Calbindin-32

Overview
NameCalbindin-32
Smed IDSMED30032335
Length (bp)1067
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calbindin-32 (SMED30032335) t-SNE clustered cells

Violin plots show distribution of expression levels for Calbindin-32 (SMED30032335) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calbindin-32 (SMED30032335) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calbindin-32 (SMED30032335) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032335

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30032335SMESG000003798.1 dd_Smed_v4_9520_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30032335SMESG000003798.1 dd_Smed_v4_9520_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30032335SMESG000003798.1 dd_Smed_v4_9520_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30032335SMESG000003798.1 dd_Smed_v6_9520_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calbindin-32 vs. Ensembl Human
Match: CALB2 (calbindin 2 [Source:HGNC Symbol;Acc:HGNC:1435])

HSP 1 Score: 206.068 bits (523), Expect = 4.292e-64
Identity = 113/275 (41.09%), Postives = 178/275 (64.73%), Query Frame = 2
Query:  146 QLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSA-FQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQHSKL 967
             L + TA+QFL++W HFD D NGYIE  EL+NF  +   +      G  ++S+S  F    + F++ YD+N DG+IE+ EL+QILPT+E FL+ F++   + SS EFM+ W+++D DRSG+IEANEL+ F+++LLK   K+    +E K+  +T  +L++FD N DGKL LSEM+RLLP++EN+L K       K++  E   IF  YD DR+G++DE E+ ALL DL E  ++  + ++L  ++  ++S   + + GK+  K+L+++L     +
Sbjct:   12 HLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARK----GSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQH--VGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLLK---KANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLK---FQGMKLTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQLTNYRKSVMS---LAEAGKLYRKDLEIVLCSEPPM 271          
BLAST of Calbindin-32 vs. Ensembl Human
Match: CALB2 (calbindin 2 [Source:HGNC Symbol;Acc:HGNC:1435])

HSP 1 Score: 206.068 bits (523), Expect = 4.292e-64
Identity = 113/275 (41.09%), Postives = 178/275 (64.73%), Query Frame = 2
Query:  146 QLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSA-FQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQHSKL 967
             L + TA+QFL++W HFD D NGYIE  EL+NF  +   +      G  ++S+S  F    + F++ YD+N DG+IE+ EL+QILPT+E FL+ F++   + SS EFM+ W+++D DRSG+IEANEL+ F+++LLK   K+    +E K+  +T  +L++FD N DGKL LSEM+RLLP++EN+L K       K++  E   IF  YD DR+G++DE E+ ALL DL E  ++  + ++L  ++  ++S   + + GK+  K+L+++L     +
Sbjct:   12 HLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARK----GSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQH--VGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLLK---KANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLK---FQGMKLTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQLTNYRKSVMS---LAEAGKLYRKDLEIVLCSEPPM 271          
BLAST of Calbindin-32 vs. Ensembl Human
Match: SCGN (secretagogin, EF-hand calcium binding protein [Source:HGNC Symbol;Acc:HGNC:16941])

HSP 1 Score: 197.208 bits (500), Expect = 1.861e-60
Identity = 104/269 (38.66%), Postives = 165/269 (61.34%), Query Frame = 2
Query:  149 LNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQI-LPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAK-PMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMIL 949
            L +  A  F  VW  FD D  GYIE  ELD F +     + ++    + + ++    +KQ F+   D ++DGRI + EL+ + L  DE FL+LF+RENP+ SSVEFM+IW+++D D SGFI A EL+ F+ +L  +++K+   + E+K+  +T  M+K+FDRN DG+L L+++AR+L ++EN+L +  M   + +    + E+IF  YDV + G ++  E+   + D+MEL +       L+KF+ ++L   DVNKDGKI   EL + L
Sbjct:    9 LGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTD----DTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKA---ISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCL 270          

HSP 2 Score: 94.7449 bits (234), Expect = 1.138e-21
Identity = 65/220 (29.55%), Postives = 119/220 (54.09%), Query Frame = 2
Query:   38 KSGRINLHSGLELELEDSQKFTDNYLTKYRNRENDNQLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPIS--SSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKEN 691
            K GRI +     + L + +    N+L  +R    +N L+  ++ +F+ +W  +D D++G+I AAEL NFL             ++ +S++  +    T ++ +D N+DGR+++ +L++IL   E FL+ F+ +   +     +F KI+  +D  ++G +E  E+  FV ++++  Q S   V+  K   F  I+L+  D N DGK+Q SE+A  L +K N
Sbjct:   74 KDGRIRMKELAGMFLSEDE----NFLLLFRR---ENPLD--SSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLH------HKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDK---FREILLRHCDVNKDGKIQKSELALCLGLKIN 275          
BLAST of Calbindin-32 vs. Ensembl Human
Match: CALB1 (calbindin 1 [Source:HGNC Symbol;Acc:HGNC:1434])

HSP 1 Score: 186.808 bits (473), Expect = 1.220e-56
Identity = 104/265 (39.25%), Postives = 166/265 (62.64%), Query Frame = 2
Query:  158 FTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILT 952
             TA+QF ++W HFD D +GY+E  EL N + +   +   +  G E+  +       +TF++ Y + +DG+I I EL+ +LPT+E FL+LF R   + S  EFMK W+++D D SGFIE  EL+ F+ +LL   +K+ + V+++K+  +T++MLKLFD N+DGKL+L+EMARLLP++EN+L K       K+   E  + F+ YD D NG++DE E+ ALL DL E  ++  D   +  ++  I++   ++  GK+   +L +IL 
Sbjct:   11 ITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQA--RKKAGLELSPEM------KTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLF-RCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLL---EKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKF---QGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMA---LSDGGKLYRTDLALILC 257          
BLAST of Calbindin-32 vs. Ensembl Human
Match: CALB2 (calbindin 2 [Source:HGNC Symbol;Acc:HGNC:1435])

HSP 1 Score: 177.563 bits (449), Expect = 2.169e-53
Identity = 95/213 (44.60%), Postives = 140/213 (65.73%), Query Frame = 2
Query:  146 QLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQS-AFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRN 781
             L + TA+QFL++W HFD D NGYIE  EL+NF  +   +      G  ++S+S  F    + F++ YD+N DG+IE+ EL+QILPT+E FL+ F++   + SS EFM+ W+++D DRSG+IEANEL+ F+++LLK   K+    +E K+  +T  +L++FD N DGKL LSEM+RLLP++EN+L K       K++  E   IF  YD + N
Sbjct:   12 HLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARK----GSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQH--VGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLLK---KANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLK---FQGMKLTSEEFNAIFTFYDKEMN 212          

HSP 2 Score: 112.079 bits (279), Expect = 1.727e-28
Identity = 55/167 (32.93%), Postives = 100/167 (59.88%), Query Frame = 2
Query:  449 SSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMIL 949
            ++ +F++IWK FD D +G+IE  EL+ F  EL K  + S    +           ++ +D+NSDGK++++E+A++LP +EN+L   +    +  S  E    ++ YD DR+G+++  E++  L DL++    PYD+ KL+++   IL  +D+N DGK+ + E+  +L
Sbjct:   17 TASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFL---LCFRQHVGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLL 180          
BLAST of Calbindin-32 vs. Ensembl Fly
Match: Cbp53E (gene:FBgn0004580 transcript:FBtr0340072)

HSP 1 Score: 263.462 bits (672), Expect = 3.711e-86
Identity = 130/289 (44.98%), Postives = 200/289 (69.20%), Query Frame = 2
Query:  107 NYLTKYRNRENDNQLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELT-EEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQHSKLG 970
            N++ +YR+ E+  +L K +A QF+DVW H+D D NGYIE  ELD FL +F +S  +  I  E ++ +  + +K  F+EAYD+N+DG+I+I EL+Q+LP +E FL+LF+ +NP+ SSVEFMKIW+ +D D SG+IEA+EL+ F+ +LLK  +K  + V E K++ +T+ ML++FD N DG+LQLSEMA+LLP+KEN+L + +     K++  ++E++F  YD D +G ++  E++  L DL+EL  ++ YD + L  F+  I+     +K GKIS KEL MIL   +K+ 
Sbjct:   19 NFMRQYRDPES-RELKKLSANQFMDVWAHYDKDGNGYIEGTELDGFLREFVSSANATDISPEAVTDTMLEELKSCFMEAYDDNQDGKIDIRELAQLLPMEENFLLLFRFDNPLESSVEFMKIWREYDTDNSGYIEADELKNFLRDLLKEAKKIND-VSEDKLIEYTDTMLQVFDANKDGRLQLSEMAKLLPVKENFLCRQVFKGATKLTKEDIEKVFSLYDRDNSGTIENEELKGFLKDLLELVKKDDYDAQDLAAFEETIMRGVGTDKHGKISRKELTMILLTLAKIS 305          
BLAST of Calbindin-32 vs. Ensembl Fly
Match: Cbp53E (gene:FBgn0004580 transcript:FBtr0087056)

HSP 1 Score: 263.462 bits (672), Expect = 3.711e-86
Identity = 130/289 (44.98%), Postives = 200/289 (69.20%), Query Frame = 2
Query:  107 NYLTKYRNRENDNQLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELT-EEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQHSKLG 970
            N++ +YR+ E+  +L K +A QF+DVW H+D D NGYIE  ELD FL +F +S  +  I  E ++ +  + +K  F+EAYD+N+DG+I+I EL+Q+LP +E FL+LF+ +NP+ SSVEFMKIW+ +D D SG+IEA+EL+ F+ +LLK  +K  + V E K++ +T+ ML++FD N DG+LQLSEMA+LLP+KEN+L + +     K++  ++E++F  YD D +G ++  E++  L DL+EL  ++ YD + L  F+  I+     +K GKIS KEL MIL   +K+ 
Sbjct:   19 NFMRQYRDPES-RELKKLSANQFMDVWAHYDKDGNGYIEGTELDGFLREFVSSANATDISPEAVTDTMLEELKSCFMEAYDDNQDGKIDIRELAQLLPMEENFLLLFRFDNPLESSVEFMKIWREYDTDNSGYIEADELKNFLRDLLKEAKKIND-VSEDKLIEYTDTMLQVFDANKDGRLQLSEMAKLLPVKENFLCRQVFKGATKLTKEDIEKVFSLYDRDNSGTIENEELKGFLKDLLELVKKDDYDAQDLAAFEETIMRGVGTDKHGKISRKELTMILLTLAKIS 305          
BLAST of Calbindin-32 vs. Ensembl Fly
Match: Nca (gene:FBgn0013303 transcript:FBtr0074902)

HSP 1 Score: 50.0618 bits (118), Expect = 5.810e-7
Identity = 41/155 (26.45%), Postives = 68/155 (43.87%), Query Frame = 2
Query:  518 ELQEFVTELLKNNQKSAEKVEESKIVY-----------FTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEE----PYDDKKLEKFQNVILSEWDVNKDGKISMKEL 937
            E+QE+    LK+       VEE K +Y           F   + + FD N DG +   E          +L    + +  K+   +L+  F  YD+D NG++   EM  ++  + ++       P D+   EK  + I  + D NKDGK+S++E 
Sbjct:   26 EIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFRE----------FLCALSVTSRGKLE-QKLKWAFSMYDLDGNGYISRQEMLEIVTAIYKMVGSVMKMPEDESTPEKRTDKIFRQMDRNKDGKLSLEEF 169          
BLAST of Calbindin-32 vs. Ensembl Fly
Match: Nox (gene:FBgn0085428 transcript:FBtr0344889)

HSP 1 Score: 50.0618 bits (118), Expect = 2.746e-6
Identity = 39/197 (19.80%), Postives = 82/197 (41.62%), Query Frame = 2
Query:  467 KIWKRFDKDRSGFIEANELQEFVTELLKNNQKSA----------------------------EKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQHSKLGE 973
            K+++  + D S  +  N++ EF++ L  +  ++                             +K+  SK  +FT  + ++FD+++ G + L E    +       A        KI FL     FK YD+D +G +   E+  ++   ++     + + ++E   + +  + D +  G+I+ + LK  L +H  L E
Sbjct:  291 KLYRLIELDGSNLVSTNQVMEFISHLTNSRPRTGFDKSSLARLEQLFRTTVGNEQEIRREEFQKIVTSKNPFFTERVFQIFDKDNSGSISLQEFIDAIHQFSGQSADD------KIRFL-----FKVYDIDGDGLIQHKELHDVIRHCIKENGMEFSEDQIEDLTSAMFEDADPHNSGEITYEALKNQLHKHGGLLE 476          
BLAST of Calbindin-32 vs. Ensembl Fly
Match: Nox (gene:FBgn0085428 transcript:FBtr0345379)

HSP 1 Score: 50.0618 bits (118), Expect = 2.765e-6
Identity = 39/197 (19.80%), Postives = 82/197 (41.62%), Query Frame = 2
Query:  467 KIWKRFDKDRSGFIEANELQEFVTELLKNNQKSA----------------------------EKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQHSKLGE 973
            K+++  + D S  +  N++ EF++ L  +  ++                             +K+  SK  +FT  + ++FD+++ G + L E    +       A        KI FL     FK YD+D +G +   E+  ++   ++     + + ++E   + +  + D +  G+I+ + LK  L +H  L E
Sbjct:  291 KLYRLIELDGSNLVSTNQVMEFISHLTNSRPRTGFDKSSLARLEQLFRTTVGNEQEIRREEFQKIVTSKNPFFTERVFQIFDKDNSGSISLQEFIDAIHQFSGQSADD------KIRFL-----FKVYDIDGDGLIQHKELHDVIRHCIKENGMEFSEDQIEDLTSAMFEDADPHNSGEITYEALKNQLHKHGGLLE 476          
BLAST of Calbindin-32 vs. Ensembl Zebrafish
Match: calb2a (calbindin 2a [Source:ZFIN;Acc:ZDB-GENE-040426-1677])

HSP 1 Score: 218.009 bits (554), Expect = 7.614e-69
Identity = 119/274 (43.43%), Postives = 173/274 (63.14%), Query Frame = 2
Query:  146 QLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQHSKL 967
             L + TA+QFLD+W HFD D NGYIE  ELDNF  Q   +     +     S +AF+     F++ +D+N+DGRIE+ EL+QILPT+E FL+ F++   + SS EFM  W+++D DRSGFIEANEL+ F+++LLK   K+    ++ K+  +T  +LK+FD N DGKL LSEMARLLP++EN+L K       ++S  +   IF  YD D NG++DE E+ ALL DL E   +  D K L  ++  I++   ++  GK+   EL+++L +   L
Sbjct:   12 HLAELTASQFLDIWKHFDADGNGYIEGKELDNFFSQLEIARRGAGVDP---SNAAFKGRMTEFMQKFDKNKDGRIEMSELAQILPTEENFLLCFRQ--FVGSSTEFMAAWRKYDTDRSGFIEANELKGFLSDLLK---KANRHYDDQKLQEYTQTILKMFDLNGDGKLGLSEMARLLPVQENFLLK---FQGVRLSAEQFNAIFTYYDKDGNGYIDEQELDALLKDLYEKNNKEVDSKSLTGYKQSIMA---LSDGGKLYRSELEIVLCRDPML 271          
BLAST of Calbindin-32 vs. Ensembl Zebrafish
Match: scgn (secretagogin, EF-hand calcium binding protein [Source:NCBI gene;Acc:573010])

HSP 1 Score: 205.297 bits (521), Expect = 6.522e-64
Identity = 106/277 (38.27%), Postives = 173/277 (62.45%), Query Frame = 2
Query:  140 DNQLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELS-QILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISF-LELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQHSK 964
            D+      A  FL +W HFD D+NGYIE  ELD+F       +  +P  ++ ++    Q +K++F+ AYD   DGR++I EL+  ILP +E FL++F+RE P+ +SVEFMKIW+++D D SG+I A EL+ F+ +L   ++K   K+  +K+  +T+ M+K+FD+N DG+L L+++AR+L ++EN+L +  ++ + ++    + E+IF  YDV R G ++  E+   + D+MEL         L+KF+  +L+  D+NKDGKI   EL + L    K
Sbjct:    2 DSAFANLDAAGFLQIWQHFDADDNGYIEGKELDDFFRHMLKKL--QP--KDKITDERVQQIKKSFMSAYDATFDGRLQIEELANMILPQEENFLLIFRREAPLDNSVEFMKIWRKYDADSSGYISAAELKNFLKDLFLQHKK---KIPPNKLDEYTDAMMKIFDKNKDGRLDLNDLARILALQENFLLQFKMDASSQVERKRDFEKIFAHYDVSRTGALEGPEVDGFVKDMMELVRPSISGGDLDKFRECLLTHCDMNKDGKIQKSELALCLGLKHK 271          
BLAST of Calbindin-32 vs. Ensembl Zebrafish
Match: scgn (secretagogin, EF-hand calcium binding protein [Source:NCBI gene;Acc:573010])

HSP 1 Score: 205.297 bits (521), Expect = 6.522e-64
Identity = 106/277 (38.27%), Postives = 173/277 (62.45%), Query Frame = 2
Query:  140 DNQLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELS-QILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISF-LELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQHSK 964
            D+      A  FL +W HFD D+NGYIE  ELD+F       +  +P  ++ ++    Q +K++F+ AYD   DGR++I EL+  ILP +E FL++F+RE P+ +SVEFMKIW+++D D SG+I A EL+ F+ +L   ++K   K+  +K+  +T+ M+K+FD+N DG+L L+++AR+L ++EN+L +  ++ + ++    + E+IF  YDV R G ++  E+   + D+MEL         L+KF+  +L+  D+NKDGKI   EL + L    K
Sbjct:    2 DSAFANLDAAGFLQIWQHFDADDNGYIEGKELDDFFRHMLKKL--QP--KDKITDERVQQIKKSFMSAYDATFDGRLQIEELANMILPQEENFLLIFRREAPLDNSVEFMKIWRKYDADSSGYISAAELKNFLKDLFLQHKK---KIPPNKLDEYTDAMMKIFDKNKDGRLDLNDLARILALQENFLLQFKMDASSQVERKRDFEKIFAHYDVSRTGALEGPEVDGFVKDMMELVRPSISGGDLDKFRECLLTHCDMNKDGKIQKSELALCLGLKHK 271          
BLAST of Calbindin-32 vs. Ensembl Zebrafish
Match: calb2b (calbindin 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1668])

HSP 1 Score: 203.371 bits (516), Expect = 3.304e-63
Identity = 114/271 (42.07%), Postives = 173/271 (63.84%), Query Frame = 2
Query:  146 QLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSV-ISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQ 955
             L + TA+QFLD+WN FD D NG IE  EL+NF+ +   +   ++P      S ++F+   + F++ +DEN DG+IE+ EL+QILPT+E FL+ F++   + SS EFM  W+++D DRSG+IE+NEL+ F+++LLK   K+    ++ K+  +T  +LK+FD N DGKL LSEMARLLP++EN+L K      +K+S  E E IF  YD D NG++DE E+ ALL DL    +   D   L   +  I++   ++  GK+   EL+++L +
Sbjct:   12 HLAELTASQFLDIWNKFDADGNGCIEGKELENFIRELEIARKTADP------SNASFKDRMKEFMQKFDENGDGKIEMSELAQILPTEENFLLCFRQ--FVGSSAEFMTAWRKYDTDRSGYIESNELKGFLSDLLK---KANRHYDDKKLNEYTQTILKMFDLNGDGKLGLSEMARLLPVEENFLLK---FQNFKLSAEEFEAIFNYYDKDGNGYIDEHELDALLRDLYHKHKMAVDPHSLSSSKKSIMA---LSDGGKLFRTELEIVLCK 265          
BLAST of Calbindin-32 vs. Ensembl Zebrafish
Match: calb1 (calbindin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-8107])

HSP 1 Score: 187.578 bits (475), Expect = 3.439e-57
Identity = 107/264 (40.53%), Postives = 166/264 (62.88%), Query Frame = 2
Query:  161 TATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILT 952
            +A+QFLD+++H+D D NG+IE  EL NF+ +   +   +  G E+  +       + F+E Y++N DG+I I EL QILPT+E FL+ F+++  + S  EFM+ W+ +D D SG+IEA+EL+ F+ +LL   Q++ +  +E K+  +T   LK+FD N DGKL LSEMARLLP  EN+L K       K++  E  +IF+ YD DRNG+MDE E+ ALL DL E   +  +  K+  +++ I++   ++  GK+   EL ++L 
Sbjct:   12 SASQFLDIFHHYDNDGNGFIEGKELQNFIKELQQA--RKQAGLELTDKM------KAFVEKYEQNADGKIGIIELVQILPTEENFLLFFRQQ--LKSCAEFMEAWRIYDADHSGYIEADELKNFLKDLL---QRAKKPYDEKKLEEYTLTTLKIFDSNKDGKLCLSEMARLLPDNENFLLKF---QGVKMARKEFNKIFELYDKDRNGYMDENELDALLKDLCEKNNKVLEANKISTYKSAIMA---LSDGGKLYRTELALVLC 256          
BLAST of Calbindin-32 vs. Ensembl Xenopus
Match: scgn (secretagogin, EF-hand calcium binding protein [Source:NCBI gene;Acc:780242])

HSP 1 Score: 201.83 bits (512), Expect = 1.985e-62
Identity = 106/272 (38.97%), Postives = 169/272 (62.13%), Query Frame = 2
Query:  140 DNQLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELS-QILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAK-PMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMIL 949
            D+   K  A +FL++W  FD D+NGYIE  ELD F        + + +G   ++    Q +K  F+ AYD   DGR++I EL+  ILP DE FL+LF+RE P+ +SVEFM+IW+++D+D SGFI A EL+ F+ +L   ++K   ++   K+  +T+ M+KLF++N DG+L L+++A++L ++EN+L +  M  ++      + E IF  YDV + G ++  E+   + D+MEL +       L+KF+ ++L+  DVNKDGKI   EL + L
Sbjct:    2 DSAFLKLDAAEFLEIWQRFDADDNGYIEGKELDEFFCH-----LLKKLGANAITAEKVQRVKDRFMSAYDVTADGRLQIQELANMILPEDENFLLLFRRETPLDNSVEFMRIWRKYDEDSSGFISAVELRNFLQDLFLQHKK---QITGDKLDEYTDTMMKLFNKNKDGRLDLNDLAKILALQENFLLQFKMDASSQDERKRDFETIFAHYDVSKTGALEGPEVDGFVKDMMELVKPSISGVDLDKFRQILLNHCDVNKDGKIQKSELALCL 265          

HSP 2 Score: 78.1814 bits (191), Expect = 5.688e-16
Identity = 49/178 (27.53%), Postives = 94/178 (52.81%), Query Frame = 2
Query:  164 ATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISS--SVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKEN 691
            + +F+ +W  +D D++G+I A EL NFL             ++ ++         T ++ +++N+DGR+++ +L++IL   E FL+ F+ +         +F  I+  +D  ++G +E  E+  FV ++++  + S   V+  K   F  I+L   D N DGK+Q SE+A  L +K +
Sbjct:  102 SVEFMRIWRKYDEDSSGFISAVELRNFLQDLFLQ------HKKQITGDKLDEYTDTMMKLFNKNKDGRLDLNDLAKILALQENFLLQFKMDASSQDERKRDFETIFAHYDVSKTGALEGPEVDGFVKDMMELVKPSISGVDLDK---FRQILLNHCDVNKDGKIQKSELALCLGLKPH 270          
BLAST of Calbindin-32 vs. Ensembl Xenopus
Match: scgn (secretagogin, EF-hand calcium binding protein [Source:NCBI gene;Acc:780242])

HSP 1 Score: 193.741 bits (491), Expect = 2.319e-59
Identity = 103/271 (38.01%), Postives = 165/271 (60.89%), Query Frame = 2
Query:  140 DNQLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELS-QILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMIL 949
            D+   K  A +FL++W  FD D+NGYIE  ELD F        + + +G   ++    Q +K  F+ AYD   DGR++I EL+  ILP DE FL+LF+RE P+ +SVEFM+IW+++D+D SGFI A EL+ F+ +L   ++K   ++   K+  +T+ M+KLF++N DG+L L+++A+ +  K ++L   +  ++      + E IF  YDV + G ++  E+   + D+MEL +       L+KF+ ++L+  DVNKDGKI   EL + L
Sbjct:    2 DSAFLKLDAAEFLEIWQRFDADDNGYIEGKELDEFFCH-----LLKKLGANAITAEKVQRVKDRFMSAYDVTADGRLQIQELANMILPEDENFLLLFRRETPLDNSVEFMRIWRKYDEDSSGFISAVELRNFLQDLFLQHKK---QITGDKLDEYTDTMMKLFNKNKDGRLDLNDLAKYVFYK-DFLIGSLWASSQDERKRDFETIFAHYDVSKTGALEGPEVDGFVKDMMELVKPSISGVDLDKFRQILLNHCDVNKDGKIQKSELALCL 263          

HSP 2 Score: 67.3958 bits (163), Expect = 3.133e-12
Identity = 43/176 (24.43%), Postives = 89/176 (50.57%), Query Frame = 2
Query:  164 ATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKEN 691
            + +F+ +W  +D D++G+I A EL NFL             ++ ++         T ++ +++N+DGR+++ +L++ +   +  +      +      +F  I+  +D  ++G +E  E+  FV ++++  + S   V+  K   F  I+L   D N DGK+Q SE+A  L +K +
Sbjct:  102 SVEFMRIWRKYDEDSSGFISAVELRNFLQDLFLQ------HKKQITGDKLDEYTDTMMKLFNKNKDGRLDLNDLAKYVFYKDFLIGSLWASSQDERKRDFETIFAHYDVSKTGALEGPEVDGFVKDMMELVKPSISGVDLDK---FRQILLNHCDVNKDGKIQKSELALCLGLKPH 268          
BLAST of Calbindin-32 vs. Ensembl Xenopus
Match: gata5 (GATA binding protein 5 [Source:Xenbase;Acc:XB-GENE-484906])

HSP 1 Score: 174.481 bits (441), Expect = 1.236e-52
Identity = 87/186 (46.77%), Postives = 127/186 (68.28%), Query Frame = 2
Query:  146 QLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAK 703
             L + TA+QFLD+W H+D+D NGYIE  EL+NF  +   +     +     S   F    + F++ YD+N DGRIE+ EL+QILPT+E FL+ F++     SS+EFM+ W+++D DRSG+IEANEL+ F+++LLK   K+    +E K+  +T  +L++FD N DGKL LSEM+RLLP++EN+L K
Sbjct:   11 HLAELTASQFLDIWKHYDSDGNGYIEGKELENFFRELEAARRGAGVDA---SNVNFGEKLKEFMQKYDKNADGRIEMAELAQILPTEENFLLCFRQH--AGSSIEFMEAWRKYDTDRSGYIEANELKGFLSDLLK---KANRPFDEKKLHEYTQTILRMFDLNGDGKLCLSEMSRLLPVQENFLLK 188          

HSP 2 Score: 109.383 bits (272), Expect = 9.232e-28
Identity = 53/169 (31.36%), Postives = 103/169 (60.95%), Query Frame = 2
Query:  449 SSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNI--MLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMIL 949
            ++ +F+ IWK +D D +G+IE  EL+ F  EL     +    V+ S + +   +   ++ +D+N+DG+++++E+A++LP +EN+L     +    I F+E    ++ YD DR+G+++  E++  L DL++    P+D+KKL ++   IL  +D+N DGK+ + E+  +L
Sbjct:   16 TASQFLDIWKHYDSDGNGYIEGKELENFFREL--EAARRGAGVDASNVNFGEKLKEFMQKYDKNADGRIEMAELAQILPTEENFLLCFRQHAGSSIEFME---AWRKYDTDRSGYIEANELKGFLSDLLKKANRPFDEKKLHEYTQTILRMFDLNGDGKLCLSEMSRLL 179          

HSP 3 Score: 61.2326 bits (147), Expect = 1.886e-10
Identity = 37/121 (30.58%), Postives = 59/121 (48.76%), Query Frame = 2
Query:  104 DNYLTKYRNRENDNQLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFM 466
            +N+L  +R           ++ +F++ W  +DTD +GYIEA EL  FL        + P   + L +       QT L  +D N DG++ + E+S++LP  E FL+ FQ     S  +  M
Sbjct:   95 ENFLLCFRQHAG-------SSIEFMEAWRKYDTDRSGYIEANELKGFLSDLLKKA-NRPFDEKKLHEYT-----QTILRMFDLNGDGKLCLSEMSRLLPVQENFLLKFQGMKLSSDGLNLM 202          
BLAST of Calbindin-32 vs. Ensembl Xenopus
Match: stim1 (stromal interaction molecule 1 [Source:Xenbase;Acc:XB-GENE-947969])

HSP 1 Score: 174.866 bits (442), Expect = 4.792e-52
Identity = 103/259 (39.77%), Postives = 165/259 (63.71%), Query Frame = 2
Query:  161 TATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKEL 937
            +A+QFL++W H+DTD NG+IE  EL NF+++   +   +  G ++  Q       + F++ Y+ N DG+I I EL+QILPT+E FL+ F+++  + SS EFM+ W+R+D D SGFIE +EL+ F+ +LLK   K+ +  EE+K+  +T+ ML +FD N+DGKL L+EM+ LLP++EN+L K       K+   E  ++F+ YD D NG++DE E+  LL DL +  ++  D   L  ++  I++   ++  GK+   EL
Sbjct:   17 SASQFLEIWRHYDTDGNGFIEGKELQNFILELQQA--RKKAGLDLSDQM------KAFVDQYENNTDGKIGIAELAQILPTEENFLLFFRQQ--LKSSEEFMQSWRRYDTDHSGFIETDELKSFLKDLLK---KANKPCEETKLEEYTHTMLLMFDTNNDGKLGLTEMSMLLPVQENFLLK---FQGVKMCGKEFNKVFELYDKDGNGYIDENELDDLLKDLCDKNKKDLDINNLSTYKKSIMA---LSDGGKLYRTEL 256          

HSP 2 Score: 101.293 bits (251), Expect = 2.991e-24
Identity = 52/167 (31.14%), Postives = 101/167 (60.48%), Query Frame = 2
Query:  449 SSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMIL 949
            S+ +F++IW+ +D D +GFIE  ELQ F+ EL +  +K+   + +    +        ++ N+DGK+ ++E+A++LP +EN+L   +       S  E  + ++ YD D +GF++  E+++ L DL++   +P ++ KLE++ + +L  +D N DGK+ + E+ M+L
Sbjct:   17 SASQFLEIWRHYDTDGNGFIEGKELQNFILELQQARKKAGLDLSDQMKAFVDQ-----YENNTDGKIGIAELAQILPTEENFL---LFFRQQLKSSEEFMQSWRRYDTDHSGFIETDELKSFLKDLLKKANKPCEETKLEEYTHTMLLMFDTNNDGKLGLTEMSMLL 175          
BLAST of Calbindin-32 vs. Ensembl Xenopus
Match: stim1 (stromal interaction molecule 1 [Source:Xenbase;Acc:XB-GENE-947969])

HSP 1 Score: 173.326 bits (438), Expect = 3.704e-51
Identity = 106/288 (36.81%), Postives = 176/288 (61.11%), Query Frame = 2
Query:  161 TATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYK-----ISFL-------------------ELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILT 952
            +A+QFL++W H+DTD NG+IE  EL NF+++   +   +  G ++  Q     MK  F++ Y+ N DG+I I EL+QILPT+E FL+ F+++  + SS EFM+ W+R+D D SGFIE +EL+ F+ +LLK   K+ +  EE+K+  +T+ ML +FD N+DGKL L+EM+ LLP++EN+L K  ++++ +     ++F+                   E  ++F+ YD D NG++DE E+  LL DL +  ++  D   L  ++  I++   ++  GK+   EL ++L 
Sbjct:   12 SASQFLEIWRHYDTDGNGFIEGKELQNFILELQQA--RKKAGLDLSDQ-----MK-AFVDQYENNTDGKIGIAELAQILPTEENFLLFFRQQ--LKSSEEFMQSWRRYDTDHSGFIETDELKSFLKDLLK---KANKPCEETKLEEYTHTMLLMFDTNNDGKLGLTEMSMLLPVQENFLLKFQVSSSVQPLQISVNFICVGINQMCFNPQGVKMCGKEFNKVFELYDKDGNGYIDENELDDLLKDLCDKNKKDLDINNLSTYKKSIMA---LSDGGKLYRTELALVLC 283          
BLAST of Calbindin-32 vs. Ensembl Mouse
Match: Calb2 (calbindin 2 [Source:MGI Symbol;Acc:MGI:101914])

HSP 1 Score: 203.371 bits (516), Expect = 4.218e-63
Identity = 112/270 (41.48%), Postives = 176/270 (65.19%), Query Frame = 2
Query:  146 QLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQS-AFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILT 952
             L + TA+QFL++W HFD D NGYIE  EL+NF  +   +      G  ++S+S  F    + F++ YD+N DG+IE+ EL+QILPT+E FL+ F++   + SS EFM+ W+++D DRSG+IEANEL+ F+++LLK   K+    +E K+  +T  +L++FD N DGKL LSEM+RLLP++EN+L K       K++  E   IF  YD D +G++DE E+ ALL DL E  ++  + ++L  ++  ++S   + + GK+  K+L+++L 
Sbjct:   12 HLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARK----GSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQH--VGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLLK---KANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLK---FQGMKLTSEEFNAIFTFYDKDGSGYIDENELDALLKDLYEKNKKEMNIQQLTTYRKSVMS---LAEAGKLYRKDLEIVLC 266          
BLAST of Calbindin-32 vs. Ensembl Mouse
Match: Calb2 (calbindin 2 [Source:MGI Symbol;Acc:MGI:101914])

HSP 1 Score: 196.438 bits (498), Expect = 7.133e-61
Identity = 105/230 (45.65%), Postives = 153/230 (66.52%), Query Frame = 2
Query:  146 QLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSA-FQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLME 832
             L + TA+QFL++W HFD D NGYIE  EL+NF  +   +      G  ++S+S  F    + F++ YD+N DG+IE+ EL+QILPT+E FL+ F++   + SS EFM+ W+++D DRSG+IEANEL+ F+++LLK   K+    +E K+  +T  +L++FD N DGKL LSEM+RLLP++EN+L K       K++  E   IF  YD D +G++DE E+ ALL DL E
Sbjct:   12 HLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARK----GSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQH--VGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLLK---KANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLK---FQGMKLTSEEFNAIFTFYDKDGSGYIDENELDALLKDLYE 229          

HSP 2 Score: 112.079 bits (279), Expect = 1.517e-28
Identity = 55/167 (32.93%), Postives = 100/167 (59.88%), Query Frame = 2
Query:  449 SSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMIL 949
            ++ +F++IWK FD D +G+IE  EL+ F  EL K  + S    +           ++ +D+NSDGK++++E+A++LP +EN+L   +    +  S  E    ++ YD DR+G+++  E++  L DL++    PYD+ KL+++   IL  +D+N DGK+ + E+  +L
Sbjct:   17 TASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFL---LCFRQHVGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLL 180          

HSP 3 Score: 88.1965 bits (217), Expect = 7.703e-20
Identity = 53/146 (36.30%), Postives = 81/146 (55.48%), Query Frame = 2
Query:  161 TATQFLDVWNHFDTDNNGYIEAAELDNFL---IQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESK 589
            ++ +F++ W  +DTD +GYIEA EL  FL   ++ A     EP           Q   QT L  +D N DG++ + E+S++LP  E FL+ FQ      +S EF  I+  +DKD SG+I+ NEL   + +L + N+K A +  ES+
Sbjct:  108 SSAEFMEAWRKYDTDRSGYIEANELKGFLSDLLKKANRPYDEP---------KLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLKFQ--GMKLTSEEFNAIFTFYDKDGSGYIDENELDALLKDLYEKNKKEAREKTESR 242          
BLAST of Calbindin-32 vs. Ensembl Mouse
Match: Calb1 (calbindin 1 [Source:MGI Symbol;Acc:MGI:88248])

HSP 1 Score: 184.882 bits (468), Expect = 3.886e-56
Identity = 103/265 (38.87%), Postives = 167/265 (63.02%), Query Frame = 2
Query:  158 FTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILT 952
             TA+QF ++W HFD D +GY+E  EL N + +   +   +  G E+  +       ++F++ Y + +DG+I I EL+ +LPT+E FL+LF R   + S  EFMK W+++D D SGFIE  EL+ F+ +LL   +K+ + V+++K+  +T++MLKLFD N+DGKL+L+EMARLLP++EN+L K       K+   E  + F+ YD D NG++DE E+ ALL DL E  ++  D   +  ++  I++   ++  GK+   +L +IL+
Sbjct:   11 ITASQFFEIWLHFDADGSGYLEGKELQNLIQELLQA--RKKAGLELSPEM------KSFVDQYGQRDDGKIGIVELAHVLPTEENFLLLF-RCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLL---EKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKF---QGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQELDINNITTYKKNIMA---LSDGGKLYRTDLALILS 257          
BLAST of Calbindin-32 vs. Ensembl Mouse
Match: Scgn (secretagogin, EF-hand calcium binding protein [Source:MGI Symbol;Acc:MGI:2384873])

HSP 1 Score: 171.4 bits (433), Expect = 9.121e-51
Identity = 93/267 (34.83%), Postives = 161/267 (60.30%), Query Frame = 2
Query:  155 KFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGEL-SQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAK-PMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMIL 949
            +  A  F  +W  FD +  GYI   ELD F       ++++    + L +   Q +K+  + +++ +++GRI + EL S  L  DE FL+ F+ E P+ +SVEFM+IW+++D D SGFI A EL  F+ +L  +++K+   + E+++  +T+ M+K+FD+N DG+L L+++AR+L ++EN+L +  M  ++ +    + E+IF  YDV + G ++  E+   + D+MEL +       L+KF+ ++L   DVNKDGKI   EL + L
Sbjct:   11 RLDAACFWQIWQRFDKEEKGYIRETELDAFF----DHLLAKSGTEDTLMEENVQKVKEQLMTSHNVSKEGRILMKELASMFLSEDENFLLFFRLETPLDNSVEFMQIWRKYDADSSGFISAAELCNFLRDLFLHHKKN---ISEAELEEYTSTMMKIFDKNKDGRLDLNDLARILALQENFLLQFKMDASSTEERKRDFEKIFAHYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCL 270          

HSP 2 Score: 93.2041 bits (230), Expect = 2.947e-21
Identity = 58/181 (32.04%), Postives = 103/181 (56.91%), Query Frame = 2
Query:  164 ATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVE-----FMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKEN 691
            + +F+ +W  +D D++G+I AAEL NFL             ++ +S++  +    T ++ +D+N+DGR+++ +L++IL   E FL+ F+ +   +SS E     F KI+  +D  ++G +E  E+  FV ++++  Q S   V+  K   F  I+L+  D N DGK+Q SE+A  L +K N
Sbjct:  107 SVEFMQIWRKYDADSSGFISAAELCNFLRDLFLH------HKKNISEAELEEYTSTMMKIFDKNKDGRLDLNDLARILALQENFLLQFKMD---ASSTEERKRDFEKIFAHYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDK---FREILLRHCDVNKDGKIQKSELALCLGLKIN 275          
BLAST of Calbindin-32 vs. Ensembl Mouse
Match: Scgn (secretagogin, EF-hand calcium binding protein [Source:MGI Symbol;Acc:MGI:2384873])

HSP 1 Score: 81.6481 bits (200), Expect = 1.319e-18
Identity = 42/113 (37.17%), Postives = 71/113 (62.83%), Query Frame = 2
Query:  614 LKLFDRNSDGKLQLSEMARLLPMKENYLAK-PMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMIL 949
            +K+FD+N DG+L L+++AR+L ++EN+L +  M  ++ +    + E+IF  YDV + G ++  E+   + D+MEL +       L+KF+ ++L   DVNKDGKI   EL + L
Sbjct:    1 MKIFDKNKDGRLDLNDLARILALQENFLLQFKMDASSTEERKRDFEKIFAHYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCL 113          

HSP 2 Score: 67.781 bits (164), Expect = 1.167e-13
Identity = 43/124 (34.68%), Postives = 74/124 (59.68%), Query Frame = 2
Query:  335 LEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVE-----FMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKEN 691
            ++ +D+N+DGR+++ +L++IL   E FL+ F+ +   +SS E     F KI+  +D  ++G +E  E+  FV ++++  Q S   V+  K   F  I+L+  D N DGK+Q SE+A  L +K N
Sbjct:    1 MKIFDKNKDGRLDLNDLARILALQENFLLQFKMD---ASSTEERKRDFEKIFAHYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDK---FREILLRHCDVNKDGKIQKSELALCLGLKIN 118          
BLAST of Calbindin-32 vs. UniProt/SwissProt
Match: sp|P41044|CAB32_DROME (Calbindin-32 OS=Drosophila melanogaster OX=7227 GN=Cbp53E PE=2 SV=1)

HSP 1 Score: 263.462 bits (672), Expect = 3.720e-85
Identity = 130/289 (44.98%), Postives = 200/289 (69.20%), Query Frame = 2
Query:  107 NYLTKYRNRENDNQLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELT-EEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQHSKLG 970
            N++ +YR+ E+  +L K +A QF+DVW H+D D NGYIE  ELD FL +F +S  +  I  E ++ +  + +K  F+EAYD+N+DG+I+I EL+Q+LP +E FL+LF+ +NP+ SSVEFMKIW+ +D D SG+IEA+EL+ F+ +LLK  +K  + V E K++ +T+ ML++FD N DG+LQLSEMA+LLP+KEN+L + +     K++  ++E++F  YD D +G ++  E++  L DL+EL  ++ YD + L  F+  I+     +K GKIS KEL MIL   +K+ 
Sbjct:   19 NFMRQYRDPES-RELKKLSANQFMDVWAHYDKDGNGYIEGTELDGFLREFVSSANATDISPEAVTDTMLEELKSCFMEAYDDNQDGKIDIRELAQLLPMEENFLLLFRFDNPLESSVEFMKIWREYDTDNSGYIEADELKNFLRDLLKEAKKIND-VSEDKLIEYTDTMLQVFDANKDGRLQLSEMAKLLPVKENFLCRQVFKGATKLTKEDIEKVFSLYDRDNSGTIENEELKGFLKDLLELVKKDDYDAQDLAAFEETIMRGVGTDKHGKISRKELTMILLTLAKIS 305          
BLAST of Calbindin-32 vs. UniProt/SwissProt
Match: sp|P07090|CALB2_CHICK (Calretinin OS=Gallus gallus OX=9031 GN=CALB2 PE=2 SV=3)

HSP 1 Score: 209.92 bits (533), Expect = 7.637e-65
Identity = 118/274 (43.07%), Postives = 176/274 (64.23%), Query Frame = 2
Query:  146 QLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQHSKL 967
             L + +A+QFLDVW HFD D NGYIE  EL+NF  +  ++   +  G +    S    MK+ F+  YD+N DG+IE+ EL+QILPT+E FL+ F++   + SS EFM+ W+R+D DRSG+IEANEL+ F+++LLK   K+    +E+K+  +T  +L++FD N DGKL LSEM+RLLP++EN+L K       K+S  E   IF  YD D +GF+DE E+ ALL DL E  ++    ++L  ++  I+   +++  GK+  KEL+++L     L
Sbjct:   10 HLAELSASQFLDVWRHFDADGNGYIEGKELENFFQELESA--RKGTGVDSKRDSLGDKMKE-FMHKYDKNADGKIEMAELAQILPTEENFLLCFRQH--VGSSSEFMEAWRRYDTDRSGYIEANELKGFLSDLLK---KANRPYDEAKLQEYTQTILRMFDMNGDGKLGLSEMSRLLPVQENFLLK---FQGMKLSSEEFNAIFAFYDKDGSGFIDEHELDALLKDLYEKNKKEMSIQQLTNYRRSIM---NLSDGGKLYRKELEVVLCSEPPL 269          
BLAST of Calbindin-32 vs. UniProt/SwissProt
Match: sp|P22676|CALB2_HUMAN (Calretinin OS=Homo sapiens OX=9606 GN=CALB2 PE=2 SV=2)

HSP 1 Score: 206.068 bits (523), Expect = 2.061e-63
Identity = 113/275 (41.09%), Postives = 178/275 (64.73%), Query Frame = 2
Query:  146 QLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSA-FQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQHSKL 967
             L + TA+QFL++W HFD D NGYIE  EL+NF  +   +      G  ++S+S  F    + F++ YD+N DG+IE+ EL+QILPT+E FL+ F++   + SS EFM+ W+++D DRSG+IEANEL+ F+++LLK   K+    +E K+  +T  +L++FD N DGKL LSEM+RLLP++EN+L K       K++  E   IF  YD DR+G++DE E+ ALL DL E  ++  + ++L  ++  ++S   + + GK+  K+L+++L     +
Sbjct:   12 HLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARK----GSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQH--VGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLLK---KANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLK---FQGMKLTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQLTNYRKSVMS---LAEAGKLYRKDLEIVLCSEPPM 271          
BLAST of Calbindin-32 vs. UniProt/SwissProt
Match: sp|Q5XJX1|SEGN_DANRE (Secretagogin OS=Danio rerio OX=7955 GN=scgn PE=1 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 4.924e-63
Identity = 106/277 (38.27%), Postives = 173/277 (62.45%), Query Frame = 2
Query:  140 DNQLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELS-QILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISF-LELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQHSK 964
            D+      A  FL +W HFD D+NGYIE  ELD+F       +  +P  ++ ++    Q +K++F+ AYD   DGR++I EL+  ILP +E FL++F+RE P+ +SVEFMKIW+++D D SG+I A EL+ F+ +L   ++K   K+  +K+  +T+ M+K+FD+N DG+L L+++AR+L ++EN+L +  ++ + ++    + E+IF  YDV R G ++  E+   + D+MEL         L+KF+  +L+  D+NKDGKI   EL + L    K
Sbjct:    2 DSAFANLDAAGFLQIWQHFDADDNGYIEGKELDDFFRHMLKKL--QP--KDKITDERVQQIKKSFMSAYDATFDGRLQIEELANMILPQEENFLLIFRREAPLDNSVEFMKIWRKYDADSSGYISAAELKNFLKDLFLQHKK---KIPPNKLDEYTDAMMKIFDKNKDGRLDLNDLARILALQENFLLQFKMDASSQVERKRDFEKIFAHYDVSRTGALEGPEVDGFVKDMMELVRPSISGGDLDKFRECLLTHCDMNKDGKIQKSELALCLGLKHK 271          
BLAST of Calbindin-32 vs. UniProt/SwissProt
Match: sp|Q63ZJ3|SEGN_XENLA (Secretagogin OS=Xenopus laevis OX=8355 GN=scgn PE=2 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 6.187e-63
Identity = 108/272 (39.71%), Postives = 169/272 (62.13%), Query Frame = 2
Query:  140 DNQLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELS-QILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAK-PMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMIL 949
            D+   K  A +FL++W  FD D+NGYIE  ELD F        + + +G   ++    Q +K  F+ AYD   DGR++I EL+  ILP DE FL+LF+RE P+ +SVEFM+IW++FD+D SGFI A EL+ F+ +L   ++K    +   K+  +T+ M+KLF+RN DG+L L+++A++L ++EN+L +  M  ++ +    + E IF  YDV + G ++  E+   + D+MEL +       L+KF+ ++L+  DVNKDGKI   EL + L
Sbjct:    2 DSAFLKLDAAEFLEIWQRFDADDNGYIEGKELDEFFCH-----LLKKLGTNAITADKVQGVKDRFMSAYDITADGRLQIQELANMILPEDENFLLLFRRETPLDNSVEFMRIWRKFDEDSSGFISAVELRNFLQDLFLQHKKH---ITGDKLDEYTDTMMKLFNRNKDGRLDLNDLAKILALQENFLLQFKMDASSQEERKSDFETIFAHYDVSKTGALEGPEVDGFVKDMMELVKPSISGVDLDKFRQILLNHCDVNKDGKIQKSELALCL 265          

HSP 2 Score: 81.2629 bits (199), Expect = 2.583e-16
Identity = 54/181 (29.83%), Postives = 96/181 (53.04%), Query Frame = 2
Query:  164 ATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVE-----FMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKEN 691
            + +F+ +W  FD D++G+I A EL NFL             ++ ++         T ++ ++ N+DGR+++ +L++IL   E FL+ F+ +   +SS E     F  I+  +D  ++G +E  E+  FV ++++  + S   V+  K   F  I+L   D N DGK+Q SE+A  L +K N
Sbjct:  102 SVEFMRIWRKFDEDSSGFISAVELRNFLQDLFLQ------HKKHITGDKLDEYTDTMMKLFNRNKDGRLDLNDLAKILALQENFLLQFKMD---ASSQEERKSDFETIFAHYDVSKTGALEGPEVDGFVKDMMELVKPSISGVDLDK---FRQILLNHCDVNKDGKIQKSELALCLGLKAN 270          
BLAST of Calbindin-32 vs. TrEMBL
Match: A0A267GD68 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030011g2 PE=4 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 1.585e-109
Identity = 162/295 (54.92%), Postives = 221/295 (74.92%), Query Frame = 2
Query:  107 NYLTKYRNRENDNQLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEP-------YDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQHSKLG 970
            N+L+++R+ +   +L  FTATQF +VW+H+D D NG+IE AELD FL +F +SV+SE  G EV+S++A   MK+ F+EA+DEN DG+IEIGELSQILPT+E FL+LF+R NP+ SSVEFM+IWK+FDKD SGFIEA+EL++F+  +L +  K    V E K++ +T+ ML+LFD+N DGKLQLSEMARLLP+KENYL +P+  N  KIS  +++R+F  YD D+NG ++  E+Q  L DL+EL +E        YDD+ ++ F+ VIL +WDVN DGKIS  ELKMIL Q S++ 
Sbjct:    8 NFLSQFRD-QGTKKLKNFTATQFAEVWSHYDQDGNGFIEGAELDEFLHEFISSVVSEDAGNEVVSETAMAQMKRDFMEAFDENLDGKIEIGELSQILPTEENFLLLFRRNNPVDSSVEFMRIWKQFDKDNSGFIEADELKDFLKSILDSADKP---VTEDKLIEYTDTMLQLFDQNRDGKLQLSEMARLLPVKENYLCRPIFKNASKISSSDIDRVFSLYDRDKNGTIENEELQGFLKDLLELAQEQGMTQKKDYDDQDMQFFKRVILDQWDVNHDGKISKDELKMILMQQSRIA 298          
BLAST of Calbindin-32 vs. TrEMBL
Match: A0A267GV22 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030011g1 PE=4 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 1.655e-109
Identity = 162/295 (54.92%), Postives = 221/295 (74.92%), Query Frame = 2
Query:  107 NYLTKYRNRENDNQLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEP-------YDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQHSKLG 970
            N+L+++R+ +   +L  FTATQF +VW+H+D D NG+IE AELD FL +F +SV+SE  G EV+S++A   MK+ F+EA+DEN DG+IEIGELSQILPT+E FL+LF+R NP+ SSVEFM+IWK+FDKD SGFIEA+EL++F+  +L +  K    V E K++ +T+ ML+LFD+N DGKLQLSEMARLLP+KENYL +P+  N  KIS  +++R+F  YD D+NG ++  E+Q  L DL+EL +E        YDD+ ++ F+ VIL +WDVN DGKIS  ELKMIL Q S++ 
Sbjct:    8 NFLSQFRD-QGTKKLKNFTATQFAEVWSHYDQDGNGFIEGAELDEFLHEFISSVVSEDAGNEVVSETAMAQMKKDFMEAFDENLDGKIEIGELSQILPTEENFLLLFRRNNPVDSSVEFMRIWKQFDKDNSGFIEADELKDFLKSILDSADKP---VTEDKLIEYTDTMLQLFDQNRDGKLQLSEMARLLPVKENYLCRPIFKNASKISSSDIDRVFSLYDRDKNGTIENEELQGFLKDLLELAQEQGMTQKKDYDDQDMQFFKRVILDQWDVNHDGKISKDELKMILMQQSRIA 298          
BLAST of Calbindin-32 vs. TrEMBL
Match: A0A267FNU4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030011g3 PE=4 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 1.692e-109
Identity = 162/295 (54.92%), Postives = 221/295 (74.92%), Query Frame = 2
Query:  107 NYLTKYRNRENDNQLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEP-------YDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQHSKLG 970
            N+L+++R+ +   +L  FTATQF +VW+H+D D NG+IE AELD FL +F +SV+SE  G EV+S++A   MK+ F+EA+DEN DG+IEIGELSQILPT+E FL+LF+R NP+ SSVEFM+IWK+FDKD SGFIEA+EL++F+  +L +  K    V E K++ +T+ ML+LFD+N DGKLQLSEMARLLP+KENYL +P+  N  KIS  +++R+F  YD D+NG ++  E+Q  L DL+EL +E        YDD+ ++ F+ VIL +WDVN DGKIS  ELKMIL Q S++ 
Sbjct:    8 NFLSQFRD-QGTKKLKNFTATQFAEVWSHYDQDGNGFIEGAELDEFLHEFISSVVSEDAGNEVVSETAMAQMKKDFMEAFDENLDGKIEIGELSQILPTEENFLLLFRRNNPVDSSVEFMRIWKQFDKDNSGFIEADELKDFLKSILDSADKP---VTEDKLIEYTDTMLQLFDQNRDGKLQLSEMARLLPVKENYLCRPIFKNASKISSSDIDRVFSLYDRDKNGTIENEELQGFLKDLLELAQEQGITQKKDYDDQDMQFFKRVILDQWDVNHDGKISKDELKMILMQQSRIA 298          
BLAST of Calbindin-32 vs. TrEMBL
Match: A0A267G6Z8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033745g2 PE=4 SV=1)

HSP 1 Score: 326.635 bits (836), Expect = 1.385e-107
Identity = 156/288 (54.17%), Postives = 219/288 (76.04%), Query Frame = 2
Query:  107 NYLTKYRNRENDNQLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQHSKLG 970
            N+L ++R+ +N  +L  FTATQF +VW+H+D D NG+IE  ELD FL +F +SV++E IG EV+S++A  AMK+ F++A+DEN DG+IEIGELSQILPT+E FL+LF+R NP+ SSVEFM+IW++FDKD SG+IEA+EL++F+  +L    +    V E K++ +T+ ML+LFD+N DGKLQLSEMA+LLP+KENYL +P+  N  +I+  +++R+F  YD D+NG ++  E+Q  L DL+EL +E YD + +  F+ VIL +WDVN DGKIS  ELKMIL Q S+L 
Sbjct:   15 NFLAQFRD-QNTRRLKNFTATQFAEVWSHYDKDGNGFIEGQELDEFLREFISSVVTEDIGPEVISETALAAMKRDFMDAFDENYDGKIEIGELSQILPTEENFLLLFRRNNPVDSSVEFMRIWRQFDKDHSGYIEADELRDFLKHILDCADRC---VSEDKLLEYTSTMLQLFDQNRDGKLQLSEMAKLLPVKENYLCRPIFKNANRINSNDIDRVFNLYDRDKNGCIENEELQGFLKDLLELAQEDYDAQDMLFFKKVILDQWDVNHDGKISKDELKMILLQQSRLA 298          
BLAST of Calbindin-32 vs. TrEMBL
Match: A0A1I8GV54 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003004g1 PE=4 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 1.528e-107
Identity = 156/288 (54.17%), Postives = 219/288 (76.04%), Query Frame = 2
Query:  107 NYLTKYRNRENDNQLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQHSKLG 970
            N+L ++R+ +N  +L  FTATQF +VW+H+D D NG+IE  ELD FL +F +SV++E IG EV+S++A  AMK+ F++A+DEN DG+IEIGELSQILPT+E FL+LF+R NP+ SSVEFM+IW++FDKD SG+IEA+EL++F+  +L    +    V E K++ +T+ ML+LFD+N DGKLQLSEMA+LLP+KENYL +P+  N  +I+  +++R+F  YD D+NG ++  E+Q  L DL+EL +E YD + +  F+ VIL +WDVN DGKIS  ELKMIL Q S+L 
Sbjct:   15 NFLAQFRD-QNTRRLKNFTATQFAEVWSHYDKDGNGFIEGQELDEFLREFISSVVTEDIGPEVISETALAAMKRDFMDAFDENYDGKIEIGELSQILPTEENFLLLFRRNNPVDSSVEFMRIWRQFDKDHSGYIEADELRDFLKHILDCADRC---VSEDKLLEYTSTMLQLFDQNRDGKLQLSEMAKLLPVKENYLCRPIFKNANRINSNDIDRVFNLYDRDKNGCIENEELQGFLKDLLELAQEDYDAQDMLFFKKVILDQWDVNHDGKISKDELKMILLQQSRLA 298          
BLAST of Calbindin-32 vs. Ensembl Cavefish
Match: calb2a (calretinin [Source:NCBI gene;Acc:103033342])

HSP 1 Score: 212.231 bits (539), Expect = 1.065e-66
Identity = 120/274 (43.80%), Postives = 176/274 (64.23%), Query Frame = 2
Query:  146 QLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQHSKL 967
             L + TA+QFLD+W HFDTD NGYIE  EL+NF  +    V     G +  + S  + MK  F++ +D+N+DGRIE+ EL+QILPT+E FL+ F++   + SS EFM  W+R+D DRSG+IEANEL+ F+++LLK   K+    ++ K+  +T  +LK+FD N DGKL LSEMARLLP++EN+L K       K++  +   IF  YD D NG++DE E+ ALL DL E  ++  D K L  ++  I++   ++  GK+   EL+++L +   L
Sbjct:   12 HLAELTASQFLDIWKHFDTDGNGYIEGKELENFFREL--EVARRGAGVDPTNVSFREKMKD-FMQKFDKNKDGRIEMSELAQILPTEENFLLCFRQ--FVGSSSEFMAAWRRYDTDRSGYIEANELKGFLSDLLK---KANRHYDDKKLQEYTQTILKMFDLNGDGKLGLSEMARLLPVQENFLLK---FQGIKLTAEQFNAIFTYYDKDGNGYIDEQELDALLRDLYEKNKKEVDTKDLTGYKKSIMA---LSDGGKLYRSELEIVLCREPML 271          
BLAST of Calbindin-32 vs. Ensembl Cavefish
Match: scgn (secretagogin, EF-hand calcium binding protein [Source:NCBI gene;Acc:103030695])

HSP 1 Score: 206.838 bits (525), Expect = 1.391e-64
Identity = 111/272 (40.81%), Postives = 170/272 (62.50%), Query Frame = 2
Query:  140 DNQLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELS-QILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAK-PMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMIL 949
            D  L+   A  FL +W HFD D+NGYIE  ELD F     T +   P G  V ++   Q +K  F+ AYD   DGR++I EL+  ILP DE FL++F+RE P+ +SVEFMKIW+++D D SG+I A EL+ F+ +L ++++K   ++  SK+  +T+ M+ +FD+N DG+L L+++AR+L ++EN+L +  M  NT      + E+IF  YDV + G ++  E+   + D+MEL        +L++F+ V+L   D+NKDGKI   EL + L
Sbjct:    2 DCDLDNLDAAGFLQIWQHFDADDNGYIEGKELDAFFRHMMTKL--RP-GDNV-TEEKVQQLKARFMSAYDVTADGRLQIQELANMILPEDENFLLVFRREAPLDNSVEFMKIWRKYDADSSGYISAVELKSFLQDLFQHHKK---ELSSSKLEEYTDTMMNIFDKNKDGRLDLNDLARILALQENFLLQFKMDANTLLERKRDFEKIFAHYDVSKTGALEGPEVDGFVKDMMELVRPSISGSELDQFRKVLLRHCDINKDGKIQKNELALCL 266          

HSP 2 Score: 88.5817 bits (218), Expect = 7.657e-20
Identity = 53/176 (30.11%), Postives = 97/176 (55.11%), Query Frame = 2
Query:  164 ATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRE--NPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMK 685
            + +F+ +W  +D D++GYI A EL +FL         E      LS S  +    T +  +D+N+DGR+++ +L++IL   E FL+ F+ +    +    +F KI+  +D  ++G +E  E+  FV ++++  + S   +  S++  F  ++L+  D N DGK+Q +E+A  L MK
Sbjct:  103 SVEFMKIWRKYDADSSGYISAVELKSFLQDLFQHHKKE------LSSSKLEEYTDTMMNIFDKNKDGRLDLNDLARILALQENFLLQFKMDANTLLERKRDFEKIFAHYDVSKTGALEGPEVDGFVKDMMELVRPS---ISGSELDQFRKVLLRHCDINKDGKIQKNELALCLGMK 269          
BLAST of Calbindin-32 vs. Ensembl Cavefish
Match: calb2b (calretinin-like [Source:NCBI gene;Acc:103034108])

HSP 1 Score: 192.971 bits (489), Expect = 2.693e-59
Identity = 113/273 (41.39%), Postives = 178/273 (65.20%), Query Frame = 2
Query:  146 QLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATS---VISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQ 955
             L + TA+QF+DVW HFD+D NG+IE  EL++FL +  ++   V +EP+       ++ +     F++ +D+N DG+IE+ EL+QILPT+E FL+ F++   + SS EFM  W+++D DRSGFIEANEL+ F+++LL    K+  + ++ K+  +T+ +LK+FD N DGKL LSEMARLLP++EN+L K     ++K+S  E   IF  YD D NG++DE E+ ALL DL +     +D + L   +  I++   ++  GK+   EL+++L +
Sbjct:    9 HLAELTASQFMDVWRHFDSDGNGFIEGQELEDFLEELESARKGVNAEPV------NASLRMKISDFMQKFDQNSDGKIEMLELAQILPTEENFLLCFRQ--FVGSSAEFMTAWRKYDTDRSGFIEANELKGFLSDLL---TKANRQYDDKKLNEYTHTILKMFDLNGDGKLGLSEMARLLPVQENFLLK---FQSFKLSSDEFSAIFMYYDKDGNGYIDEHELDALLKDLYKKHNMDFDSQTLASSKKSIMA---LSDGGKLFRTELEIVLCK 264          
BLAST of Calbindin-32 vs. Ensembl Cavefish
Match: calb1 (calbindin 1 [Source:NCBI gene;Acc:103033937])

HSP 1 Score: 190.274 bits (482), Expect = 3.028e-58
Identity = 108/265 (40.75%), Postives = 170/265 (64.15%), Query Frame = 2
Query:  161 TATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQ 955
            +A+QFLD+++H+D D NGYIE  EL NF+ +   +   +  G E+  Q       + F+E Y++N DG+I+I EL QILPT+E FL+ F+++  + S  EFM+ W+ +D D SG+IE++EL+ F+ +LL   Q++ +  +E K+  +T   LK+FD N+DGKL LSEMARLLP  EN+L K       K++  E  +IF+ YD DRNG+MDE E+ ALL DL E  ++  +  K++ ++  I++   ++  GK+   EL ++L +
Sbjct:   12 SASQFLDIFHHYDNDGNGYIEGKELQNFIKELQQA--RKQAGLELTDQM------RAFVEEYEKNADGKIDIVELVQILPTEENFLLFFRQQ--LKSCTEFMEAWRTYDADHSGYIESDELKNFLRDLL---QRAKKPFDEKKLEEYTLTTLKIFDSNNDGKLCLSEMARLLPDDENFLLKF---EGVKMARKEFNKIFELYDKDRNGYMDENELDALLKDLCEKNKKVLEIGKIQVYKKAIMA---LSDGGKLYRTELALVLCE 257          
BLAST of Calbindin-32 vs. Ensembl Cavefish
Match: calb2b (calretinin-like [Source:NCBI gene;Acc:103034108])

HSP 1 Score: 189.504 bits (480), Expect = 7.686e-58
Identity = 114/271 (42.07%), Postives = 177/271 (65.31%), Query Frame = 2
Query:  146 QLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQT-FLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQ 955
             L + TA+QF+DVW HFD+D NG+IE  EL++FL +  ++       + V   +A   MK + F++ +D+N DG+IE+ EL+QILPT+E FL+ F++   + SS EFM  W+++D DRSGFIEANEL+ F+++LL    K+  + ++ K+  +T+ +LK+FD N DGKL LSEMARLLP++EN+L K     ++K+S  E   IF  YD D NG++DE E+ ALL DL +     +D + L   +  I++   ++  GK+   EL+++L +
Sbjct:   15 HLAELTASQFMDVWRHFDSDGNGFIEGQELEDFLEELESAR------KGVNPVNASLRMKISDFMQKFDQNSDGKIEMLELAQILPTEENFLLCFRQ--FVGSSAEFMTAWRKYDTDRSGFIEANELKGFLSDLL---TKANRQYDDKKLNEYTHTILKMFDLNGDGKLGLSEMARLLPVQENFLLK---FQSFKLSSDEFSAIFMYYDKDGNGYIDEHELDALLKDLYKKHNMDFDSQTLASSKKSIMA---LSDGGKLFRTELEIVLCK 268          
BLAST of Calbindin-32 vs. Ensembl Sea Lamprey
Match: scgn (secretagogin, EF-hand calcium binding protein [Source:NCBI gene;Acc:573010])

HSP 1 Score: 190.66 bits (483), Expect = 5.143e-59
Identity = 100/269 (37.17%), Postives = 164/269 (60.97%), Query Frame = 2
Query:  149 LNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELS-QILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAK-PMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMIL 949
            +    +   L+VW  FD D+NGYIE  ELD F       ++ +   +E +S    + +++  +  YDE+ DGR+ + E++  +L  DE FL++F+R + + +SVEF+KIW ++D D SGFI A+EL+ F+ +LL ++ +   +VEE K+  +T+ M+KLFD+N DG+L L++MAR+L +KENYL +  + + + +    + E+IF  YDV R G ++  E+   + D+MEL         L KF++ +L   D N+DGKI   EL + L
Sbjct:    6 IGHLDSQGLLEVWQKFDADDNGYIEGKELDEFF----KHLLKQLAAKECVSDEKVETVRRNLMSIYDESADGRLHLSEVANMLLAEDESFLLIFKRASSLDNSVEFIKIWHQYDLDSSGFISASELKNFLKDLLSHHGR---QVEEKKLEEYTDTMMKLFDKNKDGRLDLNDMARILSLKENYLLQFSIEDASQEERRRDFEKIFAHYDVSRTGVLEGPEVDGFVKDMMELVRPSLTVADLSKFRDSLLRRCDTNQDGKIQKWELALCL 267          

HSP 2 Score: 89.7373 bits (221), Expect = 7.438e-21
Identity = 53/169 (31.36%), Postives = 99/169 (58.58%), Query Frame = 2
Query:  461 FMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMAR-LLPMKENYL----AKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILT 952
             +++W++FD D +G+IE  EL EF   LLK    + E V + K+      ++ ++D ++DG+L LSE+A  LL   E++L        L+N+     +E  +I+  YD+D +GF+  +E++  L DL+       ++KKLE++ + ++  +D NKDG++ + ++  IL+
Sbjct:   14 LLEVWQKFDADDNGYIEGKELDEFFKHLLKQ-LAAKECVSDEKVETVRRNLMSIYDESADGRLHLSEVANMLLAEDESFLLIFKRASSLDNS-----VEFIKIWHQYDLDSSGFISASELKNFLKDLLSHHGRQVEEKKLEEYTDTMMKLFDKNKDGRLDLNDMARILS 176          

HSP 3 Score: 85.1149 bits (209), Expect = 3.450e-19
Identity = 52/179 (29.05%), Postives = 102/179 (56.98%), Query Frame = 2
Query:  164 ATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPIS--SSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENY 694
            + +F+ +W+ +D D++G+I A+EL NFL      ++S   GR+V  +   +    T ++ +D+N+DGR+++ ++++IL   E +L+ F  E+        +F KI+  +D  R+G +E  E+  FV ++++  + S    + SK   F + +L+  D N DGK+Q  E+A  L ++  +
Sbjct:  104 SVEFIKIWHQYDLDSSGFISASELKNFL----KDLLSHH-GRQV-EEKKLEEYTDTMMKLFDKNKDGRLDLNDMARILSLKENYLLQFSIEDASQEERRRDFEKIFAHYDVSRTGVLEGPEVDGFVKDMMELVRPSLTVADLSK---FRDSLLRRCDTNQDGKIQKWELALCLGIRTAH 273          
BLAST of Calbindin-32 vs. Ensembl Sea Lamprey
Match: CALB2 (calbindin 2 [Source:HGNC Symbol;Acc:HGNC:1435])

HSP 1 Score: 93.2041 bits (230), Expect = 1.991e-23
Identity = 60/147 (40.82%), Postives = 89/147 (60.54%), Query Frame = 2
Query:  521 LQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQHS 961
            LQ+F+ +LLK   K+  + +E K+  +T   LK+FD N DGKL+LSEMARLLP++EN+L K        ++  E   IF  YD DRNG++DE E++ALL DL E   +  D + L  ++  I++  D    GK+   +L+M+L   S
Sbjct:    1 LQDFLKDLLK---KANREFDEKKLNEYTQTTLKMFDSNRDGKLELSEMARLLPVQENFLLKF---QGVTMTAKEFNDIFTFYDKDRNGYIDEDELEALLRDLHEKNRKDLDAQTLTSYKRNIMALSD---HGKLYRNDLEMVLCVES 138          

HSP 2 Score: 63.1586 bits (152), Expect = 1.476e-12
Identity = 34/96 (35.42%), Postives = 60/96 (62.50%), Query Frame = 2
Query:  326 QTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIM 613
            QT L+ +D N DG++E+ E++++LP  E FL+ FQ      ++ EF  I+  +DKDR+G+I+ +EL+  + +L + N+K  +   ++   Y  NIM
Sbjct:   26 QTTLKMFDSNRDGKLELSEMARLLPVQENFLLKFQ--GVTMTAKEFNDIFTFYDKDRNGYIDEDELEALLRDLHEKNRKDLDA--QTLTSYKRNIM 117          
BLAST of Calbindin-32 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000059.1 (pep scaffold:Pmarinus_7.0:GL485405:3181:11335:1 gene:ENSPMAG00000000055.1 transcript:ENSPMAT00000000059.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 89.3521 bits (220), Expect = 1.104e-22
Identity = 40/77 (51.95%), Postives = 59/77 (76.62%), Query Frame = 2
Query:  296 LSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQ 526
            L +S  +   ++F+E YD+N DG+IE+ EL+QILPT+E FL+ F++   + SS EFM+ W+R+D DRSG+IEANEL+
Sbjct:    3 LPESVVKEKMKSFMEKYDKNADGKIEMAELAQILPTEENFLLFFRQH--VKSSAEFMETWRRYDTDRSGYIEANELK 77          

HSP 2 Score: 47.7506 bits (112), Expect = 1.042e-7
Identity = 20/62 (32.26%), Postives = 42/62 (67.74%), Query Frame = 2
Query:  623 FDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQ 808
            +D+N+DGK++++E+A++LP +EN+L   +    +  S  E    ++ YD DR+G+++  E++
Sbjct:   19 YDKNADGKIEMAELAQILPTEENFL---LFFRQHVKSSAEFMETWRRYDTDRSGYIEANELK 77          
BLAST of Calbindin-32 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001806.1 (pep scaffold:Pmarinus_7.0:GL476330:305753:307416:1 gene:ENSPMAG00000001642.1 transcript:ENSPMAT00000001806.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 6.431e-11
Identity = 26/54 (48.15%), Postives = 40/54 (74.07%), Query Frame = 2
Query:  308 AFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMK 469
            +F+   + F+E +D+N DGRIE+ EL+QILPT+E FL+ F++   + SS EFM+
Sbjct:    1 SFRESMKEFMEKFDQNSDGRIELAELAQILPTEENFLLFFRQH--VKSSAEFME 52          
BLAST of Calbindin-32 vs. Ensembl Nematostella
Match: EDO45967 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRJ7])

HSP 1 Score: 144.05 bits (362), Expect = 6.425e-41
Identity = 97/278 (34.89%), Postives = 155/278 (55.76%), Query Frame = 2
Query:  143 NQLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSV-ISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKI----SFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEP---YDDKKLEKFQNVILSEWDVNKDGKISMKELKMILT 952
            ++  K +  +F+ V+  FD+D NGYIE  E+D F+      +   EP   EV  +      K+  LE YD ++DGR  + EL  ILP +   L  +  E     SV+FMKI+ RFD+D+SGF+E  EL+ F  ELL    KS+  +   K+  +    L+ +D N DGK  L+E+A++LP++EN         TY I    +  +  +++  YD D +G ++  E+ ALL D+++  ++P   Y+   LE+F+++IL  +D NKD K+S  EL  +L+
Sbjct:    3 DKATKLSPVEFVKVFMKFDSDKNGYIEEKEMDLFIHDLLKELNDKEPTKAEVADK------KKEILEKYDLDKDGRFSMDELENILPVEPNLLRTYLSEGKRIGSVDFMKIFTRFDEDKSGFLETVELRGFFHELLSMKGKSS--INPRKLDDYIEYCLEKYDANKDGKFNLNELAKMLPLEENIF------ETYGIKRDMTREDFNKVWDYYDKDNSGEIEGDEILALLHDVLK-QQQPDREYNKPDLERFRDIILEIYDENKDNKLSRDELCCLLS 265          

HSP 2 Score: 50.447 bits (119), Expect = 3.460e-7
Identity = 33/93 (35.48%), Postives = 52/93 (55.91%), Query Frame = 2
Query:  707 MLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLM------ELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQHSKL 967
            M +   K+S +E  ++F  +D D+NG+++E EM   + DL+      E T+    DKK E     IL ++D++KDG+ SM EL+ IL     L
Sbjct:    1 MADKATKLSPVEFVKVFMKFDSDKNGYIEEKEMDLFIHDLLKELNDKEPTKAEVADKKKE-----ILEKYDLDKDGRFSMDELENILPVEPNL 88          
BLAST of Calbindin-32 vs. Ensembl Nematostella
Match: EDO45965 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRJ5])

HSP 1 Score: 122.094 bits (305), Expect = 1.944e-33
Identity = 67/164 (40.85%), Postives = 104/164 (63.41%), Query Frame = 2
Query:  155 KFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGK 646
            K T+ QF D++  +D D N  I+A ELD FL         + + +   + +   A+K   LE YD N DG I++ EL+Q LP +E FLV F+++N I SSV+FMKI+K++D D+SG+IE  EL+ F+ +LL  ++K+   +  S+I  + + M+++FDRN DGK
Sbjct:   21 KLTSEQFYDIFKKYDADGNDCIDAKELDLFL---------QDVQKADPNATNLDALKNEILEKYDANYDGVIQMSELAQCLPLEENFLVGFRKDNVI-SSVDFMKIFKKYDTDKSGYIEVPELKVFLMDLLDADKKA---ISPSRINDYASAMIEIFDRNKDGK 171          

HSP 2 Score: 84.7297 bits (208), Expect = 1.695e-19
Identity = 47/157 (29.94%), Postives = 94/157 (59.87%), Query Frame = 2
Query:  449 SSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGK 919
            +S +F  I+K++D D +  I+A EL  F+ ++ K +  +      + +    N +L+ +D N DG +Q+SE+A+ LP++EN+L     +N   IS ++  +IFK YD D++G+++  E++  L+DL++  ++     ++  + + ++  +D NKDGK
Sbjct:   23 TSEQFYDIFKKYDADGNDCIDAKELDLFLQDVQKADPNA------TNLDALKNEILEKYDANYDGVIQMSELAQCLPLEENFLVGFRKDNV--ISSVDFMKIFKKYDTDKSGYIEVPELKVFLMDLLDADKKAISPSRINDYASAMIEIFDRNKDGK 171          
BLAST of Calbindin-32 vs. Ensembl Nematostella
Match: EDO45966 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRJ6])

HSP 1 Score: 112.849 bits (281), Expect = 3.768e-29
Identity = 77/257 (29.96%), Postives = 129/257 (50.19%), Query Frame = 2
Query:  182 VWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKF-QNVILSEWDVNKDGKISMKELKMIL 949
            +++ FD D NG+I+A ELD+F+         + I    LS+    + K   L   DEN D +I   EL ++LPT   F+  F         V+F+KIWK +DKD SGF+E  ELQ F+ EL   N+   ++++E +   F  I+L       DGK  + + + +  +        +  N       + +  F  YD D +G ++  E++ L  DL+++ +    ++ ++ + Q+V++ + D NKD KI   ELK  L
Sbjct:   24 IFSKFDKDGNGFIDAKELDSFI---------KDICNNELSEDDVASFKTGLLAKLDENNDNKISKKELRKVLPTKSNFMRQFLTTKEFCQ-VDFIKIWKNYDKDGSGFLEKPELQLFLEELFAVNKTPGQRIDEKEREKFQTILL-------DGKEGVDKKSLMKHLGVKAACDEVAANAMDWKQADFDEKFAKYDKDNSGCIESGELEVLFRDLLKINDADITEEDVKDYVQSVVMPDLDKNKDNKIQKDELKSYL 263          

HSP 2 Score: 53.1434 bits (126), Expect = 4.198e-8
Identity = 47/177 (26.55%), Postives = 82/177 (46.33%), Query Frame = 2
Query:  158 FTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPIS-SSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMK 685
            F    F+ +W ++D D +G++E  EL  FL +     +++  G+ +  +   +   QT L    E  D +  +  L      DE         N +     +F + + ++DKD SG IE+ EL+    +LLK N   A+  EE    Y  ++++   D+N D K+Q  E+   L +K
Sbjct:  102 FCQVDFIKIWKNYDKDGSGFLEKPELQLFLEELFA--VNKTPGQRIDEKE--REKFQTILLDGKEGVDKKSLMKHLGVKAACDE------VAANAMDWKQADFDEKFAKYDKDNSGCIESGELEVLFRDLLKIN--DADITEEDVKDYVQSVVMPDLDKNKDNKIQKDELKSYLKIK 266          
BLAST of Calbindin-32 vs. Ensembl Nematostella
Match: EDO46016 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRJ4])

HSP 1 Score: 70.8626 bits (172), Expect = 1.018e-13
Identity = 48/168 (28.57%), Postives = 86/168 (51.19%), Query Frame = 2
Query:  470 IWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDL---MELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQHSK 964
            IW R+D +R G +   +L+ F+ + +K      +K+    I       L   D++  G++ L EMAR L +++N+L +  +N   K+   +  RI+  YD D  G +   E+ AL+ D+   ++      DD  +EK++++I+   D + DG IS +EL +   Q  K
Sbjct:  170 IWNRYDVNREGSLSTEQLKGFINDSMK-----GQKLSSKNIGMLVKKTLDAVDKDRSGEVDLEEMARYLKVEDNFLREFNINPGQKLKQNDFSRIWDNYDQDGKGSIKGAELDALIRDVFAKIQGRSPEMDD--IEKWKDIIMMFADADGDGAISKEELNIFFAQGLK 330          

HSP 2 Score: 52.373 bits (124), Expect = 1.294e-7
Identity = 38/180 (21.11%), Postives = 85/180 (47.22%), Query Frame = 2
Query:  131 RENDNQLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISS--SVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEM 664
            +E D  ++     ++  +WN +D +  G +   +L  F        I++ +  + LS      + +  L+A D++  G +++ E+++ L  ++ FL  F   NP       +F +IW  +D+D  G I+  EL   + ++    Q  + ++++  I  + +I++   D + DG +   E+
Sbjct:  153 KELDRFVDDLFVRRYGTIWNRYDVNREGSLSTEQLKGF--------INDSMKGQKLSSKNIGMLVKKTLDAVDKDRSGEVDLEEMARYLKVEDNFLREFNI-NPGQKLKQNDFSRIWDNYDQDGKGSIKGAELDALIRDVFAKIQGRSPEMDD--IEKWKDIIMMFADADGDGAISKEEL 321          
BLAST of Calbindin-32 vs. Ensembl Nematostella
Match: EDO32744 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU70])

HSP 1 Score: 51.2174 bits (121), Expect = 1.020e-7
Identity = 48/166 (28.92%), Postives = 77/166 (46.39%), Query Frame = 2
Query:  458 EFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLE-LERIFKAYDVDRNGFMDETEM----QALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELK 940
            E  K +K F KD      + EL++   E  K  Q+     + +K   F   + K+FDRN DG +   E    L +            T + S  E LE  F  YD+D+NG++   EM    QA+   +  + + P D+   EK  + I  + D N+DG+++M+E +
Sbjct:   26 ELQKWYKDFMKD----CPSGELRQEAKEFQKIYQQFFPFGDPTK---FAAFVFKVFDRNEDGCISFKEFITALSI------------TSRGSLDEKLEWAFSLYDLDKNGYITRDEMLSIVQAIYCMVGNIIDLPRDEDTPEKRVDKIFKQMDKNEDGRLTMEEFR 172          
BLAST of Calbindin-32 vs. Ensembl Medaka
Match: ENSORLT00000016338.2 (calretinin [Source:NCBI gene;Acc:101174993])

HSP 1 Score: 214.542 bits (545), Expect = 1.391e-67
Identity = 117/270 (43.33%), Postives = 174/270 (64.44%), Query Frame = 2
Query:  146 QLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQ 955
             L + TA+QFLD+W HFD D NGYIE  EL+NF  +  TS     +     S   F+   + F++ +D+N DGRIE+ EL+QILPT+E FL+ F++   +SSS EFM  W+R+D DRSG+IEANEL+ F+++LL   +K+    +E K+  +T  +L++FD N DGKL LSEMARLLP++EN+L K       K++  +   IF  YD D NG++DE E++ALL DL +  ++  D K L  ++  I+S   ++  GK+   EL+++L +
Sbjct:   12 HLAEVTASQFLDIWKHFDVDGNGYIEGKELENFFRELETSRRGAGVDP---SNPQFREKMREFMQKFDKNRDGRIEMSELAQILPTEENFLLCFRQ--FVSSSAEFMAAWRRYDTDRSGYIEANELKGFLSDLL---EKANRHYDEQKLHEYTQTILRMFDLNGDGKLGLSEMARLLPVQENFLLK---FQGVKLTSEQFNSIFTYYDKDGNGYIDEQELEALLRDLYQTNKKEIDAKSLMSYKESIMS---LSDGGKLYRGELEIVLCK 267          
BLAST of Calbindin-32 vs. Ensembl Medaka
Match: calb2b (calretinin [Source:NCBI gene;Acc:101167606])

HSP 1 Score: 208.379 bits (529), Expect = 3.198e-65
Identity = 111/274 (40.51%), Postives = 174/274 (63.50%), Query Frame = 2
Query:  146 QLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQHSKL 967
            QL + TA QF+D+W HFDTD NGYIE  EL+NF  Q  ++     +     S ++F+   + F+  +D+N DGRIE+ EL+QILPT+E FL+ F+    + SS EFM  W+++D DRSG+IE+NEL+ F+++LLK   K+    ++ ++  +T  +L++FD N DGKL LSEMARLLP++EN+L K       +++  E + +F  YD D NG++DE E+ ALL DL +  +   D   L  ++  I++   ++  GK+   E++++L + S L
Sbjct:   12 QLAELTAAQFIDIWKHFDTDGNGYIEGKELENFFTQLESARRGAGVDP---SHASFKEKMREFMANFDKNSDGRIEMSELAQILPTEENFLLCFRE--FVGSSAEFMNAWRKYDTDRSGYIESNELKGFLSDLLK---KANRIYDDKRLTEYTQTILRMFDLNGDGKLGLSEMARLLPVQENFLLKF---QGIRLTVKEFDSLFTFYDKDGNGYIDEQELDALLKDLCDKNKMDVDATGLVDYKKSIMA---LSDGGKLYRTEMEIVLCRDSML 271          
BLAST of Calbindin-32 vs. Ensembl Medaka
Match: calb2b (calretinin [Source:NCBI gene;Acc:101167606])

HSP 1 Score: 196.438 bits (498), Expect = 1.136e-60
Identity = 109/278 (39.21%), Postives = 171/278 (61.51%), Query Frame = 2
Query:  146 QLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAK----PMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQHSKL 967
            QL + TA QF+D+W HFDTD NGYIE  EL+NF  Q  ++     +     S ++F+   + F+  +D+N DGRIE+ EL+QILPT+E FL+ F+    + SS EFM  W+++D DRSG+IE+NEL+ F+++LLK   K+    ++ ++  +T  +L++FD N DGKL LSEMARLLP++EN+L K    P ++ T  + +            D NG++DE E+ ALL DL +  +   D   L  ++  I++   ++  GK+   E++++L + S L
Sbjct:   12 QLAELTAAQFIDIWKHFDTDGNGYIEGKELENFFTQLESARRGAGVDP---SHASFKEKMREFMANFDKNSDGRIEMSELAQILPTEENFLLCFR--EFVGSSAEFMNAWRKYDTDRSGYIESNELKGFLSDLLK---KANRIYDDKRLTEYTQTILRMFDLNGDGKLGLSEMARLLPVQENFLLKFQKRPPISLTCVLVY-----------QDGNGYIDEQELDALLKDLCDKNKMDVDATGLVDYKKSIMA---LSDGGKLYRTEMEIVLCRDSML 267          
BLAST of Calbindin-32 vs. Ensembl Medaka
Match: ENSORLT00000006100.2 (secretagogin [Source:NCBI gene;Acc:101157482])

HSP 1 Score: 192.586 bits (488), Expect = 5.295e-59
Identity = 104/270 (38.52%), Postives = 167/270 (61.85%), Query Frame = 2
Query:  164 ATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGEL-SQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQK--SAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISF-LELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQHS 961
            A  FL++W HFD D+NGYIE  ELD F       +  +    E  ++   + +K+ F+ AYD   DGR++I EL S ILP +E FL++F RE P+ +SV+FMKIW+++D D SG+I A EL+ F+ +L + + +  S++K+EE     +T+ M+K+FD+N DG+L L+++AR+L +++N+L +  ++ + K     + E+IF  YDV + G ++  E+   + D+MEL        +L+K + V+L   DVN DGKI   EL + L   S
Sbjct:   10 AAGFLEIWQHFDADDNGYIEGKELDEFFHHMMQRLGPQ----EETTEERVRELKERFMSAYDVTADGRLQIQELASMILPEEENFLLIFHREAPLDNSVDFMKIWRKYDADCSGYISAQELKAFLKDLFEQHHREVSSDKLEE-----YTDAMMKIFDKNKDGRLDLNDLARVLALEDNFLLQFHMDASSKEERKRDFEKIFDHYDVSKTGALEGPEVDGFVKDMMELVRPSLSGPELDKLRAVLLHHCDVNNDGKIQKNELALCLGVKS 270          
BLAST of Calbindin-32 vs. Ensembl Medaka
Match: SCGN (secretagogin [Source:NCBI gene;Acc:101170527])

HSP 1 Score: 180.259 bits (456), Expect = 2.422e-54
Identity = 102/280 (36.43%), Postives = 163/280 (58.21%), Query Frame = 2
Query:  140 DNQLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQI-LPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISF---------LELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMIL 949
            D  L+K  A  FL +W +FD D+NGYIE  ELD F            +G + +++   Q +++    A+  + DGR+ I +L+ + LP +E FL+LF++E P+ +SVEFMKIW+++D+D SG+I ANEL+ F+ +L   ++KS   +  SK+  +T  MLK+FD+N  GKL L+++ARLL               Y ++F          + E+IF  YDV + G ++  E+  L++D+MEL +      +L KF+  ++S  D+N+DGKI   EL + L
Sbjct:    2 DGALDKLDAAGFLQIWLYFDKDDNGYIEQKELDAFFKHMLLH-----LGMKDVTEDKIQELRRRC--AHRPSADGRLLIQQLASVMLPEEENFLLLFRQETPLDNSVEFMKIWRKYDEDSSGYISANELKGFLQDLFLQHRKS---ITASKLEEYTVTMLKIFDKNQGGKLDLNDLARLLL-------------GYVVTFQACSREDRNRDFEKIFAHYDVSKTGALEGPEVDGLVMDMMELAKPSISGAELNKFRKALMSHCDINRDGKIQKNELALCL 258          
BLAST of Calbindin-32 vs. Planmine SMEST
Match: SMESG000003798.1 (SMESG000003798.1)

HSP 1 Score: 652.129 bits (1681), Expect = 0.000e+0
Identity = 320/322 (99.38%), Postives = 322/322 (100.00%), Query Frame = 2
Query:   32 MQKSGRINLHSGLELELEDSQKFTDNYLTKYRNRENDNQLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQHSKLGEISTKPYNR 997
            MQKSGRINLHSGLELELEDSQKFTDNYLTKYRNREN+NQLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILS+WDVNKDGKISMKELKMILTQHSKLGEISTKPYNR
Sbjct:    1 MQKSGRINLHSGLELELEDSQKFTDNYLTKYRNRENNNQLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSQWDVNKDGKISMKELKMILTQHSKLGEISTKPYNR 322          
BLAST of Calbindin-32 vs. Planmine SMEST
Match: SMESG000023194.1 (SMESG000023194.1)

HSP 1 Score: 323.553 bits (828), Expect = 6.042e-110
Identity = 156/300 (52.00%), Postives = 224/300 (74.67%), Query Frame = 2
Query:  101 TDNYLTKYRNRENDNQLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQHSKLG---EISTKPY 991
             +N+L+K+R+ +     N FTA QFL+VW H+DTD NGYIE  ELD FL +F +SV+   IG E++S SA   MK+ F+ AYDENED +IEIGEL+Q+LPTDE FL+LF+R+NP+ SSV+FMKIW++FD D SG+IE++EL+EF+  L+  ++ + +++ + K+  ++  +L+LFD N DGKLQLSEMARLLP+KENYL+KP+  N  +I+  +++R+FK YD D+NG ++  E+Q LL DL+EL  E YD++K++ +Q VIL +WD++ DGKI   ELKMIL Q SK+    EI+ K +
Sbjct:    8 VENFLSKFRDSKTRRWTN-FTAKQFLEVWCHYDTDGNGYIEGEELDGFLREFISSVVPGSIGSEIISDSALSDMKEDFMAAYDENEDNKIEIGELAQMLPTDENFLLLFRRDNPLESSVDFMKIWRKFDTDNSGYIESDELKEFLRYLI--SESNVKEISDEKLEEYSYTILQLFDENGDGKLQLSEMARLLPVKENYLSKPLFKNVNRITGYDIDRVFKKYDTDKNGTIENEELQGLLKDLLELAGESYDEEKMKFYQEVILGQWDLDHDGKIGRDELKMILLQQSKMAQEEEIARKSF 304          
BLAST of Calbindin-32 vs. Planmine SMEST
Match: SMESG000055605.1 (SMESG000055605.1)

HSP 1 Score: 320.087 bits (819), Expect = 1.353e-108
Identity = 155/297 (52.19%), Postives = 222/297 (74.75%), Query Frame = 2
Query:   89 SQKFTDNYLTKYRNRENDNQLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMKELKMILTQHSKLGEIS 979
            + KFT N+L +Y++ E   +L  FTATQF +VW+H+D D NGYIE +ELD+FL +F  S++ E I  + L++     +K+ FL+A+D+N D +IE+ EL+Q+LPTDE FL+LF+++ P+ SSVEFMKIWK+FDKD+SGFIEA+EL+ F++E LK   +  E++ E K++ +T+ ML+LFD N DGKLQLSEMARLLP+KENYL +P+  N  KI+ +++E +F  YD D+NG ++  E+Q  L DL+ L +E YD   LE F+ +IL+EWDVN DGKISM ELKM+L Q S+L +++
Sbjct:    3 TTKFT-NFLAQYKDNET-KKLRNFTATQFAEVWSHYDADGNGYIEGSELDSFLSEFIVSILGEDINPDELNKETLSDLKRDFLDAFDQNSDNKIEMSELAQVLPTDEVFLLLFRKDAPLDSSVEFMKIWKQFDKDQSGFIEADELKNFLSEFLK-EARPEEQILEEKLIEYTSTMLQLFDSNKDGKLQLSEMARLLPVKENYLCRPIFKNADKITTVDIENVFHLYDRDKNGTIENEELQGFLKDLLALVQEDYDKDDLEFFRQIILNEWDVNHDGKISMNELKMMLMQQSRLAKLT 296          
BLAST of Calbindin-32 vs. Planmine SMEST
Match: SMESG000043906.1 (SMESG000043906.1)

HSP 1 Score: 208.764 bits (530), Expect = 2.074e-66
Identity = 107/193 (55.44%), Postives = 144/193 (74.61%), Query Frame = 2
Query:  107 NYLTKYRNRENDNQLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGRE----VLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARL 673
            N+L+++R+ +   +L  FTAT+F +VWNH+D D NGYIE  ELD FL +F +SV+SE    E    +LS++A +A+K   +EAYDEN DGRIEI EL+QILP +E FL+LF+R+N + SSV+F+K+W+ FDK++SGFIEANEL+EF+  LLK   K  E   + KI  +T I+L+LFD N DGKLQLSEMARL
Sbjct:    8 NFLSQFRD-QTTKKLQNFTATEFAEVWNHYDKDGNGYIEGDELDLFLKEFVSSVVSENFSEESKEKILSETAMKALKNEIMEAYDENNDGRIEIYELAQILPMEENFLLLFRRDNQLESSVDFIKVWRMFDKNQSGFIEANELKEFLKHLLK-EAKPTEDTPKEKIDEYTKIILQLFDYNKDGKLQLSEMARL 198          

HSP 2 Score: 90.8929 bits (224), Expect = 1.988e-21
Identity = 52/173 (30.06%), Postives = 113/173 (65.32%), Query Frame = 2
Query:  449 SSVEFMKIWKRFDKDRSGFIEANEL----QEFVTELLKNN--QKSAEKV-EESKIVYFTNIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDD---KKLEKFQNVILSEWDVNKDGKISMKEL 937
            ++ EF ++W  +DKD +G+IE +EL    +EFV+ ++  N  ++S EK+  E+ +    N +++ +D N+DG++++ E+A++LPM+EN+L     +N  + S ++  ++++ +D +++GF++  E++  L  L++   +P +D   +K++++  +IL  +D NKDGK+ + E+
Sbjct:   25 TATEFAEVWNHYDKDGNGYIEGDELDLFLKEFVSSVVSENFSEESKEKILSETAMKALKNEIMEAYDENNDGRIEIYELAQILPMEENFLLLFRRDNQLESS-VDFIKVWRMFDKNQSGFIEANELKEFLKHLLK-EAKPTEDTPKEKIDEYTKIILQLFDYNKDGKLQLSEM 195          
BLAST of Calbindin-32 vs. Planmine SMEST
Match: SMESG000043906.1 (SMESG000043906.1)

HSP 1 Score: 204.912 bits (520), Expect = 9.811e-65
Identity = 107/204 (52.45%), Postives = 144/204 (70.59%), Query Frame = 2
Query:  107 NYLTKYRNRENDNQLNKFTATQFLDVWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGRE---------------VLSQSAFQAMKQTFLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKRFDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDRNSDGKLQLSEMARL 673
            N+L+++R++    +L  FTAT+F +VWNH+D D NGYIE  ELD FL +F +SV+SE    E               +LS++A +A+K   +EAYDEN DGRIEI EL+QILP +E FL+LF+R+N + SSV+F+K+W+ FDK++SGFIEANEL+EF+  LLK   K  E   + KI  +T I+L+LFD N DGKLQLSEMARL
Sbjct:    8 NFLSQFRDQ-TTKKLQNFTATEFAEVWNHYDKDGNGYIEGDELDLFLKEFVSSVVSENFSEESKELNKSESQGESSKILSETAMKALKNEIMEAYDENNDGRIEIYELAQILPMEENFLLLFRRDNQLESSVDFIKVWRMFDKNQSGFIEANELKEFLKHLLK-EAKPTEDTPKEKIDEYTKIILQLFDYNKDGKLQLSEMARL 209          

HSP 2 Score: 88.9669 bits (219), Expect = 1.540e-20
Identity = 55/184 (29.89%), Postives = 113/184 (61.41%), Query Frame = 2
Query:  449 SSVEFMKIWKRFDKDRSGFIEANEL----QEFVTELLKNN--------QKSAEKVEESKIVYFT------NIMLKLFDRNSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRNGFMDETEMQALLVDLMELTEEPYDD---KKLEKFQNVILSEWDVNKDGKISMKEL 937
            ++ EF ++W  +DKD +G+IE +EL    +EFV+ ++  N         KS  + E SKI+  T      N +++ +D N+DG++++ E+A++LPM+EN+L     +N  + S ++  ++++ +D +++GF++  E++  L  L++   +P +D   +K++++  +IL  +D NKDGK+ + E+
Sbjct:   25 TATEFAEVWNHYDKDGNGYIEGDELDLFLKEFVSSVVSENFSEESKELNKSESQGESSKILSETAMKALKNEIMEAYDENNDGRIEIYELAQILPMEENFLLLFRRDNQLESS-VDFIKVWRMFDKNQSGFIEANELKEFLKHLLK-EAKPTEDTPKEKIDEYTKIILQLFDYNKDGKLQLSEM 206          
The following BLAST results are available for this feature:
BLAST of Calbindin-32 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CALB24.292e-6441.09calbindin 2 [Source:HGNC Symbol;Acc:HGNC:1435][more]
CALB24.292e-6441.09calbindin 2 [Source:HGNC Symbol;Acc:HGNC:1435][more]
SCGN1.861e-6038.66secretagogin, EF-hand calcium binding protein [Sou... [more]
CALB11.220e-5639.25calbindin 1 [Source:HGNC Symbol;Acc:HGNC:1434][more]
CALB22.169e-5344.60calbindin 2 [Source:HGNC Symbol;Acc:HGNC:1435][more]
back to top
BLAST of Calbindin-32 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calbindin-32 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cbp53E3.711e-8644.98gene:FBgn0004580 transcript:FBtr0340072[more]
Cbp53E3.711e-8644.98gene:FBgn0004580 transcript:FBtr0087056[more]
Nca5.810e-726.45gene:FBgn0013303 transcript:FBtr0074902[more]
Nox2.746e-619.80gene:FBgn0085428 transcript:FBtr0344889[more]
Nox2.765e-619.80gene:FBgn0085428 transcript:FBtr0345379[more]
back to top
BLAST of Calbindin-32 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calb2a7.614e-6943.43calbindin 2a [Source:ZFIN;Acc:ZDB-GENE-040426-1677... [more]
scgn6.522e-6438.27secretagogin, EF-hand calcium binding protein [Sou... [more]
scgn6.522e-6438.27secretagogin, EF-hand calcium binding protein [Sou... [more]
calb2b3.304e-6342.07calbindin 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1668... [more]
calb13.439e-5740.53calbindin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-8107][more]
back to top
BLAST of Calbindin-32 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scgn1.985e-6238.97secretagogin, EF-hand calcium binding protein [Sou... [more]
scgn2.319e-5938.01secretagogin, EF-hand calcium binding protein [Sou... [more]
gata51.236e-5246.77GATA binding protein 5 [Source:Xenbase;Acc:XB-GENE... [more]
stim14.792e-5239.77stromal interaction molecule 1 [Source:Xenbase;Acc... [more]
stim13.704e-5136.81stromal interaction molecule 1 [Source:Xenbase;Acc... [more]
back to top
BLAST of Calbindin-32 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Calb24.218e-6341.48calbindin 2 [Source:MGI Symbol;Acc:MGI:101914][more]
Calb27.133e-6145.65calbindin 2 [Source:MGI Symbol;Acc:MGI:101914][more]
Calb13.886e-5638.87calbindin 1 [Source:MGI Symbol;Acc:MGI:88248][more]
Scgn9.121e-5134.83secretagogin, EF-hand calcium binding protein [Sou... [more]
Scgn1.319e-1837.17secretagogin, EF-hand calcium binding protein [Sou... [more]
back to top
BLAST of Calbindin-32 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P41044|CAB32_DROME3.720e-8544.98Calbindin-32 OS=Drosophila melanogaster OX=7227 GN... [more]
sp|P07090|CALB2_CHICK7.637e-6543.07Calretinin OS=Gallus gallus OX=9031 GN=CALB2 PE=2 ... [more]
sp|P22676|CALB2_HUMAN2.061e-6341.09Calretinin OS=Homo sapiens OX=9606 GN=CALB2 PE=2 S... [more]
sp|Q5XJX1|SEGN_DANRE4.924e-6338.27Secretagogin OS=Danio rerio OX=7955 GN=scgn PE=1 S... [more]
sp|Q63ZJ3|SEGN_XENLA6.187e-6339.71Secretagogin OS=Xenopus laevis OX=8355 GN=scgn PE=... [more]
back to top
BLAST of Calbindin-32 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GD681.585e-10954.92Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GV221.655e-10954.92Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FNU41.692e-10954.92Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G6Z81.385e-10754.17Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GV541.528e-10754.17Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Calbindin-32 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calb2a1.065e-6643.80calretinin [Source:NCBI gene;Acc:103033342][more]
scgn1.391e-6440.81secretagogin, EF-hand calcium binding protein [Sou... [more]
calb2b2.693e-5941.39calretinin-like [Source:NCBI gene;Acc:103034108][more]
calb13.028e-5840.75calbindin 1 [Source:NCBI gene;Acc:103033937][more]
calb2b7.686e-5842.07calretinin-like [Source:NCBI gene;Acc:103034108][more]
back to top
BLAST of Calbindin-32 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
scgn5.143e-5937.17secretagogin, EF-hand calcium binding protein [Sou... [more]
CALB21.991e-2340.82calbindin 2 [Source:HGNC Symbol;Acc:HGNC:1435][more]
ENSPMAT00000000059.11.104e-2251.95pep scaffold:Pmarinus_7.0:GL485405:3181:11335:1 ge... [more]
ENSPMAT00000001806.16.431e-1148.15pep scaffold:Pmarinus_7.0:GL476330:305753:307416:1... [more]
back to top
BLAST of Calbindin-32 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calbindin-32 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO459676.425e-4134.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459651.944e-3340.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459663.768e-2929.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460161.018e-1328.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO327441.020e-728.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calbindin-32 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000016338.21.391e-6743.33calretinin [Source:NCBI gene;Acc:101174993][more]
calb2b3.198e-6540.51calretinin [Source:NCBI gene;Acc:101167606][more]
calb2b1.136e-6039.21calretinin [Source:NCBI gene;Acc:101167606][more]
ENSORLT00000006100.25.295e-5938.52secretagogin [Source:NCBI gene;Acc:101157482][more]
SCGN2.422e-5436.43secretagogin [Source:NCBI gene;Acc:101170527][more]
back to top
BLAST of Calbindin-32 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003798.10.000e+099.38SMESG000003798.1[more]
SMESG000023194.16.042e-11052.00SMESG000023194.1[more]
SMESG000055605.11.353e-10852.19SMESG000055605.1[more]
SMESG000043906.12.074e-6655.44SMESG000043906.1[more]
SMESG000043906.19.811e-6552.45SMESG000043906.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032335 ID=SMED30032335|Name=Calbindin-32|organism=Schmidtea mediterranea sexual|type=transcript|length=1067bp
GGAAAATAAATGTTAAGAAAATGAAACAGAAATGCAAAAATCAGGGAGAA
TCAATTTGCACAGTGGCCTTGAGTTGGAGCTAGAAGATTCCCAGAAATTC
ACCGACAATTACCTGACAAAGTATAGAAATAGGGAAAATGATAATCAGCT
GAATAAGTTCACCGCTACCCAATTTTTAGACGTTTGGAATCATTTCGATA
CTGATAATAATGGTTACATTGAGGCGGCAGAATTGGACAATTTCCTCATT
CAATTTGCTACTAGTGTCATTAGTGAGCCCATCGGACGTGAAGTTCTCTC
TCAATCGGCTTTTCAAGCCATGAAGCAAACTTTCTTAGAAGCCTACGATG
AAAATGAAGATGGCAGAATCGAAATTGGAGAATTATCCCAAATTTTACCA
ACAGATGAAGAATTTCTTGTTTTATTTCAAAGAGAAAATCCAATTTCATC
AAGTGTAGAATTTATGAAGATTTGGAAAAGATTTGATAAAGACCGTAGCG
GTTTTATTGAGGCTAATGAGTTGCAAGAATTTGTGACAGAACTGTTGAAG
AACAATCAAAAAAGTGCTGAAAAGGTTGAAGAATCCAAAATTGTGTATTT
TACTAATATAATGTTGAAATTATTTGACCGAAATTCTGACGGAAAACTAC
AACTGAGTGAGATGGCGAGGCTCCTTCCGATGAAAGAAAACTACCTGGCT
AAACCAATGTTAAATAATACTTATAAAATTTCATTTTTGGAATTAGAAAG
AATTTTTAAGGCATATGATGTTGACAGAAACGGGTTTATGGATGAAACAG
AAATGCAAGCTTTACTTGTTGATCTCATGGAGCTAACTGAGGAACCGTAT
GATGACAAGAAGCTGGAAAAATTTCAAAATGTCATTTTGTCTGAGTGGGA
TGTAAATAAAGATGGAAAAATAAGCATGAAAGAATTGAAAATGATTTTAA
CTCAGCACAGTAAACTTGGTGAAATCTCCACAAAGCCTTACAATCGCATC
ATTTTGAAGAATGACATAAAAAAGTTGATATAAATGTTTGGAAACAATAA
CAAATGTTGTCATTACA
back to top

protein sequence of SMED30032335-orf-1

>SMED30032335-orf-1 ID=SMED30032335-orf-1|Name=SMED30032335-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=334bp
MQKSGRINLHSGLELELEDSQKFTDNYLTKYRNRENDNQLNKFTATQFLD
VWNHFDTDNNGYIEAAELDNFLIQFATSVISEPIGREVLSQSAFQAMKQT
FLEAYDENEDGRIEIGELSQILPTDEEFLVLFQRENPISSSVEFMKIWKR
FDKDRSGFIEANELQEFVTELLKNNQKSAEKVEESKIVYFTNIMLKLFDR
NSDGKLQLSEMARLLPMKENYLAKPMLNNTYKISFLELERIFKAYDVDRN
GFMDETEMQALLVDLMELTEEPYDDKKLEKFQNVILSEWDVNKDGKISMK
ELKMILTQHSKLGEISTKPYNRIILKNDIKKLI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000484secretory system
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR002048EF_hand_dom
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002048EF-hand domainSMARTSM00054efh_1coord: 190..218
e-value: 5.0
score: 12.1
coord: 281..309
e-value: 4.7
score: 12.4
coord: 47..75
e-value: 0.0046
score: 26.2
coord: 96..125
e-value: 76.0
score: 2.6
coord: 237..265
e-value: 0.0023
score: 27.2
coord: 143..171
e-value: 6.1E-6
score: 35.7
IPR002048EF-hand domainPFAMPF13202EF-hand_5coord: 101..121
e-value: 0.068
score: 12.7
IPR002048EF-hand domainPFAMPF13499EF-hand_7coord: 145..213
e-value: 1.6E-7
score: 31.7
coord: 237..303
e-value: 2.0E-8
score: 34.5
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 139..174
score: 13.872
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 43..78
score: 11.082
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 93..128
score: 7.54
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 194..221
score: 7.763
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 276..312
score: 9.827
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 233..268
score: 12.114
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 32..111
e-value: 9.9E-18
score: 66.0
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 114..218
e-value: 6.7E-23
score: 82.6
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 232..310
e-value: 1.5E-18
score: 68.6
NoneNo IPR availablePANTHERPTHR19972CALBINDINcoord: 32..314
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 56..68
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 246..258
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 290..302
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 152..164
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 106..118
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 199..211
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 143..309
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 37..174