E L         + F   +++S+D   S +I  +  G   V+
Sbjct:   65 KMQSRVTFDTMDFIAEEGHFPPKAIQ-IMQKKPSWRTEDEIQAVCNILQVLDSYRNYAEPLQLLLAKVMRFERFGRRRVIIKKGQKGNSFYFIYLGTVAI-----TKDEDGSSAFLDPHPKLLHKGSCFGEMDVLHASVRRSTIVCMEETEFLVVDREDFFANKLDQEVQKDAQYRFEFFRKMELFASWSDEKLWQLVAMAKIERFSYGQLISKDFGESPFIMFISKGSCEVL 291          
BLAST of Hsc70-interacting protein vs. Ensembl Human
Match: CNBD2 (cyclic nucleotide binding domain containing 2 [Source:HGNC Symbol;Acc:HGNC:16145])

HSP 1 Score: 74.7146 bits (182), Expect = 1.344e-13
Identity = 58/233 (24.89%), Postives = 116/233 (49.79%), Query Frame = 1
Query:  265 EISSPLMFDSSIYKADKQLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLE-------KGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIFMSGGVKMIMDPDHDEFIKSSFLSEFPQELLANNPNKFFFQYFRDNEILSRDTNNSNWIYLVKSGEISVV 942
            ++ S + FD+  + A++    P+ I+ I++K+   +T+DE++ V   L+ + + R Y   +Q  +AK   +E++  +R+++++G + +SFY I  G+V +     TK   G  A+L+       KG  FGE+ ++H + R+ST++  E  E L +  +DF    +   V+       + F K    + +  E L         + F   +++S+D   S +I  +  G   V+
Sbjct:   65 KMQSRVTFDTMDFIAEEGHFPPKAIQ-IMQKKPSWRTEDEIQAVCNILQVLDSYRNYAEPLQLLLAKVMRFERFGRRRVIIKKGQKGNSFYFIYLGTVAI-----TKDEDGSSAFLDPHPKLLHKGSCFGEMDVLHASVRRSTIVCMEETEFLVVDREDFFANKLDQEVQKDAQYRFEFFRKMELFASWSDEKLWQLVAMAKIERFSYGQLISKDFGESPFIMFISKGSCEVL 291          
BLAST of Hsc70-interacting protein vs. Ensembl Human
Match: RAPGEF4 (Rap guanine nucleotide exchange factor 4 [Source:HGNC Symbol;Acc:HGNC:16626])

HSP 1 Score: 58.151 bits (139), Expect = 3.074e-8
Identity = 41/157 (26.11%), Postives = 78/157 (49.68%), Query Frame = 1
Query:  316 QLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKY-NCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEP-VELLAIAIKDFHDIFMSGGVKMIMDPDHDE 780
            Q+     ++ IL+K    +T D+L+++   L  I+A+      ++R++A    +E +     +L  QG   +S+YIIL GS     +N      GVV  L +G  FG+LA+++   R ++++ +E     L +  +DF+ I        +   +HD+
Sbjct:  101 QMGPDAHMRMILRKPPGQRTVDDLEIIYEELLHIKALSHLSTTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILKGS-----VNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQ 252          
BLAST of Hsc70-interacting protein vs. Ensembl Human
Match: RAPGEF4 (Rap guanine nucleotide exchange factor 4 [Source:HGNC Symbol;Acc:HGNC:16626])

HSP 1 Score: 57.7658 bits (138), Expect = 3.628e-8
Identity = 41/157 (26.11%), Postives = 78/157 (49.68%), Query Frame = 1
Query:  316 QLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKY-NCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEP-VELLAIAIKDFHDIFMSGGVKMIMDPDHDE 780
            Q+     ++ IL+K    +T D+L+++   L  I+A+      ++R++A    +E +     +L  QG   +S+YIIL GS     +N      GVV  L +G  FG+LA+++   R ++++ +E     L +  +DF+ I        +   +HD+
Sbjct:  321 QMGPDAHMRMILRKPPGQRTVDDLEIIYEELLHIKALSHLSTTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILKGS-----VNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQ 472          

HSP 2 Score: 56.6102 bits (135), Expect = 9.369e-8
Identity = 38/130 (29.23%), Postives = 69/130 (53.08%), Query Frame = 1
Query:  349 LKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGV-VAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIF 735
            L K   +++ +++ ++   LK ++A  ++   +  +I   GYYE       L RQG   +++Y +L+GS+ V V   +     V +  L  G +FGE +I+  T R +T++ +E  ELL I  KDF  ++
Sbjct:   19 LDKRPLERSSEDVDIIFTRLKEVKAFEKFHPNLLHQICLCGYYENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIGTAFGE-SILDNTPRHATIVTRESSELLRIEQKDFKALW 147          
BLAST of Hsc70-interacting protein vs. Ensembl Celegans
Match: pkg-2 (Protein Kinase, cGMP-dependent [Source:UniProtKB/TrEMBL;Acc:Q8MQE2])

HSP 1 Score: 51.6026 bits (122), Expect = 1.182e-6
Identity = 48/160 (30.00%), Postives = 71/160 (44.38%), Query Frame = 1
Query:  349 LKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIFMSGGVKMIMD-PDHDEFIKSSFLSEFPQELL 825
            +K+ +  K+D   + +   L+    +R        KI+   Y  +     I++RQG   S  Y+I  G V VV  N        V  +E G  FGELAI+H   R +TV A E   L AI    FH I M    +  M    H ++  S+    +P+E+L
Sbjct:   48 VKRPIIGKSDAAFETIGNALRLNSFLRNLDATQIEKISSAMYPVEVPAGAIIIRQGDLGSIMYVIQEGKVQVVKDNR------FVRTMEDGALFGELAILHHCERTATVRAIESCHLWAIERNVFHAIMMESAREKTMSFKRHLKY--SARFGGYPEEVL 199          
BLAST of Hsc70-interacting protein vs. Ensembl Celegans
Match: pkg-2 (Protein Kinase, cGMP-dependent [Source:UniProtKB/TrEMBL;Acc:Q8MQE2])

HSP 1 Score: 50.8322 bits (120), Expect = 1.612e-6
Identity = 43/125 (34.40%), Postives = 58/125 (46.40%), Query Frame = 1
Query:  454 KIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIFMSGGVKMIMD-PDHDEFIKSSFLSEFPQELL 825
            KI+   Y  +     I++RQG   S  Y+I  G V VV  N        V  +E G  FGELAI+H   R +TV A E   L AI    FH I M    +  M    H ++  S+    +P+E+L
Sbjct:   47 KISSAMYPVEVPAGAIIIRQGDLGSIMYVIQEGKVQVVKDNR------FVRTMEDGALFGELAILHHCERTATVRAIESCHLWAIERNVFHAIMMESAREKTMSFKRHLKY--SARFGGYPEEVL 163          
BLAST of Hsc70-interacting protein vs. Ensembl Fly
Match: CG4839 (gene:FBgn0032187 transcript:FBtr0079943)

HSP 1 Score: 49.2914 bits (116), Expect = 8.053e-6
Identity = 40/169 (23.67%), Postives = 76/169 (44.97%), Query Frame = 1
Query:  484 YNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIFMSGGVKMIMDPDHDEFIKSS-FLSEFPQELLANNPNKFFFQYFRDNEILSRDTNNSNWIYLVKSGEISVVFPKPKKTGEKTENKI 987
            Y    +++R+    S  Y+   G        D    G +VA       FGELAI++   RQ+++ A     +  IA + F  I    G +     ++ +F++S+ FL EF Q LL    +    +++  +  + R+    N  Y+++ G +++     KK  E+ + +I
Sbjct:  453 YRKHSLIIREHEEGSEIYVSAEGQY------DVIRGGQLVASFGPATVFGELAILYNAPRQASIEAATDARVWKIARETFRAIMQISGSR--EREENLQFLRSAPFLQEFDQSLLLKVVDLLQRKFYETDSCIVREGELGNEFYIIRCGTVTI-----KKLDEQQQEQI 608          
BLAST of Hsc70-interacting protein vs. Ensembl Fly
Match: CG4839 (gene:FBgn0032187 transcript:FBtr0079944)

HSP 1 Score: 49.2914 bits (116), Expect = 8.053e-6
Identity = 40/169 (23.67%), Postives = 76/169 (44.97%), Query Frame = 1
Query:  484 YNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIFMSGGVKMIMDPDHDEFIKSS-FLSEFPQELLANNPNKFFFQYFRDNEILSRDTNNSNWIYLVKSGEISVVFPKPKKTGEKTENKI 987
            Y    +++R+    S  Y+   G        D    G +VA       FGELAI++   RQ+++ A     +  IA + F  I    G +     ++ +F++S+ FL EF Q LL    +    +++  +  + R+    N  Y+++ G +++     KK  E+ + +I
Sbjct:  453 YRKHSLIIREHEEGSEIYVSAEGQY------DVIRGGQLVASFGPATVFGELAILYNAPRQASIEAATDARVWKIARETFRAIMQISGSR--EREENLQFLRSAPFLQEFDQSLLLKVVDLLQRKFYETDSCIVREGELGNEFYIIRCGTVTI-----KKLDEQQQEQI 608          
BLAST of Hsc70-interacting protein vs. Ensembl Zebrafish
Match: rapgef4 (Rap guanine nucleotide exchange factor (GEF) 4 [Source:ZFIN;Acc:ZDB-GENE-070912-385])

HSP 1 Score: 60.4622 bits (145), Expect = 3.926e-9
Identity = 46/188 (24.47%), Postives = 89/188 (47.34%), Query Frame = 1
Query:  316 QLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKY-NCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEP-VELLAIAIKDFHDIFMSGGVKMIMDPDHDEFI--------KSSFLSEFPQELLANNPNKFF 849
            Q+     ++ IL+K+   +T D+L+++   L  I+A+      ++R++A    +E +     +L  QG   +S+YIIL GS     +N      GVV  L +G  FG+LA+++   R ++++ +E     L +  +DF+ I        +   +H+E +        +SS  S     +++  P K  
Sbjct:  324 QIGPDAHLRMILRKQPGQRTVDDLEIIYEELLHIKALSHLSTTVKRELAGVLIFESHAKAGTVLFNQGEEGTSWYIILKGS-----VNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDFCHFLRVDKEDFNRILRDVEANTVRLKEHEEDVLVLEKANNRSSSSSPLKYTVMSGTPEKIL 506          

HSP 2 Score: 60.077 bits (144), Expect = 4.748e-9
Identity = 38/131 (29.01%), Postives = 72/131 (54.96%), Query Frame = 1
Query:  346 ILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGV-VAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIF 735
             L K  ++++ +++ ++ + LK ++A  ++   + ++I   G+YE       L RQG   +++Y +LSGS+ V V         V +  L  G +FGE +I+  T R +T++ +E  ELL I  KDF +++
Sbjct:   24 CLDKRPEERSGEDVDIIMVRLKSVKAFEKFHPPLLQQICLCGFYECLEKGITLYRQGDIGTNWYTVLSGSLDVKVSETANHQDAVTICTLGIGTAFGE-SILDNTPRHATIVTREFSELLRIEQKDFRNLW 153          
BLAST of Hsc70-interacting protein vs. Ensembl Zebrafish
Match: rapgef4 (Rap guanine nucleotide exchange factor (GEF) 4 [Source:ZFIN;Acc:ZDB-GENE-070912-385])

HSP 1 Score: 60.4622 bits (145), Expect = 4.094e-9
Identity = 46/188 (24.47%), Postives = 89/188 (47.34%), Query Frame = 1
Query:  316 QLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKY-NCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEP-VELLAIAIKDFHDIFMSGGVKMIMDPDHDEFI--------KSSFLSEFPQELLANNPNKFF 849
            Q+     ++ IL+K+   +T D+L+++   L  I+A+      ++R++A    +E +     +L  QG   +S+YIIL GS     +N      GVV  L +G  FG+LA+++   R ++++ +E     L +  +DF+ I        +   +H+E +        +SS  S     +++  P K  
Sbjct:  324 QIGPDAHLRMILRKQPGQRTVDDLEIIYEELLHIKALSHLSTTVKRELAGVLIFESHAKAGTVLFNQGEEGTSWYIILKGS-----VNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDFCHFLRVDKEDFNRILRDVEANTVRLKEHEEDVLVLEKANNRSSSSSPLKYTVMSGTPEKIL 506          

HSP 2 Score: 60.4622 bits (145), Expect = 4.165e-9
Identity = 38/131 (29.01%), Postives = 72/131 (54.96%), Query Frame = 1
Query:  346 ILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGV-VAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIF 735
             L K  ++++ +++ ++ + LK ++A  ++   + ++I   G+YE       L RQG   +++Y +LSGS+ V V         V +  L  G +FGE +I+  T R +T++ +E  ELL I  KDF +++
Sbjct:   24 CLDKRPEERSGEDVDIIMVRLKSVKAFEKFHPPLLQQICLCGFYECLEKGITLYRQGDIGTNWYTVLSGSLDVKVSETANHQDAVTICTLGIGTAFGE-SILDNTPRHATIVTREFSELLRIEQKDFRNLW 153          
BLAST of Hsc70-interacting protein vs. Ensembl Zebrafish
Match: zgc:171558 (zgc:171558 [Source:ZFIN;Acc:ZDB-GENE-080219-4])

HSP 1 Score: 59.6918 bits (143), Expect = 7.249e-9
Identity = 49/178 (27.53%), Postives = 88/178 (49.44%), Query Frame = 1
Query:  346 ILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGV-VAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIF------MSGGVK---MIMD--PDHDEFIKSSFLSEFPQELLANNPNK 843
             L K   +++ +++ ++   LKG++A  ++   + ++I   G+YE       L RQG   +S+Y +LSGS+ V V         V +  L  G +FGE +I+  T R +T++++E  ELL I  ++F  ++      M+G +     +MD    +D       LS  P   ++ N NK
Sbjct:   19 CLDKRPAERSGEDVDIILARLKGVKAFEKFHPNLLQQICMCGFYEYLEKGITLYRQGDIGTSWYAVLSGSLDVKVSETANHQDAVTICTLGVGTAFGE-SILDNTPRHATIVSRENSELLRIEQREFKTLWEKYRQCMAGLLAPPYGVMDSGATNDRMPDKDNLSNDPLNFMSKNLNK 195          

HSP 2 Score: 53.5286 bits (127), Expect = 5.991e-7
Identity = 43/159 (27.04%), Postives = 79/159 (49.69%), Query Frame = 1
Query:  265 EISSPLMFDSSIYKADKQLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKY-NCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEP-VELLAIAIKDFHDIF 735
            E+   L+F S I   D  +++      IL+K    +T ++L+++   L  I+AV      ++R++A    +E +     +L  QG   +S+YII  GS     +N      GVV  L +G  FG+LA+++   R ++++ +E     L +  +DF+ I 
Sbjct:  309 ELQETLLFLSQI-GPDAHMRM------ILRKPPGQRTAEDLEIIYDELLHIKAVSHLSNTVKRELAGVLIFESHAKAGTVLFNQGEEGTSWYIIQKGS-----VNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRIL 455          
BLAST of Hsc70-interacting protein vs. Ensembl Zebrafish
Match: zgc:171558 (zgc:171558 [Source:ZFIN;Acc:ZDB-GENE-080219-4])

HSP 1 Score: 58.5362 bits (140), Expect = 9.211e-9
Identity = 49/178 (27.53%), Postives = 88/178 (49.44%), Query Frame = 1
Query:  346 ILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGV-VAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIF------MSGGVK---MIMD--PDHDEFIKSSFLSEFPQELLANNPNK 843
             L K   +++ +++ ++   LKG++A  ++   + ++I   G+YE       L RQG   +S+Y +LSGS+ V V         V +  L  G +FGE +I+  T R +T++++E  ELL I  ++F  ++      M+G +     +MD    +D       LS  P   ++ N NK
Sbjct:   19 CLDKRPAERSGEDVDIILARLKGVKAFEKFHPNLLQQICMCGFYEYLEKGITLYRQGDIGTSWYAVLSGSLDVKVSETANHQDAVTICTLGVGTAFGE-SILDNTPRHATIVSRENSELLRIEQREFKTLWEKYRQCMAGLLAPPYGVMDSGATNDRMPDKDNLSNDPLNFMSKNLNK 195          
BLAST of Hsc70-interacting protein vs. Ensembl Zebrafish
Match: rapgef3 (Rap guanine nucleotide exchange factor (GEF) 3 [Source:ZFIN;Acc:ZDB-GENE-090312-38])

HSP 1 Score: 53.9138 bits (128), Expect = 3.905e-7
Identity = 33/115 (28.70%), Postives = 62/115 (53.91%), Query Frame = 1
Query:  346 ILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKY-NCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQE 687
            IL+K    +T ++L+V+   L  ++AV      +++++A    +E +     +L  QG + +S+YII  GS     +N      G+V  L +G  FG+LA+++   R +T+I +E
Sbjct:  177 ILRKCPSQRTPEDLEVIYEELLHVKAVAHLSTSVRKELASVLVFESHAKAGTVLFSQGDKGTSWYIIWRGS-----VNVITHGKGLVTTLHEGDDFGQLALVNDAPRAATIILRE 286          
BLAST of Hsc70-interacting protein vs. Ensembl Xenopus
Match: bmp4 (bone morphogenetic protein 4 [Source:Xenbase;Acc:XB-GENE-483058])

HSP 1 Score: 80.4925 bits (197), Expect = 8.617e-16
Identity = 55/202 (27.23%), Postives = 95/202 (47.03%), Query Frame = 1
Query:  316 QLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLE-------KGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIFMSGGVKMIMDPDHDEFIKSSFLSEFPQELLANNPNKFFFQYFRDNEILSRDTNNS 900
            Q   PE+   +  +  + +++ +++ +   + GI + R Y  +MQ  +A+  YY ++   R++VR+GHR  SFY + SG     V+  T+ V G  A L+       KG SFGE+A++    R +TV+  E  E L +                    D  EF ++    E  +EL      K+ FQ+FR  ++ S  ++ S
Sbjct:    2 QFTFPEKAIEVALRRPEQRSEQDIRFIRSMMMGILSFRRYSSQMQLMLARVVYYRRFGRGRVIVRKGHRGDSFYFVFSG-----VIAVTQDVDGSSALLDPEPILLHKGASFGEVALLKDLRRNATVVCMEETEFLVV--------------------DRMEFFENKLDQELQKEL------KYRFQHFRSLDLFSSWSDKS 172          
BLAST of Hsc70-interacting protein vs. Ensembl Xenopus
Match: RAPGEF4 (Rap guanine nucleotide exchange factor 4 [Source:NCBI gene;Acc:100497690])

HSP 1 Score: 58.9214 bits (141), Expect = 1.613e-8
Identity = 40/157 (25.48%), Postives = 79/157 (50.32%), Query Frame = 1
Query:  316 QLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKY-NCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEP-VELLAIAIKDFHDIFMSGGVKMIMDPDHDE 780
            Q+     ++ IL+K    ++ D+L+++   L  I+A+      ++R++A +  +E +     +L  QG   +S+YIIL GS     +N      GVV  L +G  FG+LA+++   R ++++ +E     L +  +DF+ I        +   +HD+
Sbjct:  334 QIGPDAHMRMILRKPPGQRSADDLEIIFEELIHIKALSHLSTTVKRELAGFLIFESHPKAGTVLFNQGEEGTSWYIILKGS-----VNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQ 485          

HSP 2 Score: 57.3806 bits (137), Expect = 4.387e-8
Identity = 40/131 (30.53%), Postives = 68/131 (51.91%), Query Frame = 1
Query:  346 ILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVV-AYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIF 735
             L K   +++ +++ ++   LK ++A   +   + ++I   GYYE       L RQG   +S+Y +L+GS+ V V         VV   L  G +FGE +I+  T R +T++ +E  ELL I  KDF  ++
Sbjct:   18 CLDKRPLERSGEDVDIIFARLKEVKAFERFHPNLLQQICFCGYYENLEKGITLYRQGDIGTSWYAVLTGSLDVKVSETNNHQDAVVICTLGVGTAFGE-SILDNTPRHATIVTRENSELLRIEQKDFKTLW 147          
BLAST of Hsc70-interacting protein vs. Ensembl Xenopus
Match: RAPGEF4 (Rap guanine nucleotide exchange factor 4 [Source:NCBI gene;Acc:100497690])

HSP 1 Score: 58.9214 bits (141), Expect = 1.659e-8
Identity = 40/157 (25.48%), Postives = 79/157 (50.32%), Query Frame = 1
Query:  316 QLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKY-NCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEP-VELLAIAIKDFHDIFMSGGVKMIMDPDHDE 780
            Q+     ++ IL+K    ++ D+L+++   L  I+A+      ++R++A +  +E +     +L  QG   +S+YIIL GS     +N      GVV  L +G  FG+LA+++   R ++++ +E     L +  +DF+ I        +   +HD+
Sbjct:  181 QIGPDAHMRMILRKPPGQRSADDLEIIFEELIHIKALSHLSTTVKRELAGFLIFESHPKAGTVLFNQGEEGTSWYIILKGS-----VNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQ 332          
BLAST of Hsc70-interacting protein vs. Ensembl Xenopus
Match: RAPGEF4 (Rap guanine nucleotide exchange factor 4 [Source:NCBI gene;Acc:100497690])

HSP 1 Score: 57.7658 bits (138), Expect = 3.323e-8
Identity = 40/131 (30.53%), Postives = 68/131 (51.91%), Query Frame = 1
Query:  346 ILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVV-AYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIF 735
             L K   +++ +++ ++   LK ++A   +   + ++I   GYYE       L RQG   +S+Y +L+GS+ V V         VV   L  G +FGE +I+  T R +T++ +E  ELL I  KDF  ++
Sbjct:   18 CLDKRPLERSGEDVDIIFARLKEVKAFERFHPNLLQQICFCGYYENLEKGITLYRQGDIGTSWYAVLTGSLDVKVSETNNHQDAVVICTLGVGTAFGE-SILDNTPRHATIVTRENSELLRIEQKDFKTLW 147          
BLAST of Hsc70-interacting protein vs. Ensembl Xenopus
Match: RAPGEF4 (Rap guanine nucleotide exchange factor 4 [Source:NCBI gene;Acc:100497690])

HSP 1 Score: 56.9954 bits (136), Expect = 7.044e-8
Identity = 38/124 (30.65%), Postives = 66/124 (53.23%), Query Frame = 1
Query:  367 DKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVV-AYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIF 735
            +++ +++ ++   LK ++A   +   + ++I   GYYE       L RQG   +S+Y +L+GS+ V V         VV   L  G +FGE +I+  T R +T++ +E  ELL I  KDF  ++
Sbjct:   25 ERSGEDVDIIFARLKEVKAFERFHPNLLQQICFCGYYENLEKGITLYRQGDIGTSWYAVLTGSLDVKVSETNNHQDAVVICTLGVGTAFGE-SILDNTPRHATIVTRENSELLRIEQKDFKTLW 147          
BLAST of Hsc70-interacting protein vs. Ensembl Mouse
Match: Cnbd2 (cyclic nucleotide binding domain containing 2 [Source:MGI Symbol;Acc:MGI:1918123])

HSP 1 Score: 61.2326 bits (147), Expect = 1.512e-9
Identity = 51/219 (23.29%), Postives = 100/219 (45.66%), Query Frame = 1
Query:  307 ADKQLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLE-------KGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIFMSGGVKMIMDPDHDEFIKSSFLSEFPQELLANNPNKFFFQYFRDNEILSRDTNNSNWIYLVKSGEISVV 942
            A ++   P    +I +K+   +T  E++ +   L+ +   R Y   +Q  +AK   +E++  +R++V++G   +SFY I  G+V +    D     G  A+L+       +G SFGE+ ++  T R +TV+  E  E L +  +DF    +   V+      ++ F        + +E L         + F   +++S+D  NS +I  +  G   ++
Sbjct:   51 AAQEGHFPPRAISITQKKPSWRTHQEIQDLCNILQALDCYRSYTESLQLLLAKVIRFERFGRRRVIVKKGQMGNSFYFIYLGTVAITEDED-----GSSAFLDPHPTLLHRGGSFGEMGLLSTTVRSATVVCMEETEFLVVDREDFVANKLGDEVQKETQYRYNFFRNLDIFQSWSEEKLWKLVALGRIERFSYGQMVSKDFMNSAFITFICQGNCEIL 264          
BLAST of Hsc70-interacting protein vs. Ensembl Mouse
Match: Rapgef4 (Rap guanine nucleotide exchange factor (GEF) 4 [Source:MGI Symbol;Acc:MGI:1917723])

HSP 1 Score: 60.8474 bits (146), Expect = 2.671e-9
Identity = 39/131 (29.77%), Postives = 71/131 (54.20%), Query Frame = 1
Query:  346 ILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGV-VAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIF 735
             L K   +++ +++ ++   LKG++A  ++   + R+I   GYYE       L RQG   +++Y +L+GS+ V V   +     V +  L  G +FGE +I+  T R +T++ +E  ELL I  +DF  ++
Sbjct:   18 CLDKRPLERSSEDVDIIFTRLKGVKAFEKFHPNLLRQICLCGYYENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIGTAFGE-SILDNTPRHATIVTRESSELLRIEQEDFKALW 147          

HSP 2 Score: 58.151 bits (139), Expect = 2.104e-8
Identity = 41/157 (26.11%), Postives = 78/157 (49.68%), Query Frame = 1
Query:  316 QLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKY-NCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEP-VELLAIAIKDFHDIFMSGGVKMIMDPDHDE 780
            Q+     ++ IL+K    +T D+L+++   L  I+A+      ++R++A    +E +     +L  QG   +S+YIIL GS     +N      GVV  L +G  FG+LA+++   R ++++ +E     L +  +DF+ I        +   +HD+
Sbjct:  303 QMGPDAHMRMILRKPPGQRTVDDLEIIYDELLHIKALSHLSTTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILKGS-----VNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQ 454          
BLAST of Hsc70-interacting protein vs. Ensembl Mouse
Match: Rapgef4 (Rap guanine nucleotide exchange factor (GEF) 4 [Source:MGI Symbol;Acc:MGI:1917723])

HSP 1 Score: 60.8474 bits (146), Expect = 2.828e-9
Identity = 39/131 (29.77%), Postives = 71/131 (54.20%), Query Frame = 1
Query:  346 ILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGV-VAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIF 735
             L K   +++ +++ ++   LKG++A  ++   + R+I   GYYE       L RQG   +++Y +L+GS+ V V   +     V +  L  G +FGE +I+  T R +T++ +E  ELL I  +DF  ++
Sbjct:   18 CLDKRPLERSSEDVDIIFTRLKGVKAFEKFHPNLLRQICLCGYYENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIGTAFGE-SILDNTPRHATIVTRESSELLRIEQEDFKALW 147          

HSP 2 Score: 58.151 bits (139), Expect = 2.188e-8
Identity = 41/157 (26.11%), Postives = 78/157 (49.68%), Query Frame = 1
Query:  316 QLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKY-NCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEP-VELLAIAIKDFHDIFMSGGVKMIMDPDHDE 780
            Q+     ++ IL+K    +T D+L+++   L  I+A+      ++R++A    +E +     +L  QG   +S+YIIL GS     +N      GVV  L +G  FG+LA+++   R ++++ +E     L +  +DF+ I        +   +HD+
Sbjct:  321 QMGPDAHMRMILRKPPGQRTVDDLEIIYDELLHIKALSHLSTTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILKGS-----VNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQ 472          
BLAST of Hsc70-interacting protein vs. Ensembl Mouse
Match: Cnbd2 (cyclic nucleotide binding domain containing 2 [Source:MGI Symbol;Acc:MGI:1918123])

HSP 1 Score: 60.4622 bits (145), Expect = 3.324e-9
Identity = 48/207 (23.19%), Postives = 95/207 (45.89%), Query Frame = 1
Query:  328 PEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKT--VGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIFMSGGVKMIMDPDHDEFIKSSFLSEFPQELLANNPNKFFFQYFRDNEILSRDTNNSNWIYLVKSGEISVV 942
            P    +I +K+   +T  E++ +   L+ +   R Y   +Q  +AK   +E++  +R++V++G   +SFY I  G+V +    D  +  +      L +G SFGE+ ++  T R +TV+  E  E L +  +DF    +   V+      ++ F        + +E L         + F   +++S+D  NS +I  +  G   ++
Sbjct:  175 PPRAISITQKKPSWRTHQEIQDLCNILQALDCYRSYTESLQLLLAKVIRFERFGRRRVIVKKGQMGNSFYFIYLGTVAITEDEDGSSAFLDPHPTLLHRGGSFGEMGLLSTTVRSATVVCMEETEFLVVDREDFVANKLGDEVQKETQYRYNFFRNLDIFQSWSEEKLWKLVALGRIERFSYGQMVSKDFMNSAFITFICQGNCEIL 381          
BLAST of Hsc70-interacting protein vs. Ensembl Mouse
Match: Cnbd2 (cyclic nucleotide binding domain containing 2 [Source:MGI Symbol;Acc:MGI:1918123])

HSP 1 Score: 59.6918 bits (143), Expect = 5.972e-9
Identity = 51/222 (22.97%), Postives = 101/222 (45.50%), Query Frame = 1
Query:  289 DSSIYKADKQLKVPEEIKNILKKEVKD--KTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKT--VGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIFMSGGVKMIMDPDHDEFIKSSFLSEFPQELLANNPNKFFFQYFRDNEILSRDTNNSNWIYLVKSGEISVV 942
            D S +   KQ ++    ++   +E K   +T  E++ +   L+ +   R Y   +Q  +AK   +E++  +R++V++G   +SFY I  G+V +    D  +  +      L +G SFGE+ ++  T R +TV+  E  E L +  +DF    +   V+      ++ F        + +E L         + F   +++S+D  NS +I  +  G   ++
Sbjct:   31 DFSFWDKKKQGRISFVTEDFAAQEKKPSWRTHQEIQDLCNILQALDCYRSYTESLQLLLAKVIRFERFGRRRVIVKKGQMGNSFYFIYLGTVAITEDEDGSSAFLDPHPTLLHRGGSFGEMGLLSTTVRSATVVCMEETEFLVVDREDFVANKLGDEVQKETQYRYNFFRNLDIFQSWSEEKLWKLVALGRIERFSYGQMVSKDFMNSAFITFICQGNCEIL 252          
BLAST of Hsc70-interacting protein vs. UniProt/SwissProt
Match: sp|Q95JR6|CNBD2_MACFA (Cyclic nucleotide-binding domain-containing protein 2 OS=Macaca fascicularis OX=9541 GN=CNBD2 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 3.416e-13
Identity = 58/228 (25.44%), Postives = 114/228 (50.00%), Query Frame = 1
Query:  265 EISSPLMFDSSIYKADKQLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKT--VGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIFMSGGVKMIMDPDHDEFIKSSFLSEFPQELLANNPNKFFFQYFRDNEILSRDTNNSNWIYLVKSGEISVV 942
            +I S + FD+  + A++    P+ I+ I++K+   +T+DE++ V   L+ + + R Y   +Q  +AK   +E++  +R+++++G + +SFY I  G+V +    D  +  +      L+KG  FGE  I H + R+ST++  E  E L +  +DF    +   V+       + F K    + +  E L    N    + F   +++S+D   S++I  +  G   V+
Sbjct:   65 KIQSRVTFDTMDFIAEEGHFPPKAIQ-IMQKKPSWRTEDEIQTVCNILQVLDSYRNYAEPLQLLLAKVMRFERFGRRRVIIKKGQKGNSFYFIYLGTVAITNDEDGSSAFLDPHPKLLQKGSCFGETDIQHASLRRSTIVCMEETEFLVVDREDFFANKLDQEVQKDAQYRFEFFRKMDLFASWSDEKLWQLVNMSKIERFSYGQLISKDFGESSFIMFISKGSCEVL 291          
BLAST of Hsc70-interacting protein vs. UniProt/SwissProt
Match: sp|Q96M20|CNBD2_HUMAN (Cyclic nucleotide-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CNBD2 PE=2 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 6.454e-13
Identity = 58/233 (24.89%), Postives = 116/233 (49.79%), Query Frame = 1
Query:  265 EISSPLMFDSSIYKADKQLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLE-------KGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIFMSGGVKMIMDPDHDEFIKSSFLSEFPQELLANNPNKFFFQYFRDNEILSRDTNNSNWIYLVKSGEISVV 942
            ++ S + FD+  + A++    P+ I+ I++K+   +T+DE++ V   L+ + + R Y   +Q  +AK   +E++  +R+++++G + +SFY I  G+V +     TK   G  A+L+       KG  FGE+ ++H + R+ST++  E  E L +  +DF    +   V+       + F K    + +  E L         + F   +++S+D   S +I  +  G   V+
Sbjct:   65 KMQSRVTFDTMDFIAEEGHFPPKAIQ-IMQKKPSWRTEDEIQAVCNILQVLDSYRNYAEPLQLLLAKVMRFERFGRRRVIIKKGQKGNSFYFIYLGTVAI-----TKDEDGSSAFLDPHPKLLHKGSCFGEMDVLHASVRRSTIVCMEETEFLVVDREDFFANKLDQEVQKDAQYRFEFFRKMELFASWSDEKLWQLVAMAKIERFSYGQLISKDFGESPFIMFISKGSCEVL 291          
BLAST of Hsc70-interacting protein vs. UniProt/SwissProt
Match: sp|Q9EQZ6|RPGF4_MOUSE (Rap guanine nucleotide exchange factor 4 OS=Mus musculus OX=10090 GN=Rapgef4 PE=1 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 1.978e-8
Identity = 39/131 (29.77%), Postives = 71/131 (54.20%), Query Frame = 1
Query:  346 ILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGV-VAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIF 735
             L K   +++ +++ ++   LKG++A  ++   + R+I   GYYE       L RQG   +++Y +L+GS+ V V   +     V +  L  G +FGE +I+  T R +T++ +E  ELL I  +DF  ++
Sbjct:   18 CLDKRPLERSSEDVDIIFTRLKGVKAFEKFHPNLLRQICLCGYYENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIGTAFGE-SILDNTPRHATIVTRESSELLRIEQEDFKALW 147          

HSP 2 Score: 58.151 bits (139), Expect = 1.531e-7
Identity = 41/157 (26.11%), Postives = 78/157 (49.68%), Query Frame = 1
Query:  316 QLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKY-NCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEP-VELLAIAIKDFHDIFMSGGVKMIMDPDHDE 780
            Q+     ++ IL+K    +T D+L+++   L  I+A+      ++R++A    +E +     +L  QG   +S+YIIL GS     +N      GVV  L +G  FG+LA+++   R ++++ +E     L +  +DF+ I        +   +HD+
Sbjct:  321 QMGPDAHMRMILRKPPGQRTVDDLEIIYDELLHIKALSHLSTTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILKGS-----VNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQ 472          
BLAST of Hsc70-interacting protein vs. UniProt/SwissProt
Match: sp|Q9D5U8|CNBD2_MOUSE (Cyclic nucleotide-binding domain-containing protein 2 OS=Mus musculus OX=10090 GN=Cnbd2 PE=1 SV=2)

HSP 1 Score: 60.4622 bits (145), Expect = 2.325e-8
Identity = 48/207 (23.19%), Postives = 95/207 (45.89%), Query Frame = 1
Query:  328 PEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKT--VGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIFMSGGVKMIMDPDHDEFIKSSFLSEFPQELLANNPNKFFFQYFRDNEILSRDTNNSNWIYLVKSGEISVV 942
            P    +I +K+   +T  E++ +   L+ +   R Y   +Q  +AK   +E++  +R++V++G   +SFY I  G+V +    D  +  +      L +G SFGE+ ++  T R +TV+  E  E L +  +DF    +   V+      ++ F        + +E L         + F   +++S+D  NS +I  +  G   ++
Sbjct:  175 PPRAISITQKKPSWRTHQEIQDLCNILQALDCYRSYTESLQLLLAKVIRFERFGRRRVIVKKGQMGNSFYFIYLGTVAITEDEDGSSAFLDPHPTLLHRGGSFGEMGLLSTTVRSATVVCMEETEFLVVDREDFVANKLGDEVQKETQYRYNFFRNLDIFQSWSEEKLWKLVALGRIERFSYGQMVSKDFMNSAFITFICQGNCEIL 381          
BLAST of Hsc70-interacting protein vs. UniProt/SwissProt
Match: sp|Q8WZA2|RPGF4_HUMAN (Rap guanine nucleotide exchange factor 4 OS=Homo sapiens OX=9606 GN=RAPGEF4 PE=1 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 1.742e-7
Identity = 41/157 (26.11%), Postives = 78/157 (49.68%), Query Frame = 1
Query:  316 QLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKY-NCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEP-VELLAIAIKDFHDIFMSGGVKMIMDPDHDE 780
            Q+     ++ IL+K    +T D+L+++   L  I+A+      ++R++A    +E +     +L  QG   +S+YIIL GS     +N      GVV  L +G  FG+LA+++   R ++++ +E     L +  +DF+ I        +   +HD+
Sbjct:  321 QMGPDAHMRMILRKPPGQRTVDDLEIIYEELLHIKALSHLSTTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILKGS-----VNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQ 472          

HSP 2 Score: 56.6102 bits (135), Expect = 4.499e-7
Identity = 38/130 (29.23%), Postives = 69/130 (53.08%), Query Frame = 1
Query:  349 LKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGV-VAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIF 735
            L K   +++ +++ ++   LK ++A  ++   +  +I   GYYE       L RQG   +++Y +L+GS+ V V   +     V +  L  G +FGE +I+  T R +T++ +E  ELL I  KDF  ++
Sbjct:   19 LDKRPLERSSEDVDIIFTRLKEVKAFEKFHPNLLHQICLCGYYENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIGTAFGE-SILDNTPRHATIVTRESSELLRIEQKDFKALW 147          
BLAST of Hsc70-interacting protein vs. TrEMBL
Match: A0A3M6UMV3 (Cyclic nucleotide-binding domain-containing protein OS=Pocillopora damicornis OX=46731 GN=pdam_00009327 PE=4 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 8.455e-60
Identity = 107/228 (46.93%), Postives = 161/228 (70.61%), Query Frame = 1
Query:  265 EISSPLMFDSSIYKADKQLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIFM-SGGVKMIMDPDHDEFIKS-SFLSEFPQELLANNPNKFFFQYFRDNEILSRDTNNSNWIYLVKSGEISVV 942
            ++ + L FD+S +KA+++++V  E+K IL  + + +T+ +L  V   L+ IR+  EYP R+Q+K+ K G++E +  KR ++RQGH   +FY +LSGS VV V+ + ++    V +L +G SFGELAI+H T RQSTVI++EP+ELL I+ +DF DIFM +GG+K I DPDH +FIKS  FL  +P EL+A+NP K  F +FR   +L RD+N+S+WIY++KSG   V+
Sbjct:  153 QMEAELAFDASFFKANRKMRVAAEVKLILSIQPEQRTEQQLAKVLFSLRSIRSFAEYPQRIQQKLVKVGWFETHQTKRAILRQGHIPQAFYFVLSGSAVVTVLGENESFARTVHFLRRGDSFGELAILHDTRRQSTVISREPIELLVISKEDFVDIFMLAGGIKNINDPDHQKFIKSVDFLRGWPVELMASNPKKCLFHFFRSGSVLVRDSNHSDWIYIIKSGSCQVL 380          
BLAST of Hsc70-interacting protein vs. TrEMBL
Match: A0A3S1A9N7 (Cyclic nucleotide-binding domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_006018 PE=4 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 3.427e-59
Identity = 112/239 (46.86%), Postives = 168/239 (70.29%), Query Frame = 1
Query:  280 LMFDSSIYKADKQLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIFMSGGVKMIMDPDHDEFIKS-SFLSEFPQELLANNPNKFFFQYFRDNEILSRDTNNSNWIYLVKSGEISVV--FPK--PKKTGEKTEN 981
            L+FD S +KA+K+ ++ +E   I+ K V ++T  E+   +I L+ I   +++P RMQ+KIA+ G YEK+N KR+LVRQGHRAS +Y ILSG+V V+V++  +     VAYL KGQ+FGELAII+++ RQS++IA+E  + L+I+I D+H+IFM+GGVK + DPDHD+F+KS  FL  +P  LL    +K  F YF+  ++L +D+  S+WI +VKSG ++V+    K  P  T EKT++
Sbjct:  233 LLFDPSKFKANKESRITDEFVRIMSKMVWERTPQEIYYAQIALRNIECFQDFPARMQQKIAERGMYEKFNAKRVLVRQGHRASCYYFILSGAVAVMVLDQGEAFAKPVAYLTKGQTFGELAIINRSRRQSSIIAREESQFLSISIDDYHEIFMAGGVKTMTDPDHDDFLKSLPFLKGWPLNLLHEKASKCLFLYFKRGDVLVKDSQYSDWIIVVKSGSLAVLKKLKKVLPYHTKEKTDS 471          

HSP 2 Score: 62.3882 bits (150), Expect = 1.777e-6
Identity = 38/140 (27.14%), Postives = 63/140 (45.00%), Query Frame = 1
Query: 1003 SDGNKTREINSSNARSFQKHHIRTIAEDFDLAYDNSENNLEIYADC--KWIQIQRIRENNVFGLAQCFFSNQPKFILLSKAVEVFMLDKNFFLSNSSSHYRTSLKSMLISYPSVEELEEIIRDQEHWKLYKETTLLNALN 1416
            +D +    I  + + SFQ   IRTI  D D  +   +      AD   +++ IQ + +  VFGL+      Q  F ++S   +  +++K  F  +        L+  L  YP+ EEL+  ++    W+ YK  TL   LN
Sbjct:  614 TDHSSLEVIGEAASESFQSQ-IRTIHTDLDAGFARKDPGEITAADLNPEFVHIQTLTKGRVFGLSDLILGQQTSFCVVSNGADCLLINKQMFQEHMPESLYRQLRMDLCPYPTEEELQRGLKVSVDWQAYKGITLAKTLN 752          
BLAST of Hsc70-interacting protein vs. TrEMBL
Match: A0A210QUY8 (Cyclic nucleotide-binding domain-containing protein 2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11411 PE=4 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 4.361e-59
Identity = 109/241 (45.23%), Postives = 167/241 (69.29%), Query Frame = 1
Query:  226 EFRIFIENLTFH-FEISSPLMFDSSIYKADKQLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIFMSGGVKMIMDPDHDEFIKS-SFLSEFPQELLANNPNKFFFQYFRDNEILSRDTNNSNWIYLVKSGEISVV 942
            E   FI+ L FH ++  + L+FD SI+KA+K ++VPEE K IL    +++T+ E+ V +I L+ I+A+ +YP  MQ KIA+ G YE+Y  KRI++RQGH AS++Y +LSG  VV+VM++++T      ++ KG  FGEL+II  T R +T+I +EP E L+IA KD+  IFMSGG K + DPD ++F++S SFL  +P + L  +P+K  F YF+  +IL++D+N  +WI +VKSG + ++
Sbjct:  251 EVSPFIKGLHFHDYDTPTDLLFDRSIFKANKSMRVPEETKKILCTIPRNRTEREIYVAQIALRNIKAIADYPQNMQLKIAQVGQYERYEAKRIVLRQGHPASAYYFVLSGEAVVMVMDESRTYARPAFHINKGGDFGELSIIQGTKRNATIICKEPCEFLSIAKKDYKRIFMSGGAKSLGDPDQEKFLRSLSFLDGWPLDKLKESPDKTKFLYFKRGDILAQDSNYYDWIVVVKSGSVRIL 491          

HSP 2 Score: 66.2402 bits (160), Expect = 1.064e-7
Identity = 33/126 (26.19%), Postives = 67/126 (53.17%), Query Frame = 1
Query: 1057 KHHIRTIAEDFDLAYDNSENNLEIYADCK--WIQIQRIRENNVFGLAQCFFSNQPKFILLSKAVEVFMLDKNFFLSNSSSHYRTSLKSMLISYPSVEELEEIIRDQEHWKLYKETTLLNALNRFKA 1428
            K H RTI +D  LA     +++   AD +  ++++Q + + + FGLA      QP F ++S   ++ ++DK F+++N+S   +  ++  L  +P+ EE++  ++    W  Y+  T+   L+  K 
Sbjct:  670 KEHKRTIQDD--LAKKKELDDI-TEADLRPEFVEVQTLTKGHAFGLADLILEPQPSFCIVSNGADIILIDKEFYVNNASDALKNKMRQELCPFPTDEEMQNKLQQNVDWSAYRTETMTQTLDYLKT 792          
BLAST of Hsc70-interacting protein vs. TrEMBL
Match: A7RK87 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g198328 PE=4 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 5.309e-59
Identity = 105/223 (47.09%), Postives = 152/223 (68.16%), Query Frame = 1
Query:  280 LMFDSSIYKADKQLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIFM-SGGVKMIMDPDHDEFIKS-SFLSEFPQELLANNPNKFFFQYFRDNEILSRDTNNSNWIYLVKSGEISVV 942
            L FD+S YKA+++++V  E+KNIL+   + +T+ +   V   L+ IRA  EYP R+Q K+   G+YE ++ KR ++RQG    +FY +LSGS VV V+ +  T    V +L +G SFGELAI+H T RQSTVI++EP+ELL I+ +DF DIFM +GG+K I DPDH  F++S  FL  +P ELLA NP K  F +FR   +L +D+N+++WIY++K G   V+
Sbjct:  135 LAFDASFYKANRKMRVSAEVKNILQSPQEQRTEQQCAKVLFSLRSIRAFAEYPQRIQHKLINVGWYESHSSKRAILRQGQIPQAFYFVLSGSAVVTVLGEHDTFARTVHFLRRGDSFGELAILHDTQRQSTVISREPIELLVISREDFIDIFMLAGGIKNITDPDHQIFLRSLEFLKGWPIELLATNPKKCLFHFFRSGSVLVKDSNHTDWIYIIKWGSCQVL 357          
BLAST of Hsc70-interacting protein vs. TrEMBL
Match: A0A2B4RRT6 (Cyclic nucleotide-binding domain-containing protein 2 OS=Stylophora pistillata OX=50429 GN=Cnbd2 PE=4 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 1.493e-58
Identity = 106/228 (46.49%), Postives = 160/228 (70.18%), Query Frame = 1
Query:  265 EISSPLMFDSSIYKADKQLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIFM-SGGVKMIMDPDHDEFIKS-SFLSEFPQELLANNPNKFFFQYFRDNEILSRDTNNSNWIYLVKSGEISVV 942
            ++ + L FD+S +KA+++++V  E+K IL    + +T+ +L  V   L+ IR+  EYP R+Q+K+ K G++E +  KR ++RQGH   +FY +LSGS VV V+ + ++    V +L +G SFGELAI+H T RQSTVI++E +ELL I+ +DF DIFM +GG+K I DPDH +FIKS  FL  +P EL+A+NP K  F +FR   +L+RD+N+S+WIY++KSG   V+
Sbjct:  186 QMEAELAFDASFFKANRKMRVAAEVKLILSIHPEQRTEQQLAKVLFSLRSIRSFAEYPQRIQQKLVKVGWFETHKTKRAILRQGHIPQAFYFVLSGSAVVTVLGENESFARTVHFLRRGDSFGELAILHDTRRQSTVISREAIELLVISKEDFVDIFMLAGGIKNINDPDHQKFIKSIDFLKGWPVELMASNPKKCLFHFFRSGSVLARDSNHSDWIYIIKSGSCQVL 413          
BLAST of Hsc70-interacting protein vs. Ensembl Cavefish
Match: ENSAMXT00000002114.2 (cGMP-dependent protein kinase 2-like [Source:NCBI gene;Acc:103041230])

HSP 1 Score: 60.077 bits (144), Expect = 3.333e-9
Identity = 41/168 (24.40%), Postives = 77/168 (45.83%), Query Frame = 1
Query:  451 RKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIFMSGGVKMIMDPDHDE---FIKS-SFLSEFPQELLANNPNKFFFQYFRDNEILSRDTNNSNWIYLVKSGEISVV 942
            R++    Y + Y   ++++++G   +  Y++  G      + +    G ++  +  G +FGELAI++   R +TV A     + A+  + F  I M           H+E   F++S S L + P+E LA   +     YF   E + R+    N  +++  GE+SV 
Sbjct:  187 REMVDCMYEKVYTANQLVIQEGEPGNYLYVLAEG------LLEVIQNGKLLGQMRPGTAFGELAILYNCKRTATVKAVTQSHIWALDRQTFQSIMMRS-----TQARHEEYFSFLRSVSLLKDLPEEKLAKIVDCLEIDYFDKGEYIIREGEEGNTFFIIAKGEVSVT 343          
BLAST of Hsc70-interacting protein vs. Ensembl Cavefish
Match: rapgef4 (Rap guanine nucleotide exchange factor 4 [Source:NCBI gene;Acc:103034068])

HSP 1 Score: 59.6918 bits (143), Expect = 6.152e-9
Identity = 41/157 (26.11%), Postives = 79/157 (50.32%), Query Frame = 1
Query:  316 QLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKY-NCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEP-VELLAIAIKDFHDIFMSGGVKMIMDPDHDE 780
            Q+     ++ IL+K+   +T D+L+++   L  I+A+      ++R++A    +E +     +L  QG   +S+YIIL GS     +N      GVV  L +G  FG+LA+++   R ++++ +E     L +  +DF+ I        +   +H+E
Sbjct:  324 QMGPDAHMRMILRKQPGQRTVDDLEIIYEELLHIKALSHLSTTVKRELAGVLIFESHAKAGTVLFNQGEEGTSWYIILKGS-----VNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHEE 475          

HSP 2 Score: 56.9954 bits (136), Expect = 3.485e-8
Identity = 37/131 (28.24%), Postives = 71/131 (54.20%), Query Frame = 1
Query:  346 ILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGV-VAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIF 735
             L K   +++ +++ ++   LK ++A  ++   + ++I+  G+YE+      L RQG   +S+Y +LSGS+ V V         V +  L  G +FGE +I+  T R +T++ +E  ELL I  ++F  ++
Sbjct:   24 CLDKRPAERSAEDVDIIMARLKSVKAFEKFHPTLLQQISLCGFYERLEKGITLYRQGDIGTSWYAVLSGSLDVKVSETANHQDAVTICTLGIGTAFGE-SILDNTPRHATIVTREFSELLRIEQREFRTLW 153          
BLAST of Hsc70-interacting protein vs. Ensembl Cavefish
Match: rapgef4 (Rap guanine nucleotide exchange factor 4 [Source:NCBI gene;Acc:103034068])

HSP 1 Score: 59.3066 bits (142), Expect = 7.314e-9
Identity = 41/157 (26.11%), Postives = 79/157 (50.32%), Query Frame = 1
Query:  316 QLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKY-NCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEP-VELLAIAIKDFHDIFMSGGVKMIMDPDHDE 780
            Q+     ++ IL+K+   +T D+L+++   L  I+A+      ++R++A    +E +     +L  QG   +S+YIIL GS     +N      GVV  L +G  FG+LA+++   R ++++ +E     L +  +DF+ I        +   +H+E
Sbjct:  304 QMGPDAHMRMILRKQPGQRTVDDLEIIYEELLHIKALSHLSTTVKRELAGVLIFESHAKAGTVLFNQGEEGTSWYIILKGS-----VNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHEE 455          

HSP 2 Score: 55.0694 bits (131), Expect = 1.554e-7
Identity = 35/124 (28.23%), Postives = 69/124 (55.65%), Query Frame = 1
Query:  367 DKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGV-VAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIF 735
            +++ +++ ++   LK ++A  ++   + ++I+  G+YE+      L RQG   +S+Y +LSGS+ V V         V +  L  G +FGE +I+  T R +T++ +E  ELL I  ++F  ++
Sbjct:    7 ERSAEDVDIIMARLKSVKAFEKFHPTLLQQISLCGFYERLEKGITLYRQGDIGTSWYAVLSGSLDVKVSETANHQDAVTICTLGIGTAFGE-SILDNTPRHATIVTREFSELLRIEQREFRTLW 129          
BLAST of Hsc70-interacting protein vs. Ensembl Cavefish
Match: rapgef3 (Rap guanine nucleotide exchange factor (GEF) 3 [Source:ZFIN;Acc:ZDB-GENE-090312-38])

HSP 1 Score: 55.8398 bits (133), Expect = 9.076e-8
Identity = 44/198 (22.22%), Postives = 90/198 (45.45%), Query Frame = 1
Query:  328 PEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEP-VELLAIAIKDFHDIFMSGGVKMIMDPDHDEFIKSSFLSEFPQELLANNPNKFFFQYFRDNEILSRDTNNSNWIYLV 918
            P+ + N++ ++   ++ ++++V+   L  ++AV      +++++A    +E +     +  QG + +S+YII  GS     +N      G+V  L +G  FG+LA+++   R +T+I +E     L +  +DF  I        +   +H + +     S     +++  P K         E +  DTN S  I  V
Sbjct:  167 PDALLNMILRKPSQRSSEDVEVIYEELLHVKAVGHLSTSVRKELAAVLVFESHAKAGTVFSQGDKGTSWYIIWKGS-----VNVITHGKGLVTTLHEGDDFGQLALVNDAPRAATIILREDNCHFLRVDKQDFIRILKDVEANTVRLEEHGKVVLVLEKSSGQYTVMSGTPEKILEHLL---ETIKLDTNGSEPIPCV 356          
BLAST of Hsc70-interacting protein vs. Ensembl Cavefish
Match: zgc:171558 (zgc:171558 [Source:ZFIN;Acc:ZDB-GENE-080219-4])

HSP 1 Score: 53.9138 bits (128), Expect = 2.401e-7
Identity = 40/148 (27.03%), Postives = 78/148 (52.70%), Query Frame = 1
Query:  295 SIYKADKQLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGV-VAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIF 735
            ++Y + + +   E I   L K   +++ +++ ++   LK ++A  ++   + ++I   G+YE       L RQG   +S+Y +LSGS+ V V         V +  L  G +FGE +I+  T R +T++++E  ELL I  ++F  ++
Sbjct:    3 AVYTSAQSVASSEWIV-CLDKRPGERSGEDVDIILARLKVVKAFEKFHPSLLQQICLCGFYEYLEKGITLYRQGDIGTSWYAVLSGSLDVKVSETANYQDAVTICTLGIGTAFGE-SILDNTPRHATIVSRENSELLRIEQREFKTLW 148          
BLAST of Hsc70-interacting protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005682.1 (pep scaffold:Pmarinus_7.0:GL476331:764222:769958:1 gene:ENSPMAG00000005146.1 transcript:ENSPMAT00000005682.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.7962 bits (190), Expect = 8.952e-16
Identity = 52/208 (25.00%), Postives = 97/208 (46.63%), Query Frame = 1
Query:  325 VPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKT--VGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIFMSGGVKMIMDPDHDEFIKSSFLSEFPQELLANNPNKFFFQYFRDNEILSRDTNNSNWIYLVKSGEISVV 942
            +PE+      K   +++D E+  +   L+G+ + R Y   +Q  +A    YEK+  +R++V++GH    FY + SG V V   ND  +  +      L KG  FGE+A++   +R +T++  E  ELL +  +DF    +   ++      ++ F      S +  E L    +    + F   ++++ DT+ +  I  V  G   V+
Sbjct:    1 LPEKAVRAALKPPSERSDTEVIFLRGLLRGLSSFRRYTAHLQLMLAGVVRYEKFGRRRVIVKKGHYGRRFYFVFSGLVAVTKDNDGSSAFIDPEPILLRKGAGFGEIALLKDLSRNATIVCMEETELLVVDKEDFFAYKLDQELRKEFQHRYNYFRSLELFSTWSDESLETMADHCKIEEFNHGQVVTGDTSETKNIIFVIKGCCDVL 208          
BLAST of Hsc70-interacting protein vs. Ensembl Nematostella
Match: EDO48124 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK87])

HSP 1 Score: 214.542 bits (545), Expect = 7.342e-63
Identity = 105/223 (47.09%), Postives = 152/223 (68.16%), Query Frame = 1
Query:  280 LMFDSSIYKADKQLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIFM-SGGVKMIMDPDHDEFIKS-SFLSEFPQELLANNPNKFFFQYFRDNEILSRDTNNSNWIYLVKSGEISVV 942
            L FD+S YKA+++++V  E+KNIL+   + +T+ +   V   L+ IRA  EYP R+Q K+   G+YE ++ KR ++RQG    +FY +LSGS VV V+ +  T    V +L +G SFGELAI+H T RQSTVI++EP+ELL I+ +DF DIFM +GG+K I DPDH  F++S  FL  +P ELLA NP K  F +FR   +L +D+N+++WIY++K G   V+
Sbjct:  135 LAFDASFYKANRKMRVSAEVKNILQSPQEQRTEQQCAKVLFSLRSIRAFAEYPQRIQHKLINVGWYESHSSKRAILRQGQIPQAFYFVLSGSAVVTVLGEHDTFARTVHFLRRGDSFGELAILHDTQRQSTVISREPIELLVISREDFIDIFMLAGGIKNITDPDHQIFLRSLEFLKGWPIELLATNPKKCLFHFFRSGSVLVKDSNHTDWIYIIKWGSCQVL 357          
BLAST of Hsc70-interacting protein vs. Ensembl Nematostella
Match: EDO37972 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE96])

HSP 1 Score: 129.028 bits (323), Expect = 3.407e-35
Identity = 69/175 (39.43%), Postives = 109/175 (62.29%), Query Frame = 1
Query:  280 LMFDSSIYKADKQLKVPEEIKNILKKEVKDKTDDELKVVEIYLKG-IRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVG----GVVAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIFMSGGVKMIMDPDHDEFIK 789
            + FD + YKA +++K+ ++   IL      +TD++L+   + LK  + A  EYP++MQ++  K G+YE +  KR+++RQGH A +FY ILSG+ +V ++      G      VA L KG SFGELA++H   R +TV+ +E V LLA+  +DF DIFMS   +   +PDH +F++
Sbjct:    2 MAFDPNYYKAVREIKLSQDAVQILSMSPGTRTDEQLQGALVALKASVPAFGEYPLKMQQQPVKVGWYESFEAKRVIIRQGHPAENFYFILSGTALVTLLFVDPVTGEQRSNTVAVLGKGSSFGELALLHHKTRSATVLCKEDVALLAVGREDFRDIFMS--YEDGKEPDHIQFLR 174          
BLAST of Hsc70-interacting protein vs. Ensembl Nematostella
Match: EDO49748 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFM7])

HSP 1 Score: 104.375 bits (259), Expect = 1.981e-26
Identity = 58/160 (36.25%), Postives = 98/160 (61.25%), Query Frame = 1
Query:  319 LKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGV---VAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIFMSGGVKMIMDPDHDEFIK 789
            +++ +E+K+IL    +++  ++L+ V   L+ + +  E P+ MQ  + K  +++     +I+V+QGH A +FY I+SGSV VV  ND  T G V   VA L +G SFG+LAI+    R +TV+++ P+ LL I+ +D+  IFM G  +  M+P H +F +
Sbjct:    1 IQISKEVKSILSLRPEERNTEQLQTVLYALQTMSSFAELPLHMQESVCKVAWHQSLPANKIIVKQGHLAENFYFIMSGSVTVVSEND-PTSGQVFASVATLRRGASFGDLAILKNCTRTATVVSKVPIHLLVISREDYQRIFM-GRSQDGMEPSHIKFCR 158          
BLAST of Hsc70-interacting protein vs. Ensembl Nematostella
Match: EDO32932 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STN2])

HSP 1 Score: 93.9745 bits (232), Expect = 1.003e-22
Identity = 49/138 (35.51%), Postives = 89/138 (64.49%), Query Frame = 1
Query:  334 EIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVG----GVVAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIF 735
            E+KN+LKK   +++ +E+ +V   +K ++  + YP+ ++R++AK  YY+ Y   R++++QGH   SFY I+SGSVVV  + + +T G     +++ +  G SFGELA++H   R +T+I +E  E L +   DF++++
Sbjct:    1 EVKNVLKKLSYNRSVEEVDMVLQIVKRMKGFQRYPMYVKRELAKVLYYDVYEQDRVIIKQGHIGVSFYFIVSGSVVVQRVEEDRTTGEKHNQIISEMTGGDSFGELALMHDIRRTATIICKERSEFLRVDKDDFNEVY 138          
BLAST of Hsc70-interacting protein vs. Ensembl Nematostella
Match: EDO32940 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STN1])

HSP 1 Score: 80.8777 bits (198), Expect = 4.684e-18
Identity = 48/139 (34.53%), Postives = 83/139 (59.71%), Query Frame = 1
Query:  331 EEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRA-SSFYIILSGSXXXXXMNDTKTVGG----VVAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDI 732
            ++ KN+ KK    +T +++KV+   +  ++A ++Y +  +R +AK  YYE++   R++V+QGH+  SS Y ILSG+V+V V  + KT G     +V  +  G SFGELA++H   R +T+I +   E L +    F ++
Sbjct:    3 DKAKNLFKKPPWLRTSEDIKVIGGVVDKLKAFKKYSVLERRGLAKVVYYEQFEDGRVVVQQGHKGISSLYFILSGAVLVQVAEEDKTTGKITEHIVGEMFAGDSFGELALLHDIKRTATIICKGRAEFLRLDKPGFDEV 141          
BLAST of Hsc70-interacting protein vs. Ensembl Medaka
Match: rapgef4 (Rap guanine nucleotide exchange factor (GEF) 4 [Source:ZFIN;Acc:ZDB-GENE-070912-385])

HSP 1 Score: 62.3882 bits (150), Expect = 5.173e-10
Identity = 40/132 (30.30%), Postives = 74/132 (56.06%), Query Frame = 1
Query:  343 NILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGV-VAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIF 735
            N L K  ++++ +++ ++   LK ++A + +   + ++I   G+YE      +L RQG   +S+Y +LSGS+ V V   +    GV +  L  G +FGE +I+  T R +T++ +E  ELL I  K+F  ++
Sbjct:   18 NSLDKRPEERSSEDVDIILARLKKVKAFKGFNPSLLQQICLCGFYEGLEKGIMLYRQGDIGTSWYTVLSGSLDVKVSETSSYQDGVTICTLGTGTAFGE-SILDNTPRHATIVTREFSELLRIEQKEFRSLW 148          
BLAST of Hsc70-interacting protein vs. Ensembl Medaka
Match: zgc:171558 (rap guanine nucleotide exchange factor 4 [Source:NCBI gene;Acc:101167824])

HSP 1 Score: 58.5362 bits (140), Expect = 1.137e-8
Identity = 43/184 (23.37%), Postives = 87/184 (47.28%), Query Frame = 1
Query:  337 IKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKY-NCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEP-VELLAIAIKDFHDIFMSGGVKMIMDPDHDEFI-------KSSFLSEFPQELLANNPNKFFFQYF 861
            ++ IL+K    +T D+L+++   L  I+A+      ++R++A    +E +     +L  QG   +S+YIIL GS     +N      GVV  L +G  FG+LA++  + R ++++ +E     L +  +DF+ I        +   +H++ +       ++S L      +++  P K    + 
Sbjct:  311 LRMILRKSPGQRTGDDLEIIYDELLHIKALAHLSNTVKRELASVVIFESHAKAGTVLFNQGEEGTSWYIILKGS-----VNVVIYGKGVVCTLHEGDDFGKLALVTDSPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHEQSVLVLEKSPRASTLGGIKYTVISGTPEKILEHFL 489          

HSP 2 Score: 56.225 bits (134), Expect = 5.671e-8
Identity = 36/131 (27.48%), Postives = 69/131 (52.67%), Query Frame = 1
Query:  346 ILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGV-VAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIF 735
             L K   +++ +++ ++   L+ ++A + +P  +  +I    +YE       L RQG   +S+Y +LSGS+ V V         V +  L  G +FGE +I+  T R +T++++E  ELL I  ++F  ++
Sbjct:   20 CLDKRPSERSGEDVDIILTRLREVKAFQRFPPPLLLQICACAFYECLEKGITLFRQGDIGTSWYAVLSGSLDVKVSETANHQDAVTICTLGIGTAFGE-SILDNTPRHATIVSRETSELLRIEQREFKTLW 149          
BLAST of Hsc70-interacting protein vs. Ensembl Medaka
Match: zgc:171558 (rap guanine nucleotide exchange factor 4 [Source:NCBI gene;Acc:101167824])

HSP 1 Score: 58.5362 bits (140), Expect = 1.176e-8
Identity = 43/184 (23.37%), Postives = 87/184 (47.28%), Query Frame = 1
Query:  337 IKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKY-NCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEP-VELLAIAIKDFHDIFMSGGVKMIMDPDHDEFI-------KSSFLSEFPQELLANNPNKFFFQYF 861
            ++ IL+K    +T D+L+++   L  I+A+      ++R++A    +E +     +L  QG   +S+YIIL GS     +N      GVV  L +G  FG+LA++  + R ++++ +E     L +  +DF+ I        +   +H++ +       ++S L      +++  P K    + 
Sbjct:  329 LRMILRKSPGQRTGDDLEIIYDELLHIKALAHLSNTVKRELASVVIFESHAKAGTVLFNQGEEGTSWYIILKGS-----VNVVIYGKGVVCTLHEGDDFGKLALVTDSPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHEQSVLVLEKSPRASTLGGIKYTVISGTPEKILEHFL 507          

HSP 2 Score: 56.6102 bits (135), Expect = 4.838e-8
Identity = 36/131 (27.48%), Postives = 69/131 (52.67%), Query Frame = 1
Query:  346 ILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGV-VAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIF 735
             L K   +++ +++ ++   L+ ++A + +P  +  +I    +YE       L RQG   +S+Y +LSGS+ V V         V +  L  G +FGE +I+  T R +T++++E  ELL I  ++F  ++
Sbjct:   25 CLDKRPSERSGEDVDIILTRLREVKAFQRFPPPLLLQICACAFYECLEKGITLFRQGDIGTSWYAVLSGSLDVKVSETANHQDAVTICTLGIGTAFGE-SILDNTPRHATIVSRETSELLRIEQREFKTLW 154          
BLAST of Hsc70-interacting protein vs. Ensembl Medaka
Match: ENSORLT00000001298.2 (cGMP-dependent protein kinase 2 [Source:NCBI gene;Acc:101165996])

HSP 1 Score: 54.299 bits (129), Expect = 2.561e-7
Identity = 44/204 (21.57%), Postives = 88/204 (43.14%), Query Frame = 1
Query:  451 RKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIFMSGGVKMIMDPDHDE---FIKS-SFLSEFPQELLANNPNKFFFQYFRDNEILSRDTNNSNWIYLVKSGEISVVFPKPKKTGEKTENKINSFELSDGNKTREINSSNARS 1050
            R++    Y + Y+  ++++++G   +  Y++  G      + +    G ++  +  G +FGELAI++   R +TV A     +  +  + F  I M           H E   F++S S L + P+E L    +    +YF   E + R+    N  +++  G+++V        G     +I +  + D    R + S + RS
Sbjct:  186 REMVDCMYEKVYSEGQLVIQEGDAGNYLYVLAEG------LLEVIQNGKLLGEMHPGTAFGELAILYNCKRTATVKAVLQSHIWTLERQTFQTIMMQ-----TTQARHQEYFTFLRSVSLLKQLPEEKLGRIVDCLEVEYFEKGEYIIREGEEGNTFFIIAKGQVTVT---QSSEGFTQPQEIKTLGVGDYFGERALISEDVRS 375          
BLAST of Hsc70-interacting protein vs. Ensembl Medaka
Match: ENSORLT00000001302.2 (cGMP-dependent protein kinase 2 [Source:NCBI gene;Acc:101165996])

HSP 1 Score: 54.299 bits (129), Expect = 2.659e-7
Identity = 44/204 (21.57%), Postives = 88/204 (43.14%), Query Frame = 1
Query:  451 RKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIKDFHDIFMSGGVKMIMDPDHDE---FIKS-SFLSEFPQELLANNPNKFFFQYFRDNEILSRDTNNSNWIYLVKSGEISVVFPKPKKTGEKTENKINSFELSDGNKTREINSSNARS 1050
            R++    Y + Y+  ++++++G   +  Y++  G      + +    G ++  +  G +FGELAI++   R +TV A     +  +  + F  I M           H E   F++S S L + P+E L    +    +YF   E + R+    N  +++  G+++V        G     +I +  + D    R + S + RS
Sbjct:  186 REMVDCMYEKVYSEGQLVIQEGDAGNYLYVLAEG------LLEVIQNGKLLGEMHPGTAFGELAILYNCKRTATVKAVLQSHIWTLERQTFQTIMMQ-----TTQARHQEYFTFLRSVSLLKQLPEEKLGRIVDCLEVEYFEKGEYIIREGEEGNTFFIIAKGQVTVT---QSSEGFTQPQEIKTLGVGDYFGERALISEDVRS 375          
BLAST of Hsc70-interacting protein vs. Planmine SMEST
Match: SMESG000005563.1 (SMESG000005563.1)

HSP 1 Score: 227.254 bits (578), Expect = 1.251e-72
Identity = 125/145 (86.21%), Postives = 129/145 (88.97%), Query Frame = 1
Query:  283 MFDSSIYKADKQLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIK 717
            MFDSSIYKADKQLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKY+    L  +G+       I+   VVVVVMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIK
Sbjct:    1 MFDSSIYKADKQLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYS----LCLRGY-------IICILVVVVVMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIK 134          
BLAST of Hsc70-interacting protein vs. Planmine SMEST
Match: SMESG000005563.1 (SMESG000005563.1)

HSP 1 Score: 222.631 bits (566), Expect = 6.861e-71
Identity = 124/145 (85.52%), Postives = 128/145 (88.28%), Query Frame = 1
Query:  283 MFDSSIYKADKQLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIK 717
            MFDSSIYKADKQLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEK   +  L  +G+       I+   VVVVVMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIK
Sbjct:    1 MFDSSIYKADKQLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEK--IRYSLCLRGY-------IICILVVVVVMNDTKTVGGVVAYLEKGQSFGELAIIHKTNRQSTVIAQEPVELLAIAIK 136          
BLAST of Hsc70-interacting protein vs. Planmine SMEST
Match: SMESG000040416.1 (SMESG000040416.1)

HSP 1 Score: 220.705 bits (561), Expect = 3.023e-70
Identity = 105/108 (97.22%), Postives = 106/108 (98.15%), Query Frame = 1
Query:  859 FRDNEILSRDTNNSNWIYLVKSGEISVVFPKPKKTGEKTENKINSFELSDGNKTREINSSNARSFQKHHIRTIAEDFDLAYDNSENNLEIYADCKWIQIQRIRENNVF 1182
            F DNEILSRDTNNSNWIYLVKSGEISVVFPKP+KTGEKTENKINSFELSDGNKTREINSSNAR FQKHHIRTIAEDFDLAYDNSENNLEIYADCKWIQIQRIRENNVF
Sbjct:   20 FEDNEILSRDTNNSNWIYLVKSGEISVVFPKPRKTGEKTENKINSFELSDGNKTREINSSNARPFQKHHIRTIAEDFDLAYDNSENNLEIYADCKWIQIQRIRENNVF 127          
BLAST of Hsc70-interacting protein vs. Planmine SMEST
Match: SMESG000040416.1 (SMESG000040416.1)

HSP 1 Score: 219.164 bits (557), Expect = 1.115e-69
Identity = 104/108 (96.30%), Postives = 106/108 (98.15%), Query Frame = 1
Query:  859 FRDNEILSRDTNNSNWIYLVKSGEISVVFPKPKKTGEKTENKINSFELSDGNKTREINSSNARSFQKHHIRTIAEDFDLAYDNSENNLEIYADCKWIQIQRIRENNVF 1182
             +DNEILSRDTNNSNWIYLVKSGEISVVFPKP+KTGEKTENKINSFELSDGNKTREINSSNAR FQKHHIRTIAEDFDLAYDNSENNLEIYADCKWIQIQRIRENNVF
Sbjct:   16 MKDNEILSRDTNNSNWIYLVKSGEISVVFPKPRKTGEKTENKINSFELSDGNKTREINSSNARPFQKHHIRTIAEDFDLAYDNSENNLEIYADCKWIQIQRIRENNVF 123          
BLAST of Hsc70-interacting protein vs. Planmine SMEST
Match: SMESG000040416.1 (SMESG000040416.1)

HSP 1 Score: 217.624 bits (553), Expect = 2.552e-68
Identity = 104/106 (98.11%), Postives = 105/106 (99.06%), Query Frame = 1
Query:  865 DNEILSRDTNNSNWIYLVKSGEISVVFPKPKKTGEKTENKINSFELSDGNKTREINSSNARSFQKHHIRTIAEDFDLAYDNSENNLEIYADCKWIQIQRIRENNVF 1182
            DNEILSRDTNNSNWIYLVKSGEISVVFPKP+KTGEKTENKINSFELSDGNKTREINSSNAR FQKHHIRTIAEDFDLAYDNSENNLEIYADCKWIQIQRIRENNVF
Sbjct:   50 DNEILSRDTNNSNWIYLVKSGEISVVFPKPRKTGEKTENKINSFELSDGNKTREINSSNARPFQKHHIRTIAEDFDLAYDNSENNLEIYADCKWIQIQRIRENNVF 155          
The following BLAST results are available for this feature:
BLAST of Hsc70-interacting protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CNBD29.261e-1424.89cyclic nucleotide binding domain containing 2 [Sou... [more]
CNBD21.255e-1324.89cyclic nucleotide binding domain containing 2 [Sou... [more]
CNBD21.344e-1324.89cyclic nucleotide binding domain containing 2 [Sou... [more]
RAPGEF43.074e-826.11Rap guanine nucleotide exchange factor 4 [Source:H... [more]
RAPGEF43.628e-826.11Rap guanine nucleotide exchange factor 4 [Source:H... [more]
back to top
BLAST of Hsc70-interacting protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pkg-21.182e-630.00Protein Kinase, cGMP-dependent [Source:UniProtKB/... [more]
pkg-21.612e-634.40Protein Kinase, cGMP-dependent [Source:UniProtKB/... [more]
back to top
BLAST of Hsc70-interacting protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG48398.053e-623.67gene:FBgn0032187 transcript:FBtr0079943[more]
CG48398.053e-623.67gene:FBgn0032187 transcript:FBtr0079944[more]
back to top
BLAST of Hsc70-interacting protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rapgef43.926e-924.47Rap guanine nucleotide exchange factor (GEF) 4 [So... [more]
rapgef44.094e-924.47Rap guanine nucleotide exchange factor (GEF) 4 [So... [more]
zgc:1715587.249e-927.53zgc:171558 [Source:ZFIN;Acc:ZDB-GENE-080219-4][more]
zgc:1715589.211e-927.53zgc:171558 [Source:ZFIN;Acc:ZDB-GENE-080219-4][more]
rapgef33.905e-728.70Rap guanine nucleotide exchange factor (GEF) 3 [So... [more]
back to top
BLAST of Hsc70-interacting protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bmp48.617e-1627.23bone morphogenetic protein 4 [Source:Xenbase;Acc:X... [more]
RAPGEF41.613e-825.48Rap guanine nucleotide exchange factor 4 [Source:N... [more]
RAPGEF41.659e-825.48Rap guanine nucleotide exchange factor 4 [Source:N... [more]
RAPGEF43.323e-830.53Rap guanine nucleotide exchange factor 4 [Source:N... [more]
RAPGEF47.044e-830.65Rap guanine nucleotide exchange factor 4 [Source:N... [more]
back to top
BLAST of Hsc70-interacting protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cnbd21.512e-923.29cyclic nucleotide binding domain containing 2 [Sou... [more]
Rapgef42.671e-929.77Rap guanine nucleotide exchange factor (GEF) 4 [So... [more]
Rapgef42.828e-929.77Rap guanine nucleotide exchange factor (GEF) 4 [So... [more]
Cnbd23.324e-923.19cyclic nucleotide binding domain containing 2 [Sou... [more]
Cnbd25.972e-922.97cyclic nucleotide binding domain containing 2 [Sou... [more]
back to top
BLAST of Hsc70-interacting protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q95JR6|CNBD2_MACFA3.416e-1325.44Cyclic nucleotide-binding domain-containing protei... [more]
sp|Q96M20|CNBD2_HUMAN6.454e-1324.89Cyclic nucleotide-binding domain-containing protei... [more]
sp|Q9EQZ6|RPGF4_MOUSE1.978e-829.77Rap guanine nucleotide exchange factor 4 OS=Mus mu... [more]
sp|Q9D5U8|CNBD2_MOUSE2.325e-823.19Cyclic nucleotide-binding domain-containing protei... [more]
sp|Q8WZA2|RPGF4_HUMAN1.742e-726.11Rap guanine nucleotide exchange factor 4 OS=Homo s... [more]
back to top
BLAST of Hsc70-interacting protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3M6UMV38.455e-6046.93Cyclic nucleotide-binding domain-containing protei... [more]
A0A3S1A9N73.427e-5946.86Cyclic nucleotide-binding domain-containing protei... [more]
A0A210QUY84.361e-5945.23Cyclic nucleotide-binding domain-containing protei... [more]
A7RK875.309e-5947.09Predicted protein OS=Nematostella vectensis OX=453... [more]
A0A2B4RRT61.493e-5846.49Cyclic nucleotide-binding domain-containing protei... [more]
back to top
BLAST of Hsc70-interacting protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000002114.23.333e-924.40cGMP-dependent protein kinase 2-like [Source:NCBI ... [more]
rapgef46.152e-926.11Rap guanine nucleotide exchange factor 4 [Source:N... [more]
rapgef47.314e-926.11Rap guanine nucleotide exchange factor 4 [Source:N... [more]
rapgef39.076e-822.22Rap guanine nucleotide exchange factor (GEF) 3 [So... [more]
zgc:1715582.401e-727.03zgc:171558 [Source:ZFIN;Acc:ZDB-GENE-080219-4][more]
back to top
BLAST of Hsc70-interacting protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005682.18.952e-1625.00pep scaffold:Pmarinus_7.0:GL476331:764222:769958:1... [more]
back to top
BLAST of Hsc70-interacting protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hsc70-interacting protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO481247.342e-6347.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379723.407e-3539.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497481.981e-2636.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329321.003e-2235.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329404.684e-1834.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Hsc70-interacting protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rapgef45.173e-1030.30Rap guanine nucleotide exchange factor (GEF) 4 [So... [more]
zgc:1715581.137e-823.37rap guanine nucleotide exchange factor 4 [Source:N... [more]
zgc:1715581.176e-823.37rap guanine nucleotide exchange factor 4 [Source:N... [more]
ENSORLT00000001298.22.561e-721.57cGMP-dependent protein kinase 2 [Source:NCBI gene;... [more]
ENSORLT00000001302.22.659e-721.57cGMP-dependent protein kinase 2 [Source:NCBI gene;... [more]
back to top
BLAST of Hsc70-interacting protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005563.11.251e-7286.21SMESG000005563.1[more]
SMESG000005563.16.861e-7185.52SMESG000005563.1[more]
SMESG000040416.13.023e-7097.22SMESG000040416.1[more]
SMESG000040416.11.115e-6996.30SMESG000040416.1[more]
SMESG000040416.12.552e-6898.11SMESG000040416.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032342 ID=SMED30032342|Name=Hsc70-interacting protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1520bp
CAATCAGAACGAGTGATAAACAAATATAATTGTTTACCTTTGTTAAAGCC
AGAATTGAAATTGACATTTATCCGGAGAAACAAAACCATTATAACTACGA
TCTCTAAAAAATGTTGCTCACAATTCATCTGAAGAATCGTTTAGAAAAAG
CCGATCTAGTTCAAAAGTTCGACCAAAACTTCATTTTAAAAGCTTAGTCA
AGCTTATCCTCGAATGCCAACGTTTGAATTCAGAATATTCATTGAGAATT
TGACATTTCACTTTGAAATTAGTTCTCCTTTGATGTTTGACTCCAGCATT
TACAAGGCAGATAAACAACTCAAAGTTCCTGAAGAAATTAAAAATATATT
GAAAAAAGAAGTGAAAGACAAAACTGATGACGAATTAAAAGTAGTTGAAA
TTTATCTGAAGGGTATCCGTGCAGTGAGAGAATATCCAATACGAATGCAG
AGGAAAATTGCAAAATATGGATATTATGAAAAATATAACTGTAAGAGGAT
TTTGGTGAGACAGGGCCATCGAGCATCGTCTTTTTATATCATTTTATCAG
GATCAGTTGTTGTCGTCGTTATGAATGACACAAAAACTGTCGGTGGAGTT
GTTGCATATCTAGAAAAAGGGCAATCTTTTGGAGAGCTCGCGATAATTCA
TAAGACCAATCGTCAATCTACAGTTATTGCCCAAGAGCCCGTGGAGTTGT
TGGCGATCGCTATCAAAGATTTTCACGATATATTCATGTCGGGAGGGGTG
AAAATGATTATGGATCCAGATCACGATGAATTCATTAAATCAAGTTTTCT
CAGTGAATTTCCACAAGAATTACTTGCCAACAATCCAAATAAATTCTTCT
TTCAATATTTCAGGGACAATGAAATCCTCTCAAGGGACACGAATAATTCT
AACTGGATTTATTTGGTGAAATCGGGTGAAATCTCAGTTGTTTTCCCGAA
ACCAAAGAAGACAGGGGAAAAAACGGAAAACAAAATAAATTCATTTGAAC
TCAGTGATGGAAACAAGACCCGGGAAATAAACTCGTCAAATGCAAGGTCA
TTTCAAAAGCACCACATCAGAACGATTGCTGAAGATTTTGATTTAGCGTA
TGATAATTCTGAAAATAATCTGGAAATTTATGCCGATTGCAAATGGATAC
AAATTCAACGAATTCGTGAAAATAATGTTTTCGGACTTGCTCAATGTTTC
TTCTCAAATCAACCGAAATTCATTTTGCTCAGTAAAGCTGTTGAAGTATT
CATGCTTGATAAAAACTTTTTCCTTTCCAACTCTTCAAGTCATTATCGGA
CATCACTAAAAAGCATGTTGATCAGCTATCCTTCTGTTGAAGAACTGGAG
GAAATTATTCGAGATCAAGAACACTGGAAACTTTATAAAGAAACGACATT
ATTGAACGCATTAAATAGATTTAAAGCATGACATAAAATTTAGGATTTAA
ATATATGCAAATTATACCAATTTATTATTATTTTAATAAAACAAACTTTC
GTTTTAATTATGAATATCAA
back to top

protein sequence of SMED30032342-orf-1

>SMED30032342-orf-1 ID=SMED30032342-orf-1|Name=SMED30032342-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=406bp
MPTFEFRIFIENLTFHFEISSPLMFDSSIYKADKQLKVPEEIKNILKKEV
KDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQ
GHRASSFYIILSGSVVVVVMNDTKTVGGVVAYLEKGQSFGELAIIHKTNR
QSTVIAQEPVELLAIAIKDFHDIFMSGGVKMIMDPDHDEFIKSSFLSEFP
QELLANNPNKFFFQYFRDNEILSRDTNNSNWIYLVKSGEISVVFPKPKKT
GEKTENKINSFELSDGNKTREINSSNARSFQKHHIRTIAEDFDLAYDNSE
NNLEIYADCKWIQIQRIRENNVFGLAQCFFSNQPKFILLSKAVEVFMLDK
NFFLSNSSSHYRTSLKSMLISYPSVEELEEIIRDQEHWKLYKETTLLNAL
NRFKA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0000166nucleotide binding
GO:0005085guanyl-nucleotide exchange factor activity
GO:0005088Ras guanyl-nucleotide exchange factor activity
GO:0005515protein binding
GO:0017016Ras GTPase binding
GO:0030552cAMP binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000595cNMP-bd_dom
IPR014710RmlC-like_jellyroll
IPR018490cNMP-bd-like
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
GO:0043547positive regulation of GTPase activity
GO:0006887exocytosis
GO:0007264small GTPase mediated signal transduction
GO:0017156calcium ion regulated exocytosis
GO:0017157regulation of exocytosis
GO:0019933cAMP-mediated signaling
GO:0030073insulin secretion
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
GO:0016020membrane