Tensin 1

Overview
NameTensin 1
Smed IDSMED30032325
Length (bp)3397
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tensin 1 (SMED30032325) t-SNE clustered cells

Violin plots show distribution of expression levels for Tensin 1 (SMED30032325) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tensin 1 (SMED30032325) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tensin 1 (SMED30032325) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032325

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30032325SMESG000029243.1 dd_Smed_v4_17717_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30032325SMESG000029243.1 dd_Smed_v4_17717_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30032325SMESG000029243.1 dd_Smed_v4_17717_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032325SMESG000029243.1 Contig15768newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032325SMESG000029243.1 Contig15768uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
dorsal-ventral muscle cellSMED30032325SMESG000029243.1 dd_Smed_v4_17717_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tensin 1 vs. Ensembl Human
Match: TNS3 (tensin 3 [Source:HGNC Symbol;Acc:HGNC:21616])

HSP 1 Score: 85.8853 bits (211), Expect = 3.623e-16
Identity = 76/273 (27.84%), Postives = 126/273 (46.15%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTS------IFNSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYS-LTSDLNDFQVIYLGSFILSNTTENATIASA--IDKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFA 3276
            T   WY+   +R+ A   L +K  G+F++R S S   +  +A+K +T       +        ++ ++HF+I+   +G R++G  NE Y+ +L  LV  H+   L LPC L++PE +  ++    +    A   + L        V YL S  + + T +  I  A  I  +QE     P+S        ++ K     I  TD ++K F R++   N +I+C +DP+ R W  IK          P S +FG V++      +D V C LFA
Sbjct: 1168 TSKFWYKADISREQAIAMLKDKEPGSFIVRDSHSFRGAYGLAMKVATPPPSVLQLNKKAGDLANELVRHFLIECTPKGVRLKGCSNEPYFGSLTALVCQHSITPLALPCKLLIPERDPLEEIAESSPQTAANSAAELLKQGAACNVWYLNSVEMESLTGHQAIQKALSITLVQEP---PPVS------TVVHFKVSAQGITLTDNQRKLFFRRHYPVNSVIFCALDPQDRKW--IKDG--------PSSKVFGFVAR-KQGSATDNV-CHLFA 1419          

HSP 2 Score: 66.2402 bits (160), Expect = 3.517e-10
Identity = 54/192 (28.12%), Postives = 91/192 (47.40%), Query Frame = 1
Query: 1096 FYEKLHLEKFINSSLKRYVATISSISFGILQYNSNPKQLHFIIIKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILIMA-NVLNRSNLQYIYFRIQLHTCWINGSSLVFKNSELD-KSRDCSSQFPD--SVELLFKPNPVIVKDHENM 1659
            FY+   +   +  S KRYV  +S +  G ++ N++P  LHF+I+         T   +T              +   F+ +YQ    +YTS    +  E   ++I  VI+P   + GD+++   +   RS  + + FR+Q HT  + G  LVF   +LD  S+D   +FPD   VEL+F   P  ++  E++
Sbjct:  143 FYDD-KVSALMQPSQKRYVQFLSGLLSGSVKMNASPLFLHFVILHG-------TPNFDTGG------------VCRPFLKLYQAMQPVYTSGIYNVGPEN-PSRICIVIEPAQLLKGDVMVKCYHKKYRSATRDVIFRLQFHTGAVQGYGLVFGKEDLDNASKD--DRFPDYGKVELVFSATPEKIQGSEHL 311          
BLAST of Tensin 1 vs. Ensembl Human
Match: TNS2 (tensin 2 [Source:HGNC Symbol;Acc:HGNC:19737])

HSP 1 Score: 77.7962 bits (190), Expect = 1.122e-13
Identity = 83/310 (26.77%), Postives = 136/310 (43.87%), Query Frame = 1
Query: 2419 NDNLLYDNLPPKQS-----KVIIDAITTQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNST---NSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDL--NDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNK-LNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATINCNSEELCAIV 3315
            +DN+     PP Q      K + D   T   WY+ + +R  A   L +K  G F+IR S S   +  +ALK +T   ++        ++ ++HF+I+   +G +I+G  +E Y+ +L  LV  H+ + + LPC L +P     D            + S  +DL      V+YL S      TE+ T   A+ +         +S +  P    ++ K     I  TD ++K F R++   N I +   DP+ R W N   +  +SK       IFG V+K       +   C LFA ++ + +   AIV
Sbjct: 1112 SDNVPQTPEPPTQESQSNVKFVQD---TSKFWYKPHLSRDQAIALLKDKDPGAFLIRDSHSFQGAYGLALKVATPPPSAQPWKGDPVEQLVRHFLIETGPKGVKIKGCPSEPYFGSLSALVSQHSISPISLPCCLRIPSK---DPLEETPEAPVPTNMSTAADLLRQACSVLYLTSV----ETESLTGPQAVARASSAA----LSCSPRPTPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGT--TSK-------IFGFVAKKPGSPWENV--CHLFAELDPD-QPAGAIV 1395          

HSP 2 Score: 72.4034 bits (176), Expect = 4.701e-12
Identity = 55/232 (23.71%), Postives = 104/232 (44.83%), Query Frame = 1
Query: 1126 INSSLKRYVATISSISFGILQYNSNPKQLHFIIIKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILIMA-NVLNRSNLQYIYFRIQLHTCWINGSSLVFKNSELDKS-RDCSSQFPDSVELLFKPNPVIVKD---HENMLLSEKYSMSNQRISAVNIFEQIKILDQTIKKSKLSYQVGPLNGNIYASI 1806
            +  S +RY++  S +  G ++ NS+P  LH+++I  +      T                       F+ +YQ+  L+YTS    ++      Q+   ++P L + GD+++   +   R   + + FR+Q HTC I+G  L F   +LD++  D    F  SVE +F  +P  +K      +  +S  Y+ +   +   + +E      +      L++  GPL+G+ YA +
Sbjct:  276 LQPSQRRYISYFSGLLSGSIRMNSSPLFLHYVLIPMLPAFEPGTGF-------------------QPFLKIYQSMQLVYTSGVYHIAGPG-PQQLCISLEPALLLKGDVMVTCYHKGGRGTDRTLVFRVQFHTCTIHGPQLTFPKDQLDEAWTDERFPFQASVEFVFSSSPEKIKGSTPRNDPSVSVDYNTTEPAVR-WDSYENFNQHHEDSVDGSLTHTRGPLDGSPYAQV 486          
BLAST of Tensin 1 vs. Ensembl Human
Match: TNS1 (tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973])

HSP 1 Score: 77.411 bits (189), Expect = 1.516e-13
Identity = 77/301 (25.58%), Postives = 135/301 (44.85%), Query Frame = 1
Query: 2431 LYDNLPPKQSKVIIDAITTQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIF-----NSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDLNDFQVIYLGSFILSNTTENATIASAIDKL-QEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATINCNSEELCAIV 3315
            + DN P  ++KV     T+++ WY+   +R+ A   L ++  G F+IR S S   +  +A+K S+        N       + ++HF+I+    G +++G  NE  + +L  LV  H+   L LPC L++P  +  D+     + + +   + T+DL          F+ S   E+ T   AI K   E     P       H K++ +     I  TD ++K F R++   N + +C +DP+ R W   +    +         +FG V++   Q  +    C LFA ++ N +   AIV
Sbjct: 1442 MPDNSPETRAKVKFVQDTSKY-WYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFLIETGPRGVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIPNRDPTDE-----SKDSSGPANSTADLLKQGAACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKVSAQG----ITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKWMKTEGGAPAK--------LFGFVAR--KQGSTTDNACHLFAELDPN-QPASAIV 1721          

HSP 2 Score: 56.6102 bits (135), Expect = 3.795e-7
Identity = 63/247 (25.51%), Postives = 114/247 (46.15%), Query Frame = 1
Query: 1096 FYEKLHLEKFINSSLKRYVATISSISFGILQYNSNPKQLHFIIIKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILIMA-NVLNRSNLQYIYFRIQLHTCWINGSSLVFKNSELDKS-RDCSSQFPD--SVELLFKPNPVIVKDHENM----LLSEKYSMSNQ--RISAVNIFEQIKILDQTIKKSKLSYQVGPLNGNIYASI 1806
            FYE   +      S +RYV   S +  G ++ N+ P  LH +I+  +       SK          C          F+ +YQ    +YTS    +  + + + +   I+P L + GDIL+   +   RS  + + FR+Q HTC I+   +VF   +LD + +D   +FP+   VE +F   P  ++  E++     +S  Y+ S+   R  + + F   +  D  +++  + +  GPL+G++YA +
Sbjct:  149 FYED-KIVPIGQPSQRRYVHYFSGLLSGSIKMNNKPLFLHHVIMHGIP---NFESKGG--------CR--------PFLRIYQAMQPVYTSGIYNIPGDSQTS-VCITIEPGLLLKGDILLKCYHKKFRSPARDVIFRVQFHTCAIHDLGVVFGKEDLDDAFKD--DRFPEYGKVEFVFSYGPEKIQGMEHLENGPSVSVDYNTSDPLIRWDSYDNFSGHR--DDGMEE-VVGHTQGPLDGSLYAKV 369          
BLAST of Tensin 1 vs. Ensembl Human
Match: TNS1 (tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973])

HSP 1 Score: 77.411 bits (189), Expect = 1.586e-13
Identity = 77/301 (25.58%), Postives = 135/301 (44.85%), Query Frame = 1
Query: 2431 LYDNLPPKQSKVIIDAITTQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIF-----NSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDLNDFQVIYLGSFILSNTTENATIASAIDKL-QEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATINCNSEELCAIV 3315
            + DN P  ++KV     T+++ WY+   +R+ A   L ++  G F+IR S S   +  +A+K S+        N       + ++HF+I+    G +++G  NE  + +L  LV  H+   L LPC L++P  +  D+     + + +   + T+DL          F+ S   E+ T   AI K   E     P       H K++ +     I  TD ++K F R++   N + +C +DP+ R W   +    +         +FG V++   Q  +    C LFA ++ N +   AIV
Sbjct: 1534 MPDNSPETRAKVKFVQDTSKY-WYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFLIETGPRGVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIPNRDPTDE-----SKDSSGPANSTADLLKQGAACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKVSAQG----ITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKWMKTEGGAPAK--------LFGFVAR--KQGSTTDNACHLFAELDPN-QPASAIV 1813          

HSP 2 Score: 56.6102 bits (135), Expect = 3.122e-7
Identity = 63/247 (25.51%), Postives = 114/247 (46.15%), Query Frame = 1
Query: 1096 FYEKLHLEKFINSSLKRYVATISSISFGILQYNSNPKQLHFIIIKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILIMA-NVLNRSNLQYIYFRIQLHTCWINGSSLVFKNSELDKS-RDCSSQFPD--SVELLFKPNPVIVKDHENM----LLSEKYSMSNQ--RISAVNIFEQIKILDQTIKKSKLSYQVGPLNGNIYASI 1806
            FYE   +      S +RYV   S +  G ++ N+ P  LH +I+  +       SK          C          F+ +YQ    +YTS    +  + + + +   I+P L + GDIL+   +   RS  + + FR+Q HTC I+   +VF   +LD + +D   +FP+   VE +F   P  ++  E++     +S  Y+ S+   R  + + F   +  D  +++  + +  GPL+G++YA +
Sbjct:  249 FYED-KIVPIGQPSQRRYVHYFSGLLSGSIKMNNKPLFLHHVIMHGIP---NFESKGG--------CR--------PFLRIYQAMQPVYTSGIYNIPGDSQTS-VCITIEPGLLLKGDILLKCYHKKFRSPARDVIFRVQFHTCAIHDLGVVFGKEDLDDAFKD--DRFPEYGKVEFVFSYGPEKIQGMEHLENGPSVSVDYNTSDPLIRWDSYDNFSGHR--DDGMEE-VVGHTQGPLDGSLYAKV 469          
BLAST of Tensin 1 vs. Ensembl Human
Match: TNS1 (tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973])

HSP 1 Score: 77.411 bits (189), Expect = 1.592e-13
Identity = 77/301 (25.58%), Postives = 135/301 (44.85%), Query Frame = 1
Query: 2431 LYDNLPPKQSKVIIDAITTQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIF-----NSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDLNDFQVIYLGSFILSNTTENATIASAIDKL-QEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATINCNSEELCAIV 3315
            + DN P  ++KV     T+++ WY+   +R+ A   L ++  G F+IR S S   +  +A+K S+        N       + ++HF+I+    G +++G  NE  + +L  LV  H+   L LPC L++P  +  D+     + + +   + T+DL          F+ S   E+ T   AI K   E     P       H K++ +     I  TD ++K F R++   N + +C +DP+ R W   +    +         +FG V++   Q  +    C LFA ++ N +   AIV
Sbjct: 1567 MPDNSPETRAKVKFVQDTSKY-WYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFLIETGPRGVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIPNRDPTDE-----SKDSSGPANSTADLLKQGAACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKVSAQG----ITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKWMKTEGGAPAK--------LFGFVAR--KQGSTTDNACHLFAELDPN-QPASAIV 1846          

HSP 2 Score: 57.3806 bits (137), Expect = 2.140e-7
Identity = 63/247 (25.51%), Postives = 114/247 (46.15%), Query Frame = 1
Query: 1096 FYEKLHLEKFINSSLKRYVATISSISFGILQYNSNPKQLHFIIIKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILIMA-NVLNRSNLQYIYFRIQLHTCWINGSSLVFKNSELDKS-RDCSSQFPD--SVELLFKPNPVIVKDHENM----LLSEKYSMSNQ--RISAVNIFEQIKILDQTIKKSKLSYQVGPLNGNIYASI 1806
            FYE   +      S +RYV   S +  G ++ N+ P  LH +I+  +       SK          C          F+ +YQ    +YTS    +  + + + +   I+P L + GDIL+   +   RS  + + FR+Q HTC I+   +VF   +LD + +D   +FP+   VE +F   P  ++  E++     +S  Y+ S+   R  + + F   +  D  +++  + +  GPL+G++YA +
Sbjct:  295 FYED-KIVPIGQPSQRRYVHYFSGLLSGSIKMNNKPLFLHHVIMHGIP---NFESKGG--------CR--------PFLRIYQAMQPVYTSGIYNIPGDSQTS-VCITIEPGLLLKGDILLKCYHKKFRSPARDVIFRVQFHTCAIHDLGVVFGKEDLDDAFKD--DRFPEYGKVEFVFSYGPEKIQGMEHLENGPSVSVDYNTSDPLIRWDSYDNFSGHR--DDGMEE-VVGHTQGPLDGSLYAKV 515          
BLAST of Tensin 1 vs. Ensembl Celegans
Match: tns-1 (TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L045])

HSP 1 Score: 86.2705 bits (212), Expect = 7.389e-18
Identity = 71/270 (26.30%), Postives = 125/270 (46.30%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDLND----FQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATI 3282
            T   WY+   +R+ A   L +KP G FV+R S S   +  +ALK ST        D  + ++HF+I+ + +G +++G  NE  + +L  LV  H+   L LP  L+LP      DF   +     EH S T  L +      V+Y+GS  + + T N  +  +I    ++  +      D     ++ K  +  +  TD  +K F R++     +I+ G+DP  R ++N ++           + +F  V+++ S   S +  C +FA +
Sbjct:   42 TSKYWYKPTISREQAINMLRDKPPGTFVVRDSNSFPGAFGLALKVSTPPPGVNPGDGSELVRHFLIEPSPKGVKLKGCNNEPVFGSLSALVYQHSITALALPTKLVLP------DF---DPAATPEHLSATQALLEQGAACNVVYVGSVDVESLTGNECVKRSIATCSQRAIN-----GDSRAVSVHFKVSSQGVTLTDNTRKVFFRRHFNVQSVIFAGMDPIERRFENTRALGFHDGCIA-QARLFAFVARIPS---SSENACHVFAEL 293          
BLAST of Tensin 1 vs. Ensembl Celegans
Match: tns-1 (TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L045])

HSP 1 Score: 86.6557 bits (213), Expect = 1.933e-17
Identity = 71/270 (26.30%), Postives = 124/270 (45.93%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDL----NDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATI 3282
            T   WY+   +R+ A   L +KP G FV+R S S   +  +ALK ST        D  + ++HF+I+ + +G +++G  NE  + +L  LV  H+   L LP  L+LP      DF   +     EH S T  L        V+Y+GS  + + T N  +  +I    ++  +      D     ++ K  +  +  TD  +K F R++     +I+ G+DP  R ++N ++           + +F  V+++ S   S +  C +FA +
Sbjct:  142 TSKYWYKPTISREQAINMLRDKPPGTFVVRDSNSFPGAFGLALKVSTPPPGVNPGDGSELVRHFLIEPSPKGVKLKGCNNEPVFGSLSALVYQHSITALALPTKLVLP------DF---DPAATPEHLSATQALLEQGAACNVVYVGSVDVESLTGNECVKRSIATCSQRAIN-----GDSRAVSVHFKVSSQGVTLTDNTRKVFFRRHFNVQSVIFAGMDPIERRFENTRALGFHDGCI-AQARLFAFVARIPS---SSENACHVFAEL 393          
BLAST of Tensin 1 vs. Ensembl Celegans
Match: tns-1 (TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L045])

HSP 1 Score: 86.6557 bits (213), Expect = 1.933e-17
Identity = 71/270 (26.30%), Postives = 124/270 (45.93%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDL----NDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATI 3282
            T   WY+   +R+ A   L +KP G FV+R S S   +  +ALK ST        D  + ++HF+I+ + +G +++G  NE  + +L  LV  H+   L LP  L+LP      DF   +     EH S T  L        V+Y+GS  + + T N  +  +I    ++  +      D     ++ K  +  +  TD  +K F R++     +I+ G+DP  R ++N ++           + +F  V+++ S   S +  C +FA +
Sbjct:  142 TSKYWYKPTISREQAINMLRDKPPGTFVVRDSNSFPGAFGLALKVSTPPPGVNPGDGSELVRHFLIEPSPKGVKLKGCNNEPVFGSLSALVYQHSITALALPTKLVLP------DF---DPAATPEHLSATQALLEQGAACNVVYVGSVDVESLTGNECVKRSIATCSQRAIN-----GDSRAVSVHFKVSSQGVTLTDNTRKVFFRRHFNVQSVIFAGMDPIERRFENTRALGFHDGCI-AQARLFAFVARIPS---SSENACHVFAEL 393          
BLAST of Tensin 1 vs. Ensembl Celegans
Match: tns-1 (TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L045])

HSP 1 Score: 87.4261 bits (215), Expect = 5.127e-17
Identity = 71/270 (26.30%), Postives = 125/270 (46.30%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDLND----FQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATI 3282
            T   WY+   +R+ A   L +KP G FV+R S S   +  +ALK ST        D  + ++HF+I+ + +G +++G  NE  + +L  LV  H+   L LP  L+LP      DF+        EH S T  L +      V+Y+GS  + + T N  +  +I    ++  +      D     ++ K  +  +  TD  +K F R++     +I+ G+DP  R ++N ++           + +F  V+++ S   S +  C +FA +
Sbjct: 1079 TSKYWYKPTISREQAINMLRDKPPGTFVVRDSNSFPGAFGLALKVSTPPPGVNPGDGSELVRHFLIEPSPKGVKLKGCNNEPVFGSLSALVYQHSITALALPTKLVLP------DFDP---AATPEHLSATQALLEQGAACNVVYVGSVDVESLTGNECVKRSIATCSQRAIN-----GDSRAVSVHFKVSSQGVTLTDNTRKVFFRRHFNVQSVIFAGMDPIERRFENTRALGFHDGCIA-QARLFAFVARIPS---SSENACHVFAEL 1330          
BLAST of Tensin 1 vs. Ensembl Celegans
Match: tns-1 (TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L045])

HSP 1 Score: 87.0409 bits (214), Expect = 6.543e-17
Identity = 71/270 (26.30%), Postives = 125/270 (46.30%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDLND----FQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATI 3282
            T   WY+   +R+ A   L +KP G FV+R S S   +  +ALK ST        D  + ++HF+I+ + +G +++G  NE  + +L  LV  H+   L LP  L+LP      DF+        EH S T  L +      V+Y+GS  + + T N  +  +I    ++  +      D     ++ K  +  +  TD  +K F R++     +I+ G+DP  R ++N ++           + +F  V+++ S   S +  C +FA +
Sbjct: 1042 TSKYWYKPTISREQAINMLRDKPPGTFVVRDSNSFPGAFGLALKVSTPPPGVNPGDGSELVRHFLIEPSPKGVKLKGCNNEPVFGSLSALVYQHSITALALPTKLVLP------DFDP---AATPEHLSATQALLEQGAACNVVYVGSVDVESLTGNECVKRSIATCSQRAIN-----GDSRAVSVHFKVSSQGVTLTDNTRKVFFRRHFNVQSVIFAGMDPIERRFENTRALGFHDGCIA-QARLFAFVARIPS---SSENACHVFAEL 1293          
BLAST of Tensin 1 vs. Ensembl Fly
Match: by (gene:FBgn0000244 transcript:FBtr0302382)

HSP 1 Score: 72.7886 bits (177), Expect = 1.270e-12
Identity = 71/280 (25.36%), Postives = 127/280 (45.36%), Query Frame = 1
Query: 2476 AITTQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDLNDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATINCNSEELCAIV 3315
            A ++   WY+   TR+ A   L +   G F++R ST+   S  + ++ S     S      + ++HF+I+    G  ++G  +E  + +L  LV +H+ + L LPC L LP+ +      V       +H  L +      V++L S    + T N  I  AI ++   +   P+        +++ K  +  I  TD  +K F RK+ K + I +C +DP+ R+W +   SD  +        IF  V++ +     +Q  C +F  ++  S+   AIV
Sbjct:  451 ARSSSQFWYKPNLTREDAIALLASAQPGTFLVRDSTTYKDSYGLVVRVSQPPPGS-----QELVRHFLIEPTKGGVHLKGCDDEPVFTSLSALVFEHSISQLALPCLLRLPDRDIVPP--VRATTPAQQH--LLAHGAATNVLWLYSCDTESLTGNEAIRKAIRQM---YGQQPLPQP----TEVHFKVSSQGITLTDNTRKKFFRKHYKADVISHCAIDPENRMWTSEGESDKKT--------IFAFVARRSHSSTDNQ--CHVFCDLSV-SQPAAAIV 703          
BLAST of Tensin 1 vs. Ensembl Fly
Match: by (gene:FBgn0000244 transcript:FBtr0082119)

HSP 1 Score: 72.7886 bits (177), Expect = 1.270e-12
Identity = 71/280 (25.36%), Postives = 127/280 (45.36%), Query Frame = 1
Query: 2476 AITTQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDLNDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATINCNSEELCAIV 3315
            A ++   WY+   TR+ A   L +   G F++R ST+   S  + ++ S     S      + ++HF+I+    G  ++G  +E  + +L  LV +H+ + L LPC L LP+ +      V       +H  L +      V++L S    + T N  I  AI ++   +   P+        +++ K  +  I  TD  +K F RK+ K + I +C +DP+ R+W +   SD  +        IF  V++ +     +Q  C +F  ++  S+   AIV
Sbjct:  451 ARSSSQFWYKPNLTREDAIALLASAQPGTFLVRDSTTYKDSYGLVVRVSQPPPGS-----QELVRHFLIEPTKGGVHLKGCDDEPVFTSLSALVFEHSISQLALPCLLRLPDRDIVPP--VRATTPAQQH--LLAHGAATNVLWLYSCDTESLTGNEAIRKAIRQM---YGQQPLPQP----TEVHFKVSSQGITLTDNTRKKFFRKHYKADVISHCAIDPENRMWTSEGESDKKT--------IFAFVARRSHSSTDNQ--CHVFCDLSV-SQPAAAIV 703          
BLAST of Tensin 1 vs. Ensembl Fly
Match: by (gene:FBgn0000244 transcript:FBtr0301093)

HSP 1 Score: 72.7886 bits (177), Expect = 1.270e-12
Identity = 71/280 (25.36%), Postives = 127/280 (45.36%), Query Frame = 1
Query: 2476 AITTQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDLNDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATINCNSEELCAIV 3315
            A ++   WY+   TR+ A   L +   G F++R ST+   S  + ++ S     S      + ++HF+I+    G  ++G  +E  + +L  LV +H+ + L LPC L LP+ +      V       +H  L +      V++L S    + T N  I  AI ++   +   P+        +++ K  +  I  TD  +K F RK+ K + I +C +DP+ R+W +   SD  +        IF  V++ +     +Q  C +F  ++  S+   AIV
Sbjct:  451 ARSSSQFWYKPNLTREDAIALLASAQPGTFLVRDSTTYKDSYGLVVRVSQPPPGS-----QELVRHFLIEPTKGGVHLKGCDDEPVFTSLSALVFEHSISQLALPCLLRLPDRDIVPP--VRATTPAQQH--LLAHGAATNVLWLYSCDTESLTGNEAIRKAIRQM---YGQQPLPQP----TEVHFKVSSQGITLTDNTRKKFFRKHYKADVISHCAIDPENRMWTSEGESDKKT--------IFAFVARRSHSSTDNQ--CHVFCDLSV-SQPAAAIV 703          
BLAST of Tensin 1 vs. Ensembl Zebrafish
Match: tns3.2 (tensin 3, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-081031-95])

HSP 1 Score: 83.5741 bits (205), Expect = 8.375e-16
Identity = 74/289 (25.61%), Postives = 127/289 (43.94%), Query Frame = 1
Query: 2449 PKQSKVIIDAITTQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSXXXXXXXXXXXXXN------TEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVH----NNFECAEHYSLTSDLNDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNK---LNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFA 3276
            P+  K + D   T   WY+   +R+ A   L +K  G+F+IR S S   +  +A+K +T       +          +  +       +G R++G  NE Y+ +L  LV  H+   L LPC LI+P  +  ++FN      +    AE     +  N   V +LGS  L + T        +  +Q+  T   ++ N  P      ++ K     I  TD ++K F R++   + +I+C +DP+ R WK  +    ++K       IFG +++ +    S +  C LFA
Sbjct:  569 PENVKFVQD---TSKFWYKPDISREQAISVLKDKEPGSFIIRDSHSFRGAYGLAMKVATPPPTVLQTSRKVGDLSNELVRHFLIECTPKGVRLKGCPNEPYFGSLTALVCQHSITPLALPCRLIIPSRDPLEEFNESPTQTSTNSAAELLKQGAACN---VWFLGSVDLESLT-------GVQGVQKATT---VTFNKDPPPTSTVVHFKVSAQGITLTDNQRKLFFRRHYAVSTVIFCALDPQDRKWK--RDGCTAAK-------IFGFIARKSGS--STENVCHLFA 830          
BLAST of Tensin 1 vs. Ensembl Zebrafish
Match: tns1a (tensin 1a [Source:ZFIN;Acc:ZDB-GENE-120215-32])

HSP 1 Score: 81.2629 bits (199), Expect = 5.598e-15
Identity = 78/290 (26.90%), Postives = 121/290 (41.72%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTS---------IFNSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDL-----------NDF---QVIYLGSFILSNTTENATIASAI-DKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATI 3282
            T   WY+   TR+ A   L ++  G FVIR S S   +  +A+K ++          + + TN      +       + +G R++G  NE Y+  L  LV  H    L LPC L++P  + +++       E A   S T DL            DF    V+Y+ S  + + T    +A AI + L  K T  P +        +  K  T  I  TD ++K F R++   N I YC +DP+ R W N     V+         +FG V++       +  H  LFA +
Sbjct: 1368 TSKYWYKPEITREQAICILKDREPGAFVIRDSNSFRGAYGLAMKVASPPPTVQQNKKVGDITNELVRHFLIET----SAKGVRLKGCPNEPYFGCLSALVYQHAITPLALPCKLMIPTRDPNEE-----ALELATPTSSTMDLLKQGAGPPKPTEDFYACNVLYINSVDMESLTGPQAVAKAITETLAAKST--PTA------TIVQFKVSTQGITLTDNQRKVFFRRHYPINLITYCNMDPQERKW-NKAEGGVAK--------LFGFVARKQGSTTDNVSH--LFAEL 1629          

HSP 2 Score: 58.5362 bits (140), Expect = 5.601e-8
Identity = 65/264 (24.62%), Postives = 109/264 (41.29%), Query Frame = 1
Query: 1096 FYEKLHLEKFINSSLKRYVATISSISFGILQYNSNPKQLHFIIIKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILIMANVLNRSNLQY-IYFRIQLHTCWINGSSLVFKNSELDKS-RDCSSQFPD--SVELLFKPNPVIVK--DH--------------ENMLLSEKYSMSNQRISAVNIFEQIKILDQTIKKSKLSYQVGPLNGNIYASISNSRSIE 1827
            FYE   +      S +RYV   + +  G ++ N+ P  LH +I+  +     I             C          F+ +YQ    +YTS  I   +      I   I+P L + GDIL+        N    + FR+Q HTC ++  +LVF  ++LD + +D   +FP+   VE +F  +P  +K  DH              + ++  + Y   N+R   VN+                ++  GP++GN+YA +    S+E
Sbjct:  267 FYEDKAM-PVGQPSQRRYVQYFAGLLSGHIKINNKPLFLHHVIMHGIPNFESIGG-----------CR--------PFLKIYQAMQPVYTSG-IYNVKGDSHTSICITIEPGLLLKGDILLKCYHKRYQNPSRDVIFRVQFHTCALHNLALVFTKNDLDDTFKD--ERFPEYGKVEFIFSFDPEKIKGLDHLQNGPSVSVDYNTQDPLIRWDSYENFNRRCEDVNV--------------DAAHTQGPIDGNLYARVQKKNSLE 493          
BLAST of Tensin 1 vs. Ensembl Zebrafish
Match: tns1a (tensin 1a [Source:ZFIN;Acc:ZDB-GENE-120215-32])

HSP 1 Score: 81.2629 bits (199), Expect = 5.621e-15
Identity = 76/290 (26.21%), Postives = 119/290 (41.03%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTS---------IFNSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDL-----------NDF---QVIYLGSFILSNTTENATIASAI-DKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATI 3282
            T   WY+   TR+ A   L ++  G FVIR S S   +  +A+K ++          + + TN      +       + +G R++G  NE Y+  L  LV  H    L LPC L++P  + +++       E A   S T DL            DF    V+Y+ S  + + T    +A AI + L  K T  P +        +  K  T  I  TD ++K F R++   N I YC +DP+ R W   +              +FG V++       +  H  LFA +
Sbjct: 1394 TSKYWYKPEITREQAICILKDREPGAFVIRDSNSFRGAYGLAMKVASPPPTVQQNKKVGDITNELVRHFLIET----SAKGVRLKGCPNEPYFGCLSALVYQHAITPLALPCKLMIPTRDPNEE-----ALELATPTSSTMDLLKQGAGPPKPTEDFYACNVLYINSVDMESLTGPQAVAKAITETLAAKST--PTA------TIVQFKVSTQGITLTDNQRKVFFRRHYPINLITYCNMDPQERKWNKAEGGVAK---------LFGFVARKQGSTTDNVSH--LFAEL 1655          

HSP 2 Score: 58.5362 bits (140), Expect = 5.958e-8
Identity = 65/264 (24.62%), Postives = 109/264 (41.29%), Query Frame = 1
Query: 1096 FYEKLHLEKFINSSLKRYVATISSISFGILQYNSNPKQLHFIIIKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILIMANVLNRSNLQY-IYFRIQLHTCWINGSSLVFKNSELDKS-RDCSSQFPD--SVELLFKPNPVIVK--DH--------------ENMLLSEKYSMSNQRISAVNIFEQIKILDQTIKKSKLSYQVGPLNGNIYASISNSRSIE 1827
            FYE   +      S +RYV   + +  G ++ N+ P  LH +I+  +     I             C          F+ +YQ    +YTS  I   +      I   I+P L + GDIL+        N    + FR+Q HTC ++  +LVF  ++LD + +D   +FP+   VE +F  +P  +K  DH              + ++  + Y   N+R   VN+                ++  GP++GN+YA +    S+E
Sbjct:  267 FYEDKAM-PVGQPSQRRYVQYFAGLLSGHIKINNKPLFLHHVIMHGIPNFESIGG-----------CR--------PFLKIYQAMQPVYTSG-IYNVKGDSHTSICITIEPGLLLKGDILLKCYHKRYQNPSRDVIFRVQFHTCALHNLALVFTKNDLDDTFKD--ERFPEYGKVEFIFSFDPEKIKGLDHLQNGPSVSVDYNTQDPLIRWDSYENFNRRCEDVNV--------------DAAHTQGPIDGNLYARVQKKNSLE 493          
BLAST of Tensin 1 vs. Ensembl Zebrafish
Match: tns1b (tensin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-6933])

HSP 1 Score: 77.0258 bits (188), Expect = 1.167e-13
Identity = 66/289 (22.84%), Postives = 120/289 (41.52%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSXXXXXXXXXXXX-----XNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDL----NDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNK---LNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATINCNSEELCAIV 3315
            T   WY+   +R  A   L ++  G FVIR S S   +  +A+K ++    +  +     + + ++       + +G R++G  NE Y+  L  LV  H+   L LPC L++P  +      +  + E A   +  +D+        V+Y+ S  + + T    IA AI +          ++N  P      ++ K     I  TD ++K F R++     + +C +DP+ R W   +               FG V++       +  H  LFA ++ + +   AIV
Sbjct: 1433 TSKFWYKPDISRDQAINMLKDQDPGAFVIRDSHSFRGAYGLAMKVASPPPTTQPTKKAGDVTNELVRHFLIETSPKGVRLKGCPNEPYFGCLSALVYQHSITPLALPCKLVIPTRD-----PLEESPEIATPTNPAADMLKQGAACNVLYINSVDMESLTGPQAIAKAISE----------TMNASPAPSATIVHFKVSAQGITLTDNQRKLFFRRHYPIGTVTFCDIDPQERKWNKPEGGTAK---------FFGFVARKQGSTTDNVSH--LFAEMDPD-QPATAIV 1694          

HSP 2 Score: 62.3882 bits (150), Expect = 3.406e-9
Identity = 66/250 (26.40%), Postives = 112/250 (44.80%), Query Frame = 1
Query: 1096 FYEKLHLEKFINSSLKRYVATISSISFGILQYNSNPKQLHFIIIKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILIMA-NVLNRSNLQYIYFRIQLHTCWINGSSLVFKNSELDKS-RDCSSQFPD--SVELLFKPNPVIVKDHENMLLSEKYSMSNQRISAVNIFEQIKILDQTIKKS--KLSYQVGPLNGNIYASISNSRSIE 1827
            FYE   L      S +RYV   S +  G ++ N+ P  LH +I+  +       SK          C          F+ +YQ    +YTS  I   Q      I   I+P L + GDIL+   +   RS  + + FR+Q HTC ++   +VF   ELD++ +D   +FP+   VE +F   P  ++  +++      S+      A+  ++  +  +Q  + S   + +  GPL+G++YA +    S+E
Sbjct:  201 FYEDKVL-PVGQPSQRRYVQYFSGLLSGHIKINNKPLFLHHVIMHGIP---NFESKGG--------CRP--------FLKIYQAMQPVYTSG-IYNVQGDSQTSICITIEPGLLLKGDILLKCYHKRFRSPCRDVIFRVQFHTCAVHDLGIVFGKDELDETFKD--DRFPEYGKVEFVFSFGPEKIQGMDHLENGPSVSVDYNTQDALIRWDSYENFNQRCEDSMEDVIHTEGPLDGSLYAKVRKKESLE 427          
BLAST of Tensin 1 vs. Ensembl Zebrafish
Match: tns2b (tensin 2b [Source:ZFIN;Acc:ZDB-GENE-101001-5])

HSP 1 Score: 73.9442 bits (180), Expect = 9.240e-13
Identity = 71/275 (25.82%), Postives = 127/275 (46.18%), Query Frame = 1
Query: 2497 WYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNS-----TNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDL----NDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNK---LNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATIN 3285
            WY+   +R  A   L +K  G F+IR S S   +  +ALK ST+  ++       S  ++ ++HF+I+   +G +I+G  NE Y+ +L  LV  H+   + LPC L +P+ +   +     + +   + S  +DL        V+YL S      TE+ T   A+ K  +       +L   P      ++ K  T  I  TD +++ F R++   + + +  VDP  + W  + + + S K       +FG V++  S  + +   C LFA ++
Sbjct: 1066 WYKPGISRDQAIAVLKDKEAGCFLIRDSNSFQGAYGLALKVSTAPAHTNSHTEPGSAQEQLVRHFLIESGAKGVKIKGCQNETYFGSLSALVYQHSITPVSLPCVLRIPDRDLVGEL---QDLQSGTNTSTAADLLKQGAACNVLYLNSV----ETESLTGPQAVSKTTK------CTLTQEPRPSPTVVHFKVSTQGITLTDNQRRLFFRRHYPIHSVTFSSVDPLDQRW--VDADNTSCK-------MFGFVAR-RSGALGNV--CHLFAELD 1315          

HSP 2 Score: 69.3218 bits (168), Expect = 2.713e-11
Identity = 66/251 (26.29%), Postives = 112/251 (44.62%), Query Frame = 1
Query: 1114 LEKFINSSLKRYVATISSISFGILQYNSNP---KQLHFIIIKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILI-----MANVLNRSNLQYIYFRIQLHTCWINGSSLVFKNSELDKSRDCS-SQFPD--SVELLFKPNPVI----VKDHENMLLSEKYSMSNQRISAVNIFEQIKILDQTIKKSKLSYQVGPLNGNIYASISNSRS 1821
            +  FI  S  RY+   + +  G ++ NS+P    Q+H  +  N                       ++    + F+ +YQ+  L+Y+S K  + Q   +  +   I+P L + GDIL+     +++V  R  +    FR+Q HTC ++GS L F   ELD +  C+  +FP   +VELLF   P      V  +E   +S  Y  S   +   + +E    L        +S+  GPL+G++YA +   R+
Sbjct:  162 ISSFILPSQNRYIYYFAGLLSGSIKMNSSPLFLHQIHVPVSPNY----------------------QSGGGYAPFLKIYQSLQLVYSSGKYDI-QGPNSKTLCVNIEPALLLKGDILVKCYHRLSDVCKRECV----FRVQFHTCSVHGSQLAFGKGELDHA--CTDDRFPSDATVELLFSTGPQRRGGDVPGNEPG-VSADYG-STDPVVRWDSYENFN-LHHEDSVEDISHTRGPLDGSLYAQVKKRRA 380          
BLAST of Tensin 1 vs. Ensembl Xenopus
Match: TNS3 (tensin 3 [Source:NCBI gene;Acc:100492216])

HSP 1 Score: 85.1149 bits (209), Expect = 5.024e-16
Identity = 70/273 (25.64%), Postives = 118/273 (43.22%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSXXXXXXXXXXXXXN------TEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYS-LTSDLNDFQVIYLGSFILSNTTENATIASA--IDKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFA 3276
            T   WY+   +R  A   L +K  G+F++R S S   +  +A+K +T   +  +S          +  +       +G R++G  NE Y+ +L  LV  H+   L LPC L++P+ +  ++         A   + L        V YL S  + + T    +  A  I +LQE     PIS        ++ K     I  TD ++K F R++   N +I+C +DP+ R W       +S+K       +FG V++  +    +   C LFA
Sbjct:  960 TSKFWYKPDISRDQAIAVLKDKEPGSFIVRDSHSFKGAYGLAMKVATPPPSVLHSSKKGLDLTNELVRHFLIECVHKGVRLKGCPNEPYFGSLTALVYQHSITPLALPCKLLIPDKDPLEEIPAATPQSAANSAAELLKQGAACNVWYLNSVEMESLTGYQAVQKALSITQLQEPP---PIS------TVVHFKVSAQGITLTDNQRKLFFRRHYPVNTVIFCALDPQDRKWTR---DGLSAK-------VFGFVARKGA---GNHNICHLFA 1210          

HSP 2 Score: 57.3806 bits (137), Expect = 1.523e-7
Identity = 60/245 (24.49%), Postives = 110/245 (44.90%), Query Frame = 1
Query: 1102 EKLHLEKFIN--------SSLKRYVATISSISFGILQYNSNPKQLHFIIIKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILIMANVLNRSNLQYIYFRIQLHTCWINGSSLVFKNSELDKSRDCSSQFPD--SVELLFKPNPVIVKDHENMLLSEKYSMSNQRISAVNIFEQIKILDQTIKKSKLSYQVGPLNGNIYASI 1806
            ++  ++KFI+         S KRYV  ++ +  G+ + N  P  LH +I+  +          N  S+   +           F+ +Y     +YTS   L+  E +  +I   I+P   I GDI  M    + S  + + FR+Q HT  I+   ++F   +LD + +   +FP+   +EL+F   P      +N+ ++  Y+ S+  I   + +E   I+         S+  GPL+G++YA +
Sbjct:  140 DRFAMKKFIDDKVSVLLQPSQKRYVNFLNELLSGLEKMNVMPLFLHSVILHGI---------PNFDSADRCQ----------FFLKIYIAMQPVYTSGIYLVGPENQG-KIYIEIEPAQLIKGDI--MLKCYHPSVTRDLVFRLQFHTGAIHSHRVIFCKEDLDHA-NIDDRFPEYGRIELVFSGGPEKNPGKQNIGVTIDYNTSDPLIRW-DSYENTNIV-------SFSHTQGPLDGSLYARV 353          
BLAST of Tensin 1 vs. Ensembl Xenopus
Match: TNS3 (tensin 3 [Source:NCBI gene;Acc:100492216])

HSP 1 Score: 85.1149 bits (209), Expect = 5.663e-16
Identity = 70/273 (25.64%), Postives = 118/273 (43.22%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSXXXXXXXXXXXXXN------TEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYS-LTSDLNDFQVIYLGSFILSNTTENATIASA--IDKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFA 3276
            T   WY+   +R  A   L +K  G+F++R S S   +  +A+K +T   +  +S          +  +       +G R++G  NE Y+ +L  LV  H+   L LPC L++P+ +  ++         A   + L        V YL S  + + T    +  A  I +LQE     PIS        ++ K     I  TD ++K F R++   N +I+C +DP+ R W       +S+K       +FG V++  +    +   C LFA
Sbjct: 1017 TSKFWYKPDISRDQAIAVLKDKEPGSFIVRDSHSFKGAYGLAMKVATPPPSVLHSSKKGLDLTNELVRHFLIECVHKGVRLKGCPNEPYFGSLTALVYQHSITPLALPCKLLIPDKDPLEEIPAATPQSAANSAAELLKQGAACNVWYLNSVEMESLTGYQAVQKALSITQLQEPP---PIS------TVVHFKVSAQGITLTDNQRKLFFRRHYPVNTVIFCALDPQDRKWTR---DGLSAK-------VFGFVARKGA---GNHNICHLFA 1267          
BLAST of Tensin 1 vs. Ensembl Xenopus
Match: TNS3 (tensin 3 [Source:NCBI gene;Acc:100492216])

HSP 1 Score: 85.1149 bits (209), Expect = 5.682e-16
Identity = 70/273 (25.64%), Postives = 118/273 (43.22%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSXXXXXXXXXXXXXN------TEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYS-LTSDLNDFQVIYLGSFILSNTTENATIASA--IDKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFA 3276
            T   WY+   +R  A   L +K  G+F++R S S   +  +A+K +T   +  +S          +  +       +G R++G  NE Y+ +L  LV  H+   L LPC L++P+ +  ++         A   + L        V YL S  + + T    +  A  I +LQE     PIS        ++ K     I  TD ++K F R++   N +I+C +DP+ R W       +S+K       +FG V++  +    +   C LFA
Sbjct: 1028 TSKFWYKPDISRDQAIAVLKDKEPGSFIVRDSHSFKGAYGLAMKVATPPPSVLHSSKKGLDLTNELVRHFLIECVHKGVRLKGCPNEPYFGSLTALVYQHSITPLALPCKLLIPDKDPLEEIPAATPQSAANSAAELLKQGAACNVWYLNSVEMESLTGYQAVQKALSITQLQEPP---PIS------TVVHFKVSAQGITLTDNQRKLFFRRHYPVNTVIFCALDPQDRKWTR---DGLSAK-------VFGFVARKGA---GNHNICHLFA 1278          

HSP 2 Score: 55.0694 bits (131), Expect = 7.956e-7
Identity = 62/249 (24.90%), Postives = 112/249 (44.98%), Query Frame = 1
Query: 1102 EKLHLEKFIN--------SSLKRYVATISSISFGILQYNSNPKQLHFIIIKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILIMANVLNRSNLQYIYFRIQLHTCWINGSSLVFKNSELDKSRDCSSQFPD--SVELLFKPNPVIVKDHENML----LSEKYSMSNQRISAVNIFEQIKILDQTIKKSKLSYQVGPLNGNIYASI 1806
            ++  ++KFI+         S KRYV  ++ +  G+ + N  P  LH +I+  +          N  S+   +           F+ +Y     +YTS   L+  E +  +I   I+P   I GDI  M    + S  + + FR+Q HT  I+   ++F   +LD + +   +FP+   +EL+F   P   K+ EN      ++  Y+ S+  I   + +E   I+ +       S+  GPL+G++YA +
Sbjct:  140 DRFAMKKFIDDKVSVLLQPSQKRYVNFLNELLSGLEKMNVMPLFLHSVILHGI---------PNFDSADRCQ----------FFLKIYIAMQPVYTSGIYLVGPENQG-KIYIEIEPAQLIKGDI--MLKCYHPSVTRDLVFRLQFHTGAIHSHRVIFCKEDLDHA-NIDDRFPEYGRIELVFSGGP--EKNPENFYNNQGVTIDYNTSDPLIRW-DSYENTNIVSEDGVSVCFSHTQGPLDGSLYARV 362          
BLAST of Tensin 1 vs. Ensembl Xenopus
Match: TNS3 (tensin 3 [Source:NCBI gene;Acc:100492216])

HSP 1 Score: 85.1149 bits (209), Expect = 6.063e-16
Identity = 70/273 (25.64%), Postives = 118/273 (43.22%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSXXXXXXXXXXXXXN------TEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYS-LTSDLNDFQVIYLGSFILSNTTENATIASA--IDKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFA 3276
            T   WY+   +R  A   L +K  G+F++R S S   +  +A+K +T   +  +S          +  +       +G R++G  NE Y+ +L  LV  H+   L LPC L++P+ +  ++         A   + L        V YL S  + + T    +  A  I +LQE     PIS        ++ K     I  TD ++K F R++   N +I+C +DP+ R W       +S+K       +FG V++  +    +   C LFA
Sbjct:  964 TSKFWYKPDISRDQAIAVLKDKEPGSFIVRDSHSFKGAYGLAMKVATPPPSVLHSSKKGLDLTNELVRHFLIECVHKGVRLKGCPNEPYFGSLTALVYQHSITPLALPCKLLIPDKDPLEEIPAATPQSAANSAAELLKQGAACNVWYLNSVEMESLTGYQAVQKALSITQLQEPP---PIS------TVVHFKVSAQGITLTDNQRKLFFRRHYPVNTVIFCALDPQDRKWTR---DGLSAK-------VFGFVARKGA---GNHNICHLFA 1214          

HSP 2 Score: 55.0694 bits (131), Expect = 8.284e-7
Identity = 62/249 (24.90%), Postives = 112/249 (44.98%), Query Frame = 1
Query: 1102 EKLHLEKFIN--------SSLKRYVATISSISFGILQYNSNPKQLHFIIIKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILIMANVLNRSNLQYIYFRIQLHTCWINGSSLVFKNSELDKSRDCSSQFPD--SVELLFKPNPVIVKDHENML----LSEKYSMSNQRISAVNIFEQIKILDQTIKKSKLSYQVGPLNGNIYASI 1806
            ++  ++KFI+         S KRYV  ++ +  G+ + N  P  LH +I+  +          N  S+   +           F+ +Y     +YTS   L+  E +  +I   I+P   I GDI  M    + S  + + FR+Q HT  I+   ++F   +LD + +   +FP+   +EL+F   P   K+ EN      ++  Y+ S+  I   + +E   I+ +       S+  GPL+G++YA +
Sbjct:  140 DRFAMKKFIDDKVSVLLQPSQKRYVNFLNELLSGLEKMNVMPLFLHSVILHGI---------PNFDSADRCQ----------FFLKIYIAMQPVYTSGIYLVGPENQG-KIYIEIEPAQLIKGDI--MLKCYHPSVTRDLVFRLQFHTGAIHSHRVIFCKEDLDHA-NIDDRFPEYGRIELVFSGGP--EKNPENFYNNQGVTIDYNTSDPLIRW-DSYENTNIVSEDGVSVCFSHTQGPLDGSLYARV 362          
BLAST of Tensin 1 vs. Ensembl Xenopus
Match: TNS3 (tensin 3 [Source:NCBI gene;Acc:100492216])

HSP 1 Score: 83.9593 bits (206), Expect = 1.360e-15
Identity = 72/273 (26.37%), Postives = 121/273 (44.32%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYST---SIFNSTNSXXXXXXXXXXXXXNT---EGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYS-LTSDLNDFQVIYLGSFILSNTTENATIASA--IDKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFA 3276
            T   WY+   +R  A   L +K  G+F++R S S   +  +A+K +T   S+ +S+    D   +     +     +G R++G  NE Y+ +L  LV  H+   L LPC L++P+ +  ++         A   + L        V YL S  + + T    +  A  I +LQE     PIS        ++ K     I  TD ++K F R++   N +I+C +DP+ R W       +S+K       +FG V++  +    +   C LFA
Sbjct: 1026 TSKFWYKPDISRDQAIAVLKDKEPGSFIVRDSHSFKGAYGLAMKVATPPPSVLHSSKKGLDLTNELVRHFLIECVHKGVRLKGCPNEPYFGSLTALVYQHSITPLALPCKLLIPDKDPLEEIPAATPQSAANSAAELLKQGAACNVWYLNSVEMESLTGYQAVQKALSITQLQEPP---PIS------TVVHFKVSAQGITLTDNQRKLFFRRHYPVNTVIFCALDPQDRKWTR---DGLSAK-------VFGFVARKGA---GNHNICHLFA 1276          
BLAST of Tensin 1 vs. Ensembl Mouse
Match: Tns3 (tensin 3 [Source:MGI Symbol;Acc:MGI:2443012])

HSP 1 Score: 85.1149 bits (209), Expect = 4.611e-16
Identity = 75/274 (27.37%), Postives = 131/274 (47.81%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYST---SIFN---STNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYS--LTSDLNDFQVIYLGSFILSNTTENATIASAIDK--LQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFA 3276
            T   WY+   +R+ A   L +K  G+F++R S S   +  +A+K +T   S+ +         ++ ++HF+I+   +G R++G  NE Y+ +L  LV  H+   L LPC L++PE +  ++    N+ + A + +  L        V YL S  + + T +  +  A+    +QE     P+S        ++ K     I  TD ++K F R++   + +I+C +DP+ R W  IK          P S +FG V++      +D V C LFA
Sbjct: 1163 TSKFWYKADISREQAIAMLKDKAPGSFIVRDSHSFRGAYGLAMKVATPPPSVLHLNKKAGDLSNELVRHFLIECTPKGVRLKGCSNEPYFGSLTALVCQHSITPLALPCKLLIPERDPLEEI-AENSPQTAANSAAELLKQGAACNVWYLNSVEMESLTGHQAVQKALSMTLVQEP---PPVS------TVVHFKVSAQGITLTDNQRKLFFRRHYPVSSVIFCALDPQDRKW--IKDG--------PSSKVFGFVAR-KQGSATDNV-CHLFA 1414          

HSP 2 Score: 67.3958 bits (163), Expect = 1.175e-10
Identity = 57/241 (23.65%), Postives = 109/241 (45.23%), Query Frame = 1
Query: 1096 FYEKLHLEKFINSSLKRYVATISSISFGILQYNSNPKQLHFIIIKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILIMA-NVLNRSNLQYIYFRIQLHTCWINGSSLVFKNSELDKSRDC-SSQFPD--SVELLFKPNPVIVKDHENMLLSEKYSMSNQRISAVNIFEQIKILDQTIKKSKLSYQVGPLNGNIYASI 1806
            FY+   +   +  S KRYV  +S +  G ++ N++P  LHF+I+  +            S      C          F+ +YQ    +YTS    +  E  + +I   I+P   + GDI++   +   RS  + + FR+Q HT  + G  L+F   ELD +  C   +FPD   +EL+F   P  ++  E++   +  ++       +  ++  + +       ++ +  GP++G++YA +
Sbjct:  143 FYDD-KISALMEPSQKRYVQFLSGLLSGAMKMNTSPLFLHFVIMHGV-----------PSFDTGGACRP--------FLKLYQAMQPVYTSGIYNVGSENPS-RIRIAIEPAQLLKGDIMVKCYHKKFRSATRDVIFRLQFHTGAVQGYGLLFGKEELDSA--CKDDRFPDYGKIELVFSATPEKIQGSEHLYSDQGVTVDYNTADPLIRWDSYENMS---ADGEVLHTQGPVDGSLYAKV 357          
BLAST of Tensin 1 vs. Ensembl Mouse
Match: Tns3 (tensin 3 [Source:MGI Symbol;Acc:MGI:2443012])

HSP 1 Score: 84.7297 bits (208), Expect = 6.141e-16
Identity = 75/274 (27.37%), Postives = 131/274 (47.81%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYST---SIFN---STNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYS--LTSDLNDFQVIYLGSFILSNTTENATIASAIDK--LQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFA 3276
            T   WY+   +R+ A   L +K  G+F++R S S   +  +A+K +T   S+ +         ++ ++HF+I+   +G R++G  NE Y+ +L  LV  H+   L LPC L++PE +  ++    N+ + A + +  L        V YL S  + + T +  +  A+    +QE     P+S        ++ K     I  TD ++K F R++   + +I+C +DP+ R W  IK          P S +FG V++      +D V C LFA
Sbjct: 1276 TSKFWYKADISREQAIAMLKDKAPGSFIVRDSHSFRGAYGLAMKVATPPPSVLHLNKKAGDLSNELVRHFLIECTPKGVRLKGCSNEPYFGSLTALVCQHSITPLALPCKLLIPERDPLEEI-AENSPQTAANSAAELLKQGAACNVWYLNSVEMESLTGHQAVQKALSMTLVQEP---PPVS------TVVHFKVSAQGITLTDNQRKLFFRRHYPVSSVIFCALDPQDRKW--IKDG--------PSSKVFGFVAR-KQGSATDNV-CHLFA 1527          

HSP 2 Score: 67.3958 bits (163), Expect = 1.127e-10
Identity = 57/241 (23.65%), Postives = 109/241 (45.23%), Query Frame = 1
Query: 1096 FYEKLHLEKFINSSLKRYVATISSISFGILQYNSNPKQLHFIIIKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILIMA-NVLNRSNLQYIYFRIQLHTCWINGSSLVFKNSELDKSRDC-SSQFPD--SVELLFKPNPVIVKDHENMLLSEKYSMSNQRISAVNIFEQIKILDQTIKKSKLSYQVGPLNGNIYASI 1806
            FY+   +   +  S KRYV  +S +  G ++ N++P  LHF+I+  +            S      C          F+ +YQ    +YTS    +  E  + +I   I+P   + GDI++   +   RS  + + FR+Q HT  + G  L+F   ELD +  C   +FPD   +EL+F   P  ++  E++   +  ++       +  ++  + +       ++ +  GP++G++YA +
Sbjct:  256 FYDD-KISALMEPSQKRYVQFLSGLLSGAMKMNTSPLFLHFVIMHGV-----------PSFDTGGACRP--------FLKLYQAMQPVYTSGIYNVGSENPS-RIRIAIEPAQLLKGDIMVKCYHKKFRSATRDVIFRLQFHTGAVQGYGLLFGKEELDSA--CKDDRFPDYGKIELVFSATPEKIQGSEHLYSDQGVTVDYNTADPLIRWDSYENMS---ADGEVLHTQGPVDGSLYAKV 470          
BLAST of Tensin 1 vs. Ensembl Mouse
Match: Tns3 (tensin 3 [Source:MGI Symbol;Acc:MGI:2443012])

HSP 1 Score: 84.3445 bits (207), Expect = 7.386e-16
Identity = 75/274 (27.37%), Postives = 131/274 (47.81%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYST---SIFN---STNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYS--LTSDLNDFQVIYLGSFILSNTTENATIASAIDK--LQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFA 3276
            T   WY+   +R+ A   L +K  G+F++R S S   +  +A+K +T   S+ +         ++ ++HF+I+   +G R++G  NE Y+ +L  LV  H+   L LPC L++PE +  ++    N+ + A + +  L        V YL S  + + T +  +  A+    +QE     P+S        ++ K     I  TD ++K F R++   + +I+C +DP+ R W  IK          P S +FG V++      +D V C LFA
Sbjct: 1312 TSKFWYKADISREQAIAMLKDKAPGSFIVRDSHSFRGAYGLAMKVATPPPSVLHLNKKAGDLSNELVRHFLIECTPKGVRLKGCSNEPYFGSLTALVCQHSITPLALPCKLLIPERDPLEEI-AENSPQTAANSAAELLKQGAACNVWYLNSVEMESLTGHQAVQKALSMTLVQEP---PPVS------TVVHFKVSAQGITLTDNQRKLFFRRHYPVSSVIFCALDPQDRKW--IKDG--------PSSKVFGFVAR-KQGSATDNV-CHLFA 1563          

HSP 2 Score: 67.3958 bits (163), Expect = 1.152e-10
Identity = 57/241 (23.65%), Postives = 109/241 (45.23%), Query Frame = 1
Query: 1096 FYEKLHLEKFINSSLKRYVATISSISFGILQYNSNPKQLHFIIIKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILIMA-NVLNRSNLQYIYFRIQLHTCWINGSSLVFKNSELDKSRDC-SSQFPD--SVELLFKPNPVIVKDHENMLLSEKYSMSNQRISAVNIFEQIKILDQTIKKSKLSYQVGPLNGNIYASI 1806
            FY+   +   +  S KRYV  +S +  G ++ N++P  LHF+I+  +            S      C          F+ +YQ    +YTS    +  E  + +I   I+P   + GDI++   +   RS  + + FR+Q HT  + G  L+F   ELD +  C   +FPD   +EL+F   P  ++  E++   +  ++       +  ++  + +       ++ +  GP++G++YA +
Sbjct:  292 FYDD-KISALMEPSQKRYVQFLSGLLSGAMKMNTSPLFLHFVIMHGV-----------PSFDTGGACRP--------FLKLYQAMQPVYTSGIYNVGSENPS-RIRIAIEPAQLLKGDIMVKCYHKKFRSATRDVIFRLQFHTGAVQGYGLLFGKEELDSA--CKDDRFPDYGKIELVFSATPEKIQGSEHLYSDQGVTVDYNTADPLIRWDSYENMS---ADGEVLHTQGPVDGSLYAKV 506          
BLAST of Tensin 1 vs. Ensembl Mouse
Match: Tns4 (tensin 4 [Source:MGI Symbol;Acc:MGI:2144377])

HSP 1 Score: 83.1889 bits (204), Expect = 1.125e-15
Identity = 89/332 (26.81%), Postives = 139/332 (41.87%), Query Frame = 1
Query: 2308 ENKYISNLNVCKELKDSTRCSSIYSKILSVDQQLIAENDNLLYDNLPPKQSKVIIDAITTQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKY---STSIFNSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDD-----DFNVHNNFECAEHYSLTSDLNDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNKL-NLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFA 3276
            +++  S  ++C+ +K         SK L  D  L A  D    D  P    K ++D   T   W++   TR+ A   L  +  G FVIR S+S   S  +ALK    S S  N    D    I+HF+I+ + +G  ++G   E Y+ +L   V  H+   L LPC L +P+          D   H    C +  +          +YL S  +   +    +  AI    E+        +  P   + + K     I  TD+++K F R++   + + +CG+DP+ R W+         K   P S IFG V+K  SQ    +  C LFA
Sbjct:  379 QSRVTSPSHLCQAIKSP-------SKTLP-DVPLPASPDGPAKDMQP--TMKFVMD---TSKYWFKPSITREQAINLLRTEKPGAFVIRDSSSYRGSFGLALKVQETSASAPNRPGEDSSDLIRHFLIESSAKGVHLKGADEEPYFGSLSSFVCQHSIMALALPCKLTIPQKELGGAEPASDSPTHGQTSCLKISA------GCHTLYLSSVSVETLSGALAVQKAISVTLER--------DVLPTPTVVHFKVTEQGITLTDVQRKVFFRRHYPLSALRFCGMDPEQRKWQ---------KYCKP-SRIFGFVAK--SQTEPQENVCHLFA 671          
BLAST of Tensin 1 vs. Ensembl Mouse
Match: Tns1 (tensin 1 [Source:MGI Symbol;Acc:MGI:104552])

HSP 1 Score: 78.1814 bits (191), Expect = 5.495e-14
Identity = 73/300 (24.33%), Postives = 127/300 (42.33%), Query Frame = 1
Query: 2431 LYDNLPPKQSKVIIDAITTQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSXXXXXXXXXXX----XXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDLNDFQVIYLGSFILSNTTENATIASAIDKL-QEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATINCNSEELCAIV 3315
            + DN P  ++KV     T+++ WY+   +R+ A   L ++  G F+IR S S   +  +A+K S+     T           +     +    G +++G  NE  + +L  LV  H+   L LPC L++P  +  D+     + + +   + T+DL          F+ S   E+ T   AI K   E     P          ++ K     I  TD ++K F R++   N + +C +DP+ R W   +    +         +FG V++   Q  +    C LFA ++ N +   AIV
Sbjct: 1413 MPDNSPETRAKVKFVQDTSKY-WYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTITQQGKKDMTHELVRHFLIETGPRGVKLKGCPNEPNFGSLSALVYQHSVIPLALPCKLVIPSRDPTDE-----SKDSSGPANSTTDLLKQGAACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATI----VHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKWMKTEGGAPAK--------LFGFVAR--KQGSTTDNACHLFAELDPN-QPASAIV 1691          

HSP 2 Score: 61.6178 bits (148), Expect = 7.536e-9
Identity = 64/245 (26.12%), Postives = 113/245 (46.12%), Query Frame = 1
Query: 1096 FYEKLHLEKFINSSLKRYVATISSISFGILQYNSNPKQLHFIIIKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILIMA-NVLNRSNLQYIYFRIQLHTCWINGSSLVFKNSELDKS-RDCSSQFPD--SVELLFKPNPVIVKDHENM----LLSEKYSMSNQRISAVNIFEQIKILDQTIKKSKLSYQVGPLNGNIYASI 1806
            FYE   +      S +RYV   S +  G ++ N+ P  LH +I+  +       SK          C          F+ +YQ    +YTS    +  + +A+ I   I+P L + GDIL+   +   RS  + + FR+Q HTC I+   +VF   +LD++ +D   +FPD   VE +F   P  ++  E++     +S  Y+ S+  I   + ++      +   +  + +  GPL+G++YA +
Sbjct:  151 FYED-KIVPIGQPSQRRYVHYFSGLLSGSIKMNNKPLFLHHVIMHGIP---NFESKGG--------CRP--------FLRIYQAMQPVYTSGIYNIPGDSQAS-ICITIEPGLLLKGDILLKCYHKKFRSPARDVIFRVQFHTCAIHDLGVVFGKEDLDEAFKD--DRFPDYGKVEFVFSYGPEKIQGMEHLENGPSVSVDYNTSDPLIR-WDSYDNFSGHREDGMEEVVGHTQGPLDGSLYAKV 371          
BLAST of Tensin 1 vs. UniProt/SwissProt
Match: sp|H2L045|TENSH_CAEEL (Tensin homolog OS=Caenorhabditis elegans OX=6239 GN=tns-1 PE=1 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 6.522e-16
Identity = 71/270 (26.30%), Postives = 125/270 (46.30%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDLND----FQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATI 3282
            T   WY+   +R+ A   L +KP G FV+R S S   +  +ALK ST        D  + ++HF+I+ + +G +++G  NE  + +L  LV  H+   L LP  L+LP      DF+        EH S T  L +      V+Y+GS  + + T N  +  +I    ++  +      D     ++ K  +  +  TD  +K F R++     +I+ G+DP  R ++N ++           + +F  V+++ S   S +  C +FA +
Sbjct: 1079 TSKYWYKPTISREQAINMLRDKPPGTFVVRDSNSFPGAFGLALKVSTPPPGVNPGDGSELVRHFLIEPSPKGVKLKGCNNEPVFGSLSALVYQHSITALALPTKLVLP------DFDP---AATPEHLSATQALLEQGAACNVVYVGSVDVESLTGNECVKRSIATCSQRAIN-----GDSRAVSVHFKVSSQGVTLTDNTRKVFFRRHFNVQSVIFAGMDPIERRFENTRALGFHDGCIA-QARLFAFVARIPS---SSENACHVFAEL 1330          
BLAST of Tensin 1 vs. UniProt/SwissProt
Match: sp|Q68CZ2|TENS3_HUMAN (Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2)

HSP 1 Score: 85.8853 bits (211), Expect = 1.740e-15
Identity = 76/273 (27.84%), Postives = 126/273 (46.15%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTS------IFNSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYS-LTSDLNDFQVIYLGSFILSNTTENATIASA--IDKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFA 3276
            T   WY+   +R+ A   L +K  G+F++R S S   +  +A+K +T       +        ++ ++HF+I+   +G R++G  NE Y+ +L  LV  H+   L LPC L++PE +  ++    +    A   + L        V YL S  + + T +  I  A  I  +QE     P+S        ++ K     I  TD ++K F R++   N +I+C +DP+ R W  IK          P S +FG V++      +D V C LFA
Sbjct: 1168 TSKFWYKADISREQAIAMLKDKEPGSFIVRDSHSFRGAYGLAMKVATPPPSVLQLNKKAGDLANELVRHFLIECTPKGVRLKGCSNEPYFGSLTALVCQHSITPLALPCKLLIPERDPLEEIAESSPQTAANSAAELLKQGAACNVWYLNSVEMESLTGHQAIQKALSITLVQEP---PPVS------TVVHFKVSAQGITLTDNQRKLFFRRHYPVNSVIFCALDPQDRKW--IKDG--------PSSKVFGFVAR-KQGSATDNV-CHLFA 1419          

HSP 2 Score: 66.2402 bits (160), Expect = 1.689e-9
Identity = 54/192 (28.12%), Postives = 91/192 (47.40%), Query Frame = 1
Query: 1096 FYEKLHLEKFINSSLKRYVATISSISFGILQYNSNPKQLHFIIIKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILIMA-NVLNRSNLQYIYFRIQLHTCWINGSSLVFKNSELD-KSRDCSSQFPD--SVELLFKPNPVIVKDHENM 1659
            FY+   +   +  S KRYV  +S +  G ++ N++P  LHF+I+         T   +T              +   F+ +YQ    +YTS    +  E   ++I  VI+P   + GD+++   +   RS  + + FR+Q HT  + G  LVF   +LD  S+D   +FPD   VEL+F   P  ++  E++
Sbjct:  143 FYDD-KVSALMQPSQKRYVQFLSGLLSGSVKMNASPLFLHFVILHG-------TPNFDTGG------------VCRPFLKLYQAMQPVYTSGIYNVGPEN-PSRICIVIEPAQLLKGDVMVKCYHKKYRSATRDVIFRLQFHTGAVQGYGLVFGKEDLDNASKD--DRFPDYGKVELVFSATPEKIQGSEHL 311          
BLAST of Tensin 1 vs. UniProt/SwissProt
Match: sp|Q5SSZ5|TENS3_MOUSE (Tensin-3 OS=Mus musculus OX=10090 GN=Tns3 PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 3.226e-15
Identity = 75/274 (27.37%), Postives = 131/274 (47.81%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYST---SIFN---STNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYS--LTSDLNDFQVIYLGSFILSNTTENATIASAIDK--LQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFA 3276
            T   WY+   +R+ A   L +K  G+F++R S S   +  +A+K +T   S+ +         ++ ++HF+I+   +G R++G  NE Y+ +L  LV  H+   L LPC L++PE +  ++    N+ + A + +  L        V YL S  + + T +  +  A+    +QE     P+S        ++ K     I  TD ++K F R++   + +I+C +DP+ R W  IK          P S +FG V++      +D V C LFA
Sbjct: 1163 TSKFWYKADISREQAIAMLKDKAPGSFIVRDSHSFRGAYGLAMKVATPPPSVLHLNKKAGDLSNELVRHFLIECTPKGVRLKGCSNEPYFGSLTALVCQHSITPLALPCKLLIPERDPLEEI-AENSPQTAANSAAELLKQGAACNVWYLNSVEMESLTGHQAVQKALSMTLVQEP---PPVS------TVVHFKVSAQGITLTDNQRKLFFRRHYPVSSVIFCALDPQDRKW--IKDG--------PSSKVFGFVAR-KQGSATDNV-CHLFA 1414          

HSP 2 Score: 67.3958 bits (163), Expect = 8.221e-10
Identity = 57/241 (23.65%), Postives = 109/241 (45.23%), Query Frame = 1
Query: 1096 FYEKLHLEKFINSSLKRYVATISSISFGILQYNSNPKQLHFIIIKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILIMA-NVLNRSNLQYIYFRIQLHTCWINGSSLVFKNSELDKSRDC-SSQFPD--SVELLFKPNPVIVKDHENMLLSEKYSMSNQRISAVNIFEQIKILDQTIKKSKLSYQVGPLNGNIYASI 1806
            FY+   +   +  S KRYV  +S +  G ++ N++P  LHF+I+  +            S      C          F+ +YQ    +YTS    +  E  + +I   I+P   + GDI++   +   RS  + + FR+Q HT  + G  L+F   ELD +  C   +FPD   +EL+F   P  ++  E++   +  ++       +  ++  + +       ++ +  GP++G++YA +
Sbjct:  143 FYDD-KISALMEPSQKRYVQFLSGLLSGAMKMNTSPLFLHFVIMHGV-----------PSFDTGGACRP--------FLKLYQAMQPVYTSGIYNVGSENPS-RIRIAIEPAQLLKGDIMVKCYHKKFRSATRDVIFRLQFHTGAVQGYGLLFGKEELDSA--CKDDRFPDYGKIELVFSATPEKIQGSEHLYSDQGVTVDYNTADPLIRWDSYENMS---ADGEVLHTQGPVDGSLYAKV 357          
BLAST of Tensin 1 vs. UniProt/SwissProt
Match: sp|Q8BZ33|TENS4_MOUSE (Tensin-4 OS=Mus musculus OX=10090 GN=Tns4 PE=2 SV=2)

HSP 1 Score: 83.1889 bits (204), Expect = 7.869e-15
Identity = 89/332 (26.81%), Postives = 139/332 (41.87%), Query Frame = 1
Query: 2308 ENKYISNLNVCKELKDSTRCSSIYSKILSVDQQLIAENDNLLYDNLPPKQSKVIIDAITTQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKY---STSIFNSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDD-----DFNVHNNFECAEHYSLTSDLNDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNKL-NLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFA 3276
            +++  S  ++C+ +K         SK L  D  L A  D    D  P    K ++D   T   W++   TR+ A   L  +  G FVIR S+S   S  +ALK    S S  N    D    I+HF+I+ + +G  ++G   E Y+ +L   V  H+   L LPC L +P+          D   H    C +  +          +YL S  +   +    +  AI    E+        +  P   + + K     I  TD+++K F R++   + + +CG+DP+ R W+         K   P S IFG V+K  SQ    +  C LFA
Sbjct:  379 QSRVTSPSHLCQAIKSP-------SKTLP-DVPLPASPDGPAKDMQP--TMKFVMD---TSKYWFKPSITREQAINLLRTEKPGAFVIRDSSSYRGSFGLALKVQETSASAPNRPGEDSSDLIRHFLIESSAKGVHLKGADEEPYFGSLSSFVCQHSIMALALPCKLTIPQKELGGAEPASDSPTHGQTSCLKISA------GCHTLYLSSVSVETLSGALAVQKAISVTLER--------DVLPTPTVVHFKVTEQGITLTDVQRKVFFRRHYPLSALRFCGMDPEQRKWQ---------KYCKP-SRIFGFVAK--SQTEPQENVCHLFA 671          
BLAST of Tensin 1 vs. UniProt/SwissProt
Match: sp|Q9GLM4|TENS1_BOVIN (Tensin-1 OS=Bos taurus OX=9913 GN=TNS1 PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.198e-13
Identity = 76/304 (25.00%), Postives = 136/304 (44.74%), Query Frame = 1
Query: 2431 LYDNLPPKQSKVIIDAITTQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIF-----NSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDL----NDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATINCNSEELCAIV 3315
            + DN P  ++KV     T+++ WY+   +R+ A   L ++  G F+IR S S   +  +A+K S+        N       + ++HF+I+    G +++G  NE  + +L  LV  H+   L LPC L++P  +  D+     + + +   + TSDL        V+++ S  + + T    I+ AI    E     P          ++ K     I  TD ++K F R++   N + +C +DP+ R W   +    +         +FG V++   Q  +    C LFA ++ N +   AIV
Sbjct: 1422 MPDNSPETRAKVKFVQDTSKY-WYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFLIETGPRGVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIPNRDPTDE-----SKDSSGPANSTSDLLKQGAACNVLFVNSVDMESLTGPQAISKAIS---ETLAADPTPAATI----VHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKWTKTEGGAPAK--------LFGFVAR--KQGSATDNACHLFAELDPN-QPASAIV 1701          

HSP 2 Score: 55.0694 bits (131), Expect = 4.806e-6
Identity = 54/192 (28.12%), Postives = 85/192 (44.27%), Query Frame = 1
Query: 1096 FYEKLHLEKFINSSLKRYVATISSISFGILQYNSNPKQLHFIIIKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILIMA-NVLNRSNLQYIYFRIQLHTCWINGSSLVFKNSELDKS-RDCSSQFPD--SVELLFKPNPVIVKDHENM 1659
            FYE   +      S +RYV   S +  G ++ N+ P  LH +I+  +       SK          C          F+ +YQ    +YTS  I   Q      I   I+P L + GDIL+   +   RS  + + FR+Q HTC I+   +VF   +LD + +D   +FP+   VE +F   P  ++  E++
Sbjct:  149 FYED-KIVPIGQPSQRRYVHYFSGLLSGSIKMNNKPLFLHHVIMHGIP---NFESKGG--------CR--------PFLRIYQAMQPVYTSG-IYNVQGDSQTSICITIEPGLLLKGDILLKCYHKKFRSPARDVIFRVQFHTCAIHDLGVVFGKEDLDDAFKD--DRFPEYGKVEFVFSYGPEKIQGMEHL 317          
BLAST of Tensin 1 vs. TrEMBL
Match: A0A2R5L3T5 (Putative clathrin coat dissociation kinase gak/pten/auxilin OS=Ornithodoros turicata OX=34597 PE=4 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 9.421e-18
Identity = 80/285 (28.07%), Postives = 135/285 (47.37%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYST---SIFNSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDL----NDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFP-HNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATINCNSEELCAIV 3315
            T   WY+   +R+ A   L NKP G F++R S S   +  +A+K +T   ++ +       + ++HF+I+   +G R++G  NE  Y +L  LV  H+   L LPC L+LPE+    D N+  +    ++ S+ S L        V+YL +  + + T    +  A+ +L        +++   P    ++ K  +  I  TD  +K F R++   N I YCG DP+ R W   K+ D    +T      FG V++  +    +Q  C LFA ++   +   AIV
Sbjct:  978 TSKYWYKPNISREEAISVLKNKPPGTFIVRDSNSFPGAFGLAVKVATLPANVQHKAGDPSSELVRHFLIEPTAKGVRLKGCANESVYGSLSALVYQHSITPLALPCRLLLPESELGADSNI--SASTTDNKSVASSLLQQGAACSVLYLCTMDMESLTGPQAVRRAMSEL--------LAIQPAPVPTVVHFKVSSMGITLTDNNRKLFFRRHYALNAISYCGTDPEDRRWTQ-KNDDSGVTVT---LRCFGFVARKPASRTDNQ--CHLFAEVDPE-QPASAIV 1245          

HSP 2 Score: 65.0846 bits (157), Expect = 1.178e-6
Identity = 67/248 (27.02%), Postives = 108/248 (43.55%), Query Frame = 1
Query: 1126 INSSLKRYVATISSISFGILQYNSNPKQLHFIIIKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILIMA-NVLNRSNLQYIYFRIQLHTCWINGSSLVFKNSELDKSRDC-SSQFPDS--VELLFKPNPVIVKDHENMLLSEKYSMSNQRISAV--NIFEQIKIL----DQTIKKSKLSYQV--GPLNGNIYASISNSRSIEKE 1833
            ++ S KRY+   + +  G ++ NS+   LH +I+        I +  N    K              F  +YQ    +YTS   L +    + ++I  ++P L + GDILI   +   R   +   FR+Q HTC + G  + F  ++LD +  C  S+FPD   +EL F   P    D+         +MS  R   +  N +E   +        I     S+ V  GPL+GN+YA+I+  R+   E
Sbjct:  146 MHPSQKRYINYFAELLSGNIKMNSSAPYLHHLILNG------IPNFDNKGGCK-------------PFFKIYQGMQPVYTSGVYLATDS--SKRVIVSMEPSLQLRGDILIKCYHKKQRPAGRSPIFRLQFHTCTLAGDRVTFTKTDLDDA--CIDSRFPDDGKIELQFSQRP---GDYRGNGSVNDTAMSVDRDPLIKQNSYENFDMAADDSQSDIDDFLESFHVPEGPLDGNLYATIAKKRAPVTE 367          
BLAST of Tensin 1 vs. TrEMBL
Match: Q4SUW3 (Chromosome undetermined SCAF13838, whole genome shotgun sequence (Fragment) OS=Tetraodon nigroviridis OX=99883 GN=GSTENG00012279001 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.429e-17
Identity = 74/272 (27.21%), Postives = 114/272 (41.91%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSXXXXXXXXXXXXXN------TEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYS-LTSDLNDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPH-NKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFA 3276
            T   WY+   +R  A   L +K  G FV+R S S   +  +A+K +T   ++             +  +       +G R++G  NE Y+ +L  LV  H+   L LPC LILP+ +  +D    +    A   + L        V YLGS  L   T +  +        +K T   IS+   P    ++ K     I  TD ++K F R++   N +I+C +DP+ R W    SS            IFG V++    E  +   C LFA
Sbjct:  104 TSKFWYKPDISRDQAIALLKDKEPGAFVVRDSHSFRGAYGLAMKVATPPPSALQHSKKGGDLSSELVRHFLIECTQKGVRLKGCPNEPYFGSLTALVCQHSITPLALPCKLILPDRDPVEDLTETSTPTAANSAADLLRQGAACNVWYLGSVALETLTGHQAV--------QKATTTTISMEPPPPCTVVHFKVSAQGITLTDNQRKLFFRRHYAVNTVIFCSLDPQGRKWTRGSSSTAK---------IFGFVARKDQSETENM--CHLFA 356          
BLAST of Tensin 1 vs. TrEMBL
Match: A0A1W7R9G2 (Tensin OS=Hadrurus spadix OX=141984 PE=4 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 2.318e-17
Identity = 78/281 (27.76%), Postives = 133/281 (47.33%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTS---IFNSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDLNDFQVIYLGSFILSNTTENATIASAI-DKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATINCNSEELCAIV 3315
            T   WY+   +R+ A   L +KP G F++R S S   +  +ALK +T    + N+T    ++ ++HF+I+  ++G R++G  NE  + TL  LV  H+   L LPC L+LPE++  D   V    +      L        ++YLG+  +   T +A +     D L+ K    P + +      ++ K     I  TD   K F R++   + + +CG+DP+ R W  +   D  + I    S  FG ++K A  +  +Q  C +FA +    +   AI+
Sbjct:  886 TSKYWYKPNISREEAISMLKDKPPGTFIVRDSNSFPGAFGLALKVATPPPNVQNTTGDISNELVRHFLIEPTSKGVRLKGCANEPVFGTLSALVYQHSMTPLALPCKLLLPESDPADS-KVSETVDEPNSVPLLQGAA-CNLLYLGTADVETLTGSAAVERGFSDILKRK----PATKSSI----IHFKVSGQGITLTDNSHKLFFRRHYPLHAVSHCGLDPRNRRWDEV---DEENNINVNSSHCFGFIAKKAGAKTDNQ--CHMFAELEAE-QPASAII 1150          
BLAST of Tensin 1 vs. TrEMBL
Match: A0A293N2E9 (SH2 domain-containing protein (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.722e-17
Identity = 81/285 (28.42%), Postives = 132/285 (46.32%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYST---SIFNSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDL----NDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFP-HNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATINCNSEELCAIV 3315
            T   WY+   +R+ A   L NKP G F++R S S   +  +A+K +T   ++ +         ++HF+I+   +G R++G  NE  Y +L  LV  H+   L LPC L+LPE+    D  +  N   A+  S  S L        V+YL +  + + T    +  A+ +L        +++   P    ++ K  +  I  TD  +K F R++   N I YCG DP+ R W   K+ D    +T      FG V++  +    +Q  C LFA ++   +   AIV
Sbjct:  462 TSKYWYKPNISREEAISVLKNKPPGTFIVRDSNSFPGAFGLAVKVATLPPNVQHKAGDPSTDLVRHFLIEPTAKGVRLKGCANESVYGSLSALVYQHSITPLALPCRLLLPESELGADSII--NTSTADTKSAASSLLHQGAACSVLYLCTMDMESLTGPQAVRRAMSEL--------LAIQPPPVPTVVHFKVSSMGITLTDNNRKLFFRRHYALNAISYCGTDPEDRRWTQ-KNDDSGVTVT---LRCFGFVARKPASRTDNQ--CHLFAEVDPE-QPASAIV 729          
BLAST of Tensin 1 vs. TrEMBL
Match: A0A1Y1N8P7 (SH2 domain-containing protein OS=Photinus pyralis OX=7054 PE=4 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 4.567e-17
Identity = 117/471 (24.84%), Postives = 199/471 (42.25%), Query Frame = 1
Query: 1975 NTKVYENDSIQTNLLEERCK-ESNEKVAVSKELNQVKGFSIKP-------TNNCIEFNKLDDGKLEAKLKSSKNISPYDNFNIQIKLSDDLNNSFTSKEEKILPLE---KVMERSLLKNVQSENKYISNLNVCKELKDSTRCSSIYSKILSVDQQLIAENDNLLYDNLP----PKQSKVIIDAITTQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYST--SIFNSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDLNDF-------QVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATINCNSEELCAIV 3315
            N+ +Y ++SI +   +   + ES+   +VS    Q   F + P       +   ++F+ L   +L  K  +++    Y      +K S   +NS  SK+    P E     +E S     +S +   ++ N  +   D  + S +++   S     +    + ++   P    P   K + D   T   WY+   +R+ A   L  +P G FV+R S S   +  +ALK +T  S   + +   D+ ++HF+I+  + G R++G  NE  + +L  L+  H+   + LPC L+LPE +   D             SLT+    +        V+YL S  + + T    I  A+ +L   F   P+      H K+N +     I  TD K+K F R++   N + YCG DP    W      + SS        IFG V++  +    +Q  C LFA +    +   AIV
Sbjct:  429 NSPLYRDESISSWRTQSVSEMESSPPHSVSPR-PQTPAFPVHPRTPYTNASTPTVQFD-LPSERLPPKSPTTQRRLSYPT--SALKSSKGRSNSPGSKDRPTSPSELSNGTLEYSHSVVQRSTSATPTSHNYKENFADGYQHSPVHNGSASPTVYYVNSRRSSVHSESPQEVSPAHVKFVRD---TSKYWYKPTISREEAISLLRTQPPGTFVVRDSNSFPGAFGLALKVATLPSNVQAKSPSSDEFVRHFLIEPTSRGVRLKGCSNEPVFSSLSALIYQHSVIQMALPCRLVLPEGDVKQD-------------SLTTTSQAWLSQGAACNVLYLFSLDMESLTGPQAIKKAVVEL---FQKSPVPTATIVHFKVNGQG----ITLTDHKRKVFFRRHYPINTVSYCGEDPDEHRWSVGTGEEKSSNK------IFGYVARKPASNTDNQ--CHLFAELEPE-QPATAIV 863          
BLAST of Tensin 1 vs. Ensembl Cavefish
Match: ENSAMXT00000049936.1 (pep primary_assembly:Astyanax_mexicanus-2.0:13:8188442:8199496:-1 gene:ENSAMXG00000013421.2 transcript:ENSAMXT00000049936.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.8037 bits (203), Expect = 7.674e-16
Identity = 64/240 (26.67%), Postives = 108/240 (45.00%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYS---TSIFNSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDLNDF-------QVIYLGSFILSNTTENATIASAIDK-------LQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVW 3153
            T   WY+   +R+ A   L ++  G FVIR S S   +  +A+K +    ++  +     ++ ++HF+I+ +++G R++G  NE ++  L  LV  H+   L LPC L++P  +         N E  E  + TS   D         V+Y+ S  + + T    +A AI +       L     HF +SL                I  TD ++K F R++   N + YC +DP+ R W
Sbjct:  280 TSKFWYKPDISREQAITLLKDREPGAFVIRDSHSFRGAYGLAMKVACPPPTVQQNKKDMTNELVRHFLIETSSKGVRLKGCPNEPHFGCLSALVYQHSITPLALPCKLMIPTRD--------PNEEALELVTPTSSAMDLLKQGAACNVLYINSVDMESLTGPQAVAKAISETLAANPPLSATVVHFKVSLQG--------------ITLTDNQRKVFFRRHYPINTVTYCNIDPQERKW 497          
BLAST of Tensin 1 vs. Ensembl Cavefish
Match: TNS3 (tensin-3 [Source:NCBI gene;Acc:103027377])

HSP 1 Score: 83.5741 bits (205), Expect = 9.279e-16
Identity = 76/291 (26.12%), Postives = 126/291 (43.30%), Query Frame = 1
Query: 2449 PKQSKVIIDAITTQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYST---SIFNSTNSXXXXXXXXXXX---XXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDLNDFQ------VIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNK---LNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFA 3276
            P  +K + D   T   WY+   +R+ A   L +K  G+F++R S S   +  +A+K +T   SI   +    D   +       +   +G R++G  NE Y+ +L  LV  H+   L LPC LI+P  +  +D       E  +  S  S     +      V +LGS  L + T        +  +Q+  T   + L   P      ++ K     I  TD ++K F R++   N +I+C +DP+ R W   K   +++K       IFG V++ +     +   C LFA
Sbjct:  912 PDNAKFVQD---TSKFWYKPDISREQAITVLKDKEPGSFIVRDSHSFRGAYGLAMKVATPPPSILQQSKKVGDLTNELVRHFLIECTQKGVRLKGCPNEPYFGSLTALVCQHSITPLALPCKLIIPSRDPLEDLT-----ESQQQTSTNSATELLKQGAACNVWFLGSVELESLT-------GVQAIQKAST---VILGQNPPATSTIVHFKVSAQGITLTDNQRKLFFRRHYAVNTVIFCALDPQDRRW--TKDGCLAAK-------IFGFVARKSGSSTENV--CHLFA 1173          
BLAST of Tensin 1 vs. Ensembl Cavefish
Match: ENSAMXT00000013817.2 (pep primary_assembly:Astyanax_mexicanus-2.0:13:8188442:8217069:-1 gene:ENSAMXG00000013421.2 transcript:ENSAMXT00000013817.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.7221 bits (195), Expect = 1.516e-14
Identity = 73/287 (25.44%), Postives = 129/287 (44.95%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYS---TSIFNSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDLNDFQVIYLGSFILSNTTENATIASAIDK-------LQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATINCNSEELCAIV 3315
            T   WY+   +R+ A   L ++  G FVIR S S   +  +A+K +    ++  +     ++ ++HF+I+ +++G R++G  NE ++  L  LV  H+   L LPC L++P       F+         H+ ++S   +  V+Y+ S  + + T    +A AI +       L     HF +SL                I  TD ++K F R++   N + YC +DP+ R W   K+    +K       +FG V++       +  H  LFA +  + +   AIV
Sbjct:  891 TSKFWYKPDISREQAITLLKDREPGAFVIRDSHSFRGAYGLAMKVACPPPTVQQNKKDMTNELVRHFLIETSSKGVRLKGCPNEPHFGCLSALVYQHSITPLALPCKLMIPTRGETLSFS---------HFLISSAACN--VLYINSVDMESLTGPQAVAKAISETLAANPPLSATVVHFKVSLQG--------------ITLTDNQRKVFFRRHYPINTVTYCNIDPQERKWN--KADGGLAK-------LFGFVARKQGSTTDNVSH--LFAELEPD-QPATAIV 1140          
BLAST of Tensin 1 vs. Ensembl Cavefish
Match: tns1b (tensin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-6933])

HSP 1 Score: 77.411 bits (189), Expect = 9.015e-14
Identity = 64/285 (22.46%), Postives = 118/285 (41.40%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSXXXXXXXXXXX----XXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDL----NDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATINCNSEELCAIV 3315
            T   WY+   +R+ A   L  +  G F+IR S S   +  +A+K S+    +  +         +     + + +G +++G  NE Y+  L  LV  H+   L LPC L++P  +  ++       E A   +  ++L        V+Y+ S  + + T    +A AI    E     P+         ++ K  +  I  TD ++K F R++   + + +C +DP+ R W   +               FG V++       +  H  LFA ++ + +   AIV
Sbjct: 1437 TSKFWYKPDISREQAINILKEREPGAFIIRDSHSFRGAYGLAMKVSSPPPTAQQAKKGDITNELVRHFLIETSPKGVKLKGCPNEPYFGCLSALVYQHSITPLALPCKLVIPTKDPHEEVP-----EVATPVNPATELLKQGAACNVLYINSVDMESLTGPQAVAKAIS---ETMAASPMPTA----TTVHFKVSSQGITLTDNQRKLFFRRHYPISTVTFCDLDPQERKWNKAEGGTAK---------FFGFVARKQGSTTDNVSH--LFAEMDPD-QPATAIV 1697          

HSP 2 Score: 59.3066 bits (142), Expect = 2.554e-8
Identity = 66/250 (26.40%), Postives = 110/250 (44.00%), Query Frame = 1
Query: 1096 FYEKLHLEKFINSSLKRYVATISSISFGILQYNSNPKQLHFIIIKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILIMA-NVLNRSNLQYIYFRIQLHTCWINGSSLVFKNSELDKS-RDCSSQFPD--SVELLFKPNPVIVKDHENMLLSEKYSMSNQRISAVNIFEQIKILDQTIKKS--KLSYQVGPLNGNIYASISNSRSIE 1827
            FYE   L      S KRYV   S +  G ++ N+ P  LH +I+  +       +K          C          F+ +YQ    +YTS  I   Q      I   I+P L + GDIL+   +   RS  + + FR+Q HTC ++  SLVF   ELD++ +D   +FP+   VE +F   P  +    ++      S+       +  ++  +  +Q  + S   + +  GPL+G++YA +    S++
Sbjct:  179 FYEDKVL-PVGQPSQKRYVQYFSGLLSGHIKINNKPLFLHHVIMHGIP---NFEAKGG--------CRP--------FLKIYQAMQPVYTSG-IYNVQGDSQTSICITIEPGLLLKGDILLKCYHKRFRSPSRDVIFRVQFHTCAVHDLSLVFGKDELDETFKD--DRFPEYGKVEFVFSFGPEKINGMGHLENGPSVSVDYNTQDPLIRWDSYENFNQRCEDSMDDVIHTQGPLDGSLYAKVRKKESLD 405          
BLAST of Tensin 1 vs. Ensembl Cavefish
Match: ENSAMXT00000036434.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001063.1:374077:386605:1 gene:ENSAMXG00000039082.1 transcript:ENSAMXT00000036434.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.7886 bits (177), Expect = 1.182e-13
Identity = 54/196 (27.55%), Postives = 87/196 (44.39%), Query Frame = 1
Query: 2695 EGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENN-CDDDFNVHNNFECAEHYSLTSDLNDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFP-HNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFA 3276
            +G R++G  NE Y+ +L  LV  H+   L LPC LI+P+ +  +D     +         L        V +LGS  + + T    +  A   +        +SL   P    ++ K  +  I  TD ++K F R++   N +I+C +DP+ R WK         +   P + IFG V++     + D V C LFA
Sbjct:   35 KGVRLKGCPNEPYFGSLTALVYQHSITPLALPCKLIIPDRDPLEDAVETPSQSITNSAAELLKQGAACNVWFLGSVEMESLTGFQAVQKATSDV--------LSLEAPPTPTVVHFKVSSQGITLTDNQRKLFFRRHYAVNTVIFCALDPQERKWK---------RDGYPSAKIFGFVARKTGTAM-DNV-CHLFA 211          
BLAST of Tensin 1 vs. Ensembl Sea Lamprey
Match: TNS1 (tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973])

HSP 1 Score: 88.1965 bits (217), Expect = 8.442e-18
Identity = 77/289 (26.64%), Postives = 129/289 (44.64%), Query Frame = 1
Query: 2455 QSKVIIDAITTQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFN------STNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILP-----ENNCDDDFNVHNNFECAEHYSLTSDLNDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPH-NKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATIN 3285
            Q K + D   T   WY+   +R  A   L +K  G+FVIR S S   +  +A+K S+   N             + ++H++I+  ++G R++G  NE Y+ +L  LV  H+   L LPC +++P     E++  D    H      E     +  N   V+YLGS  + + T    +A A+ +         +S +  P   +++ K     +  TD ++K F R++   + + YC  DP+ R WK    S  +         IFG V+K       +Q  C LFA ++
Sbjct: 1392 QVKFVQD---TTKYWYKKEISRDQAIALLKDKEPGSFVIRDSHSFRGAYGLAMKVSSPPPNIPQQGKKKGDVSSELVRHYLIECTSKGVRLKGCPNEPYFGSLSALVYQHSITPLALPCKIVIPHEDPLEHSEVDSIQSHPVNATPELLKQGAACN---VLYLGSVEMESLTGPQAVAKAVGQ--------ALSGSAPPSPTQVHFKVSQQGVTLTDNQRKLFFRRHYPADTVTYCDQDPQNRKWKKDSGSSAN---------IFGFVAKKQGSVTDNQ--CHLFAELD 1655          
BLAST of Tensin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003653.1 (pep scaffold:Pmarinus_7.0:GL476944:428913:445548:-1 gene:ENSPMAG00000003337.1 transcript:ENSPMAT00000003653.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.2705 bits (212), Expect = 2.429e-17
Identity = 78/308 (25.32%), Postives = 128/308 (41.56%), Query Frame = 1
Query: 2431 LYDNLPPKQSKVIIDAI---------TTQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSXXXXXXXXXXX----XXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDLNDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATINCNSEELCAIV 3315
            L D  PP  S V  D            T   WY+   +R  A   L  +  G FVIR S+S   +  +ALK +T    S +S         +     +   +G R++G  NE  + +L  LV  H+   L LPC L++PE++  D  +V++  E      L        V++LGS  + + T    I  A  ++ +     P++        ++ K     I  TD ++      +   + + +C VDP+ R W   + +        P S +FG V++      SD + C LFA ++   +   AIV
Sbjct:  502 LPDRSPPHGSPVSQDGTLESPVNFVQDTSKYWYKPDISRDQAITMLKGRDPGAFVIRDSSSFRGAYGLALKVATPPGPSLDSKKGDPASELVRHFLIESTPKGVRLKGCSNEPVFGSLSALVYQHSITPLALPCKLLVPEHDPLDTSSVNSASE------LLKQGAACNVLFLGSVEMESLTGPQAIGKATAEILD-MKPRPVATT------VHFKVSAQGITLTDNQRSILPPTHNPVSTVTFCNVDPETRTWVQAEGT--------PGSRVFGFVARKPGSS-SDNL-CHLFAELDPE-QPAAAIV 785          
BLAST of Tensin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005743.1 (pep scaffold:Pmarinus_7.0:GL478791:187748:191319:1 gene:ENSPMAG00000005205.1 transcript:ENSPMAT00000005743.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 1.818e-14
Identity = 67/251 (26.69%), Postives = 116/251 (46.22%), Query Frame = 1
Query: 2557 GNFVIRPSTSLWKSLSIALKYST---SIFNST--NSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENN---CDD-DFNVHNNFECAEHYSLTSDLNDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATI 3282
            G+F+IR S S   +  +A+K +    S+   T      ++ ++H++I+   +G R++G  NE ++ +L  LV  H+   L LPC LI+P+ +   C + D +  N    A    L        V++LGS  + + T    IA A+ ++ E       S        ++ K     I  TD ++K F R++     + +C +DP+ R W+N  S+  +         IFG V+K   Q  +    C LFA +
Sbjct:   11 GSFIIRDSHSFRGAYGLAVKVAMPPPSVLQQTKKGDLANELVRHYLIESTPKGVRLKGCPNEPFFGSLSALVYQHSITPLALPCQLIIPDKDPMECSETDSSEANTANSASE--LLKQGAACNVLFLGSVEMESLTGPQAIAKAVGEVLEA------SAATPAATAVHFKVSAQGITLTDNQRKLFFRRHYPSITVTFCDLDPQERKWQNNGSNSAN---------IFGFVAK--KQASTTDNLCHLFAEL 242          
BLAST of Tensin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001958.1 (pep scaffold:Pmarinus_7.0:GL480048:14054:23824:1 gene:ENSPMAG00000001775.1 transcript:ENSPMAT00000001958.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.633 bits (174), Expect = 9.959e-14
Identity = 71/275 (25.82%), Postives = 114/275 (41.45%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKY----STSIFNSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDLND------FQVIYLGSFILSNTTENATIASAIDKLQEKFTH-FPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFA 3276
            T   WY+   TR+ A   L  +  G FVIR S+S      +A+K           +     D+ ++HF+I+   +G R++G  NE ++ +L  LV  HT   L LP  L LP    D DF++    +  +  +  S  +           +L S  + + T    +A A   +    T   PI         ++L+     I  TDI +K F R++     I +C + P    W   +          P + +FG V++ A   +S  V C LFA
Sbjct:    7 TSKFWYKPGITREQAVTLLCPREAGAFVIRNSSSFHGDFGLAMKVENLPPGVPVQAGRDTVDELVRHFLIETKAQGVRLKGCPNEPFFGSLSALVNQHTVTPLALPGCLRLP----DRDFDLTKAHDLCDALTGGSTGSSQPPEAVGTAFFLDSVEMESLTGPQAVARATSVIMGMATRSMPI--------HVHLRVTGQGITLTDIYRKRFFRRHYPAESISFCAMVPDVTRWPMAED--------KPAAKMFGFVARKAG-SVSHNV-CHLFA 259          
BLAST of Tensin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010484.1 (pep scaffold:Pmarinus_7.0:GL477590:9709:49115:-1 gene:ENSPMAG00000009496.1 transcript:ENSPMAT00000010484.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.7886 bits (177), Expect = 2.282e-13
Identity = 53/185 (28.65%), Postives = 89/185 (48.11%), Query Frame = 1
Query: 1102 EKLHLEKFIN---SSLKRYVATISSISFGILQYNSNPKQLHFIIIKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQE-KEANQIIFVIDPILPITGDILIMANVLNRSNLQYIYFRIQLHTCWINGSSLVFKNSELDKSRDCS-SQFPDS--VELLFKPNPV 1635
            ++ ++EKF +    S +RYV   + +  G ++ NS P  L  I++                ++  S C  +      VF+ VYQ  HL YTS    +  E ++   +   + P + + GDIL+     +  + + + FR+Q HTC + G+ L F   +LD++  C+   FPDS  VELLF   P+
Sbjct:  143 KRFYVEKFASLTQPSQQRYVYYFNGLLSGSIKMNSAPVYLSHILLHG---------AWGPPTTAFSGCGGR------VFLRVYQGLHLYYTSPVYTVRAEVRDGAPLCVNLSPGVVLKGDILVKC-YRSSEDGREVVFRVQFHTCTLQGNRLKFTKHDLDEA--CADPGFPDSGQVELLFSSGPI 309          
BLAST of Tensin 1 vs. Ensembl Nematostella
Match: EDO45783 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRM1])

HSP 1 Score: 65.855 bits (159), Expect = 1.561e-11
Identity = 63/270 (23.33%), Postives = 114/270 (42.22%), Query Frame = 1
Query: 2494 LWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSXXXXXXXXXXXXXN------TEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDLNDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATIN 3285
             WY+   TR  A   L +K  G FV+R S S   +  +A+K +    +    D  K         +       +G +++G  NE  + +L   V  HT   L LP  L++P             F  A   ++ S     +V+++G     +  E  + ++A+ +  E    +  +    P    + K   + +  TD+++K F RK+     I++CG+DP  + W ++   D + K     S  FG+V +   +  +D   C LFA ++
Sbjct:    3 FWYKPKITRDQAINVLKDKEPGLFVVRDSQSFPGAYGLAVKVAIPPPHVLQGDLTKVDLANEKIRHFLIESTKKGVKLKGCDNEPVFGSLAAFVFQHTITPLSLPLRLVIPNEGTWPRRCFSLTFMYA--VNVVSFFLAMKVMFVGE----SNVEMLSGSTAVQRTVEDLLKYKATPRFTP---ASFKVTREGVTITDLERKVFFRKHFPMTSILHCGIDPLDQRW-DLHLPDYTGK-----SRTFGMVVRRIGEAGND---CHLFAEVD 254          
BLAST of Tensin 1 vs. Ensembl Nematostella
Match: EDO45782 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRM0])

HSP 1 Score: 55.8398 bits (133), Expect = 4.220e-8
Identity = 51/173 (29.48%), Postives = 78/173 (45.09%), Query Frame = 1
Query: 1114 LEKFINSSLKRYVATISSISFGILQYNSNPKQLHFIIIKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILIMANVLNR-SNLQYIYFRIQLHTCWINGSSLVFKNSELDKS-RDCSSQFPDS--VELLF 1620
            L      S +RYV   S    G ++ +S P  LH +I+  +       SK                     F+ VY    L+YTS   L++Q+ E  ++   I+  L + GD+LI     N  S+++ I FR Q HT  I    LV   ++LD++ RD   +FPD+  VE +F
Sbjct:  158 LGGVTQPSQRRYVHYFSDYLEGKIKLSSEPMFLHHVIVHGIP---NFDSKGGCKP----------------FLRVYDGLKLVYTSGVFLVTQDME--RVCITIEGGLILHGDVLIKCYHKNTLSSVRDIIFRCQFHTGAIKDCVLVLDKTDLDEAHRD--KRFPDNCKVEFVF 307          
BLAST of Tensin 1 vs. Ensembl Medaka
Match: ENSORLT00000032068.1 (tensin 4 [Source:NCBI gene;Acc:101172468])

HSP 1 Score: 88.5817 bits (218), Expect = 1.235e-17
Identity = 77/272 (28.31%), Postives = 122/272 (44.85%), Query Frame = 1
Query: 2461 KVIIDAITTQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDLNDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFA 3276
            K ++D   T   W+R + +R  A   L +K  G FVIR STS   S  +A+K S S          + I+HF+I+ + +G RI+G   E ++ +L  LV  HT +   LPC L+L   +  D      + E A     T    +F  +YL +      T    +  A+  + EK +        F    +NLK     +  TDI ++ F R++   + + Y G DP  R+W   + S   ++       +FG V+K  S E   +  C +FA
Sbjct:  292 KFVMD---TSKFWFRPHISRAEAEACLRDKEAGAFVIRDSTSFRGSFGLAMKVSQSP-TCPGEGKSELIRHFLIESSAKGVRIKGSSQEPFFGSLSALVYQHTVSPYALPCRLVL---HSQDLKTPEESPENAASEDQTRTACNF--VYLDAVPTEMLTGPCAVQKAVTSMLEKAS------GSFTPALVNLKVSGKGVTLTDINRRLFFRRHYPTHLLSYGGEDPDGRLW--WRGSSFGAR-------MFGFVAK--SMEAGVENVCHVFA 537          
BLAST of Tensin 1 vs. Ensembl Medaka
Match: TNS3 (tensin 3 [Source:NCBI gene;Acc:101166006])

HSP 1 Score: 88.9669 bits (219), Expect = 2.244e-17
Identity = 71/272 (26.10%), Postives = 117/272 (43.01%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSXXXXXXXXXXXXXN------TEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENN-CDDDFNVHNNFECAEHYSLTSDLNDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNK-LNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFA 3276
            T   WY+   +R  A   L ++  G F++R S S   +  +A+K +T                  +  +       +G R++G  NE Y+ +L  LV  H+   L LPC LI+P+ +  +DD     +        L        V YL S  + + T N  +        +K T   ++LN  P +  ++ K  +  I  TD ++K F R++   N +I+C +DP+ R WK         K   P + IFG V++     + D + C LFA
Sbjct: 1084 TSKFWYKSDISRDQAISVLKDREPGCFIVRDSHSFKGAYGLAMKVATPPPTIVQQGKKGGDLSNELVRHFLIECTQKGVRLKGCPNEPYFGSLTALVCQHSITPLALPCKLIIPDRDPLEDDVENPAHSVTNSAAELLKQGAACNVWYLSSVEMESLTGNQAV--------QKATTMTLNLNPPPTSTVVHFKVSSQGITLTDNQRKLFFRRHYSVNTVIFCALDPQDRKWK---------KDGCPSAKIFGFVARKTGTSM-DNI-CHLFA 1336          

HSP 2 Score: 54.6842 bits (130), Expect = 7.616e-7
Identity = 45/190 (23.68%), Postives = 86/190 (45.26%), Query Frame = 1
Query: 1087 ALIFYEKLHLEKFINSSLKRYVATISSISFGILQYNSNPKQLHFII---IKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILIMANVLNRSNL---QYIYFRIQLHTCWINGSSLVFKNSELDKSRDCSSQFPD--SVELLFKPNP 1632
            A+  Y    +   +  S KRYV  ++S+  G ++ N++P  LH +I   I N   TR                      +   ++ VYQ    +Y+S    +      +++   ++P   + GDI+I     ++S++   + + FR+Q HT  + G +L+F+  +++ +     +FPD   VEL+F   P
Sbjct:  139 AMRKYYDDKVSALMTPSQKRYVWILNSLLSGSMKINASPSFLHCVILHGIPNFDATR----------------------VCRPYIKVYQGMQAVYSSGVYHIG-PGHRDRVCIALEPAQLLKGDIMI--KCYHKSDVTSEREVVFRLQFHTGAVQGYNLMFEKEDMEVANK-DPRFPDYGKVELVFSEGP 302          
BLAST of Tensin 1 vs. Ensembl Medaka
Match: TNS3 (tensin-3 [Source:NCBI gene;Acc:101166465])

HSP 1 Score: 88.1965 bits (217), Expect = 3.458e-17
Identity = 72/276 (26.09%), Postives = 124/276 (44.93%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYST---SIFNSTNSXXXXXXXXXXX---XXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENN-----CDDDFNVHNNFECAEHYSLTSDLNDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNK-LNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFA 3276
            T   WY+   +R  A   L +K  G+F++R S S   +  +A+K +T   ++   +    D   +       +   +G R++G  NE Y+ +L  LV  H+   L LPC LILP+ +      D       N   A+     +  N   V YLGS  L + T +  +        +K T   ++++  P +  ++ K     I  TD ++K F R++   N +I+C +DP+ R W   + S  ++K       IFG V++ +  +  +   C LFA
Sbjct:  951 TSKFWYKPDISRDQAIAVLKDKEPGSFIVRDSHSFRGAYGLAMKVATPPPTVLQHSKKGGDLSNELVRHFLIECTPKGVRLKGCPNEPYFGSLTALVCQHSITPLALPCRLILPDRDPVEELSDSPAQTATN-SAADLLKQGAACN---VWYLGSVELESLTGHQAV--------QKATTVTLTMDPPPPSTVVHFKVSAQGITLTDNQRKLFFRRHYAVNTVIFCSLDPQGRKW--TRDSGSTAK-------IFGFVARKSQSDTENM--CHLFA 1203          

HSP 2 Score: 59.3066 bits (142), Expect = 2.299e-8
Identity = 52/185 (28.11%), Postives = 87/185 (47.03%), Query Frame = 1
Query: 1087 ALIFYEKLHLEKFINSSLKRYVATISSISFGILQYNSNPKQLHFIIIKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILIMANVLNR-SNLQYIYFRIQLHTCWINGSSLVFKNSELDKSRDCSSQFPDS--VELLFKPNP 1632
            A+  + K  L   +  S KRY  T+ S+  G L+   +P  L  +++  +    KI             C         +F+ VYQ+   + TS  +  +   + N++ FV+ P   + GDI +++   N  S  + + FR+Q HT  I G +L F  ++LD + + SS FPD   +ELLF  +P
Sbjct:  139 AMWRFYKDKLSTEMTPSQKRYAWTLGSVLKGGLRMRFSPCFLLCVVLHGLP---KIDPDGGC-------C---------LFLRVYQSLQAVCTS-PVYHANAAQTNRLYFVLQPAQLLNGDITVVSYHKNSWSGSRQVVFRLQFHTGIIAGHTLSFSKADLDCACEDSS-FPDDGKLELLFSESP 302          
BLAST of Tensin 1 vs. Ensembl Medaka
Match: TNS3 (tensin-3 [Source:NCBI gene;Acc:101166465])

HSP 1 Score: 87.8113 bits (216), Expect = 4.846e-17
Identity = 72/276 (26.09%), Postives = 124/276 (44.93%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYST---SIFNSTNSXXXXXXXXXXX---XXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENN-----CDDDFNVHNNFECAEHYSLTSDLNDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNK-LNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFA 3276
            T   WY+   +R  A   L +K  G+F++R S S   +  +A+K +T   ++   +    D   +       +   +G R++G  NE Y+ +L  LV  H+   L LPC LILP+ +      D       N   A+     +  N   V YLGS  L + T +  +        +K T   ++++  P +  ++ K     I  TD ++K F R++   N +I+C +DP+ R W   + S  ++K       IFG V++ +  +  +   C LFA
Sbjct:  900 TSKFWYKPDISRDQAIAVLKDKEPGSFIVRDSHSFRGAYGLAMKVATPPPTVLQHSKKGGDLSNELVRHFLIECTPKGVRLKGCPNEPYFGSLTALVCQHSITPLALPCRLILPDRDPVEELSDSPAQTATN-SAADLLKQGAACN---VWYLGSVELESLTGHQAV--------QKATTVTLTMDPPPPSTVVHFKVSAQGITLTDNQRKLFFRRHYAVNTVIFCSLDPQGRKW--TRDSGSTAK-------IFGFVARKSQSDTENM--CHLFA 1152          

HSP 2 Score: 59.6918 bits (143), Expect = 2.162e-8
Identity = 52/185 (28.11%), Postives = 87/185 (47.03%), Query Frame = 1
Query: 1087 ALIFYEKLHLEKFINSSLKRYVATISSISFGILQYNSNPKQLHFIIIKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILIMANVLNR-SNLQYIYFRIQLHTCWINGSSLVFKNSELDKSRDCSSQFPDS--VELLFKPNP 1632
            A+  + K  L   +  S KRY  T+ S+  G L+   +P  L  +++  +    KI             C         +F+ VYQ+   + TS  +  +   + N++ FV+ P   + GDI +++   N  S  + + FR+Q HT  I G +L F  ++LD + + SS FPD   +ELLF  +P
Sbjct:   88 AMWRFYKDKLSTEMTPSQKRYAWTLGSVLKGGLRMRFSPCFLLCVVLHGLP---KIDPDGGC-------C---------LFLRVYQSLQAVCTS-PVYHANAAQTNRLYFVLQPAQLLNGDITVVSYHKNSWSGSRQVVFRLQFHTGIIAGHTLSFSKADLDCACEDSS-FPDDGKLELLFSESP 251          
BLAST of Tensin 1 vs. Ensembl Medaka
Match: TNS3 (tensin 3 [Source:NCBI gene;Acc:101166006])

HSP 1 Score: 87.4261 bits (215), Expect = 5.237e-17
Identity = 71/272 (26.10%), Postives = 117/272 (43.01%), Query Frame = 1
Query: 2485 TQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSXXXXXXXXXXXXXN------TEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENN-CDDDFNVHNNFECAEHYSLTSDLNDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNK-LNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFA 3276
            T   WY+   +R  A   L ++  G F++R S S   +  +A+K +T                  +  +       +G R++G  NE Y+ +L  LV  H+   L LPC LI+P+ +  +DD     +        L        V YL S  + + T N  +        +K T   ++LN  P +  ++ K  +  I  TD ++K F R++   N +I+C +DP+ R WK         K   P + IFG V++     + D + C LFA
Sbjct:  696 TSKFWYKSDISRDQAISVLKDREPGCFIVRDSHSFKGAYGLAMKVATPPPTIVQQGKKGGDLSNELVRHFLIECTQKGVRLKGCPNEPYFGSLTALVCQHSITPLALPCKLIIPDRDPLEDDVENPAHSVTNSAAELLKQGAACNVWYLSSVEMESLTGNQAV--------QKATTMTLNLNPPPTSTVVHFKVSSQGITLTDNQRKLFFRRHYSVNTVIFCALDPQDRKWK---------KDGCPSAKIFGFVARKTGTSM-DNI-CHLFA 948          

HSP 2 Score: 54.299 bits (129), Expect = 8.213e-7
Identity = 43/181 (23.76%), Postives = 83/181 (45.86%), Query Frame = 1
Query: 1114 LEKFINSSLKRYVATISSISFGILQYNSNPKQLHFII---IKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILIMANVLNRSNL---QYIYFRIQLHTCWINGSSLVFKNSELDKSRDCSSQFPD--SVELLFKPNP 1632
            +   +  S KRYV  ++S+  G ++ N++P  LH +I   I N   TR                      +   ++ VYQ    +Y+S    +      +++   ++P   + GDI+I     ++S++   + + FR+Q HT  + G +L+F+  +++ +     +FPD   VEL+F   P
Sbjct:  148 VSALMTPSQKRYVWILNSLLSGSMKINASPSFLHCVILHGIPNFDATR----------------------VCRPYIKVYQGMQAVYSSGVYHIG-PGHRDRVCIALEPAQLLKGDIMI--KCYHKSDVTSEREVVFRLQFHTGAVQGYNLMFEKEDMEVANK-DPRFPDYGKVELVFSEGP 302          
BLAST of Tensin 1 vs. Planmine SMEST
Match: SMESG000029243.1 (SMESG000029243.1)

HSP 1 Score: 1943.32 bits (5033), Expect = 0.000e+0
Identity = 1002/1002 (100.00%), Postives = 1002/1002 (100.00%), Query Frame = 1
Query:  331 MYEKKSVHGITKNCWCLKNDVPTQMKEISNPIPFCSILNPSSKTDIXXXXXXXXXXXXAEELHIDNKMSKSFDFIYSQSKNDALGEEITKTIKKDLVNHEQNFKNIQWKPLVNQKKKINLIYITNRIIVADDDCTDSIEYDKALRSLSICYGKYLKTFYLSVRSTVENPHKDQTNYLSSLPFLMPFLYESYYFLTNIHSWXXXXXXXXXXXXXXENSYHLLEAVVRFLIITDETNERLYKPENVVLSNHETNALIFYEKLHLEKFINSSLKRYVATISSISFGILQYNSNPKQLHFIIIKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILIMANVLNRSNLQYIYFRIQLHTCWINGSSLVFKNSELDKSRDCSSQFPDSVELLFKPNPVIVKDHENMLLSEKYSMSNQRISAVNIFEQIKILDQTIKKSKLSYQVGPLNGNIYASISNSRSIEKEQMDDFTCKRENSNVLRKFNLLENEISSAVELLTNNEKNCPKFENRMKNTKVYENDSIQTNLLEERCKESNEKVAVSKELNQVKGFSIKPTNNCIEFNKLDDGKLEAKLKSSKNISPYDNFNIQIKLSDDLNNSFTSKEEKILPLEKVMERSLLKNVQSENKYISNLNVCKELKDSTRCSSIYSKILSVDQQLIAENDNLLYDNLPPKQSKVIIDAITTQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDLNDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATINCNSEELCAIVRKSLVKF 3336
            MYEKKSVHGITKNCWCLKNDVPTQMKEISNPIPFCSILNPSSKTDIKKLKEKMRKSSKAEELHIDNKMSKSFDFIYSQSKNDALGEEITKTIKKDLVNHEQNFKNIQWKPLVNQKKKINLIYITNRIIVADDDCTDSIEYDKALRSLSICYGKYLKTFYLSVRSTVENPHKDQTNYLSSLPFLMPFLYESYYFLTNIHSWLLKSKKNIILLKGKENSYHLLEAVVRFLIITDETNERLYKPENVVLSNHETNALIFYEKLHLEKFINSSLKRYVATISSISFGILQYNSNPKQLHFIIIKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILIMANVLNRSNLQYIYFRIQLHTCWINGSSLVFKNSELDKSRDCSSQFPDSVELLFKPNPVIVKDHENMLLSEKYSMSNQRISAVNIFEQIKILDQTIKKSKLSYQVGPLNGNIYASISNSRSIEKEQMDDFTCKRENSNVLRKFNLLENEISSAVELLTNNEKNCPKFENRMKNTKVYENDSIQTNLLEERCKESNEKVAVSKELNQVKGFSIKPTNNCIEFNKLDDGKLEAKLKSSKNISPYDNFNIQIKLSDDLNNSFTSKEEKILPLEKVMERSLLKNVQSENKYISNLNVCKELKDSTRCSSIYSKILSVDQQLIAENDNLLYDNLPPKQSKVIIDAITTQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSDDDKHIKHFIIDINTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDLNDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATINCNSEELCAIVRKSLVKF
Sbjct:    1 MYEKKSVHGITKNCWCLKNDVPTQMKEISNPIPFCSILNPSSKTDIKKLKEKMRKSSKAEELHIDNKMSKSFDFIYSQSKNDALGEEITKTIKKDLVNHEQNFKNIQWKPLVNQKKKINLIYITNRIIVADDDCTDSIEYDKALRSLSICYGKYLKTFYLSVRSTVENPHKDQTNYLSSLPFLMPFLYESYYFLTNIHSWLLKSKKNIILLKGKENSYHLLEAVVRFLIITDETNERLYKPENVVLSNHETNALIFYEKLHLEKFINSSLKRYVATISSISFGILQYNSNPKQLHFIIIKNMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKILLSQEKEANQIIFVIDPILPITGDILIMANVLNRSNLQYIYFRIQLHTCWINGSSLVFKNSELDKSRDCSSQFPDSVELLFKPNPVIVKDHENMLLSEKYSMSNQRISAVNIFEQIKILDQTIKKSKLSYQVGPLNGNIYASISNSRSIEKEQMDDFTCKRENSNVLRKFNLLENEISSAVELLTNNEKNCPKFENRMKNTKVYENDSIQTNLLEERCKESNEKVAVSKELNQVKGFSIKPTNNCIEFNKLDDGKLEAKLKSSKNISPYDNFNIQIKLSDDLNNSFTSKEEKILPLEKVMERSLLKNVQSENKYISNLNVCKELKDSTRCSSIYSKILSVDQQLIAENDNLLYDNLPPKQSKVIIDAITTQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSDDDKHIKHFIIDINTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTSDLNDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATINCNSEELCAIVRKSLVKF 1002          
BLAST of Tensin 1 vs. Planmine SMEST
Match: SMESG000019881.1 (SMESG000019881.1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.058e-19
Identity = 70/218 (32.11%), Postives = 115/218 (52.75%), Query Frame = 1
Query: 2494 LWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILP--ENNCDDDFNVHNNFECAEHYSLTS--DLNDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVD 3135
            +WY+   +R+ A   L  KP G+FV+R S +   S  +A+    +   ST  DDD+ ++HF+I+ NT+G RIRG  NE Y+ +L  LV  HT   L LPC LILP  E++ DD  + +++        ++S      F  +YLGS    + T  A ++ A++ L E  T       +    +++++   + +  TD+ +K F R++   N I YCG +
Sbjct:  668 IWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNVPRT---STVEDDDRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPISESDLDDQQSSYDSCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKT-------EVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE 875          
BLAST of Tensin 1 vs. Planmine SMEST
Match: SMESG000060707.1 (SMESG000060707.1)

HSP 1 Score: 75.485 bits (184), Expect = 1.843e-13
Identity = 75/285 (26.32%), Postives = 122/285 (42.81%), Query Frame = 1
Query: 2497 WYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNST----NSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHN----------NFECAEHYSLT-SDLNDFQVIYLGSFILSNTTENATIASAIDKL-----QEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCR--VWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATIN 3285
            WY+ + +R+ A   L N   GNF+IR S +   +  +A+K +    N T    + + +K   + I     +G   +GF  E  + +L  LV  +T     LPC L+LP+   D   N                  +  SL  SD   + V YLG + +   T  + I  AI++L        FT   + +N             + I+ TD+++K F R++  F+ I YC +DPK R    +  KS  V        + IFGI+ K     ++ +  C LF  ++
Sbjct:  835 WYQPHISREEAIAILKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTHVSSHSVIISSPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINS-----------GEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKK------TKIFGIIVKAY---MAGENKCFLFGELD 1099          
BLAST of Tensin 1 vs. Planmine SMEST
Match: SMESG000060707.1 (SMESG000060707.1)

HSP 1 Score: 75.0998 bits (183), Expect = 2.063e-13
Identity = 75/285 (26.32%), Postives = 122/285 (42.81%), Query Frame = 1
Query: 2497 WYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNST----NSXXXXXXXXXXXXXNTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHN----------NFECAEHYSLT-SDLNDFQVIYLGSFILSNTTENATIASAIDKL-----QEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCR--VWKNIKSSDVSSKITDPHSPIFGIVSKVASQEISDQVHCQLFATIN 3285
            WY+ + +R+ A   L N   GNF+IR S +   +  +A+K +    N T    + + +K   + I     +G   +GF  E  + +L  LV  +T     LPC L+LP+   D   N                  +  SL  SD   + V YLG + +   T  + I  AI++L        FT   + +N             + I+ TD+++K F R++  F+ I YC +DPK R    +  KS  V        + IFGI+ K     ++ +  C LF  ++
Sbjct:  410 WYQPHISREEAIAILKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTHVSSHSVIISSPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINS-----------GEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKK------TKIFGIIVKAY---MAGENKCFLFGELD 674          
BLAST of Tensin 1 vs. Planmine SMEST
Match: SMESG000033851.1 (SMESG000033851.1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.834e-8
Identity = 65/271 (23.99%), Postives = 104/271 (38.38%), Query Frame = 1
Query: 2479 ITTQHLWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSXXXXXXXXXXXXXNT------EGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLI--------LPENNCDDDFNVHNNFECAE---------------HYSLTSDLNDF---------------QVIYLGSFILSNTTENATIASAIDKL----QEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCR 3147
            + T+ LWY+ +  R+     L +K  G+F+IR S++   +  +ALK ++   N+  ++D +        I T       G R++G  NE  Y +L  LVQDH +N   LP  LI        L + +       H  +E  +               H S++S   +F                 +YLG F +      A I  AI+KL      K T   I L+            T+ I FTD  +  F  +      ++    D + R
Sbjct:  424 LNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPIYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDS-----------TNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLR 683          
The following BLAST results are available for this feature:
BLAST of Tensin 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TNS33.623e-1627.84tensin 3 [Source:HGNC Symbol;Acc:HGNC:21616][more]
TNS21.122e-1326.77tensin 2 [Source:HGNC Symbol;Acc:HGNC:19737][more]
TNS11.516e-1325.58tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973][more]
TNS11.586e-1325.58tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973][more]
TNS11.592e-1325.58tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973][more]
back to top
BLAST of Tensin 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tns-17.389e-1826.30TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L04... [more]
tns-11.933e-1726.30TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L04... [more]
tns-11.933e-1726.30TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L04... [more]
tns-15.127e-1726.30TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L04... [more]
tns-16.543e-1726.30TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L04... [more]
back to top
BLAST of Tensin 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
by1.270e-1225.36gene:FBgn0000244 transcript:FBtr0302382[more]
by1.270e-1225.36gene:FBgn0000244 transcript:FBtr0082119[more]
by1.270e-1225.36gene:FBgn0000244 transcript:FBtr0301093[more]
back to top
BLAST of Tensin 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tns3.28.375e-1625.61tensin 3, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-... [more]
tns1a5.598e-1526.90tensin 1a [Source:ZFIN;Acc:ZDB-GENE-120215-32][more]
tns1a5.621e-1526.21tensin 1a [Source:ZFIN;Acc:ZDB-GENE-120215-32][more]
tns1b1.167e-1322.84tensin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-6933][more]
tns2b9.240e-1325.82tensin 2b [Source:ZFIN;Acc:ZDB-GENE-101001-5][more]
back to top
BLAST of Tensin 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TNS35.024e-1625.64tensin 3 [Source:NCBI gene;Acc:100492216][more]
TNS35.663e-1625.64tensin 3 [Source:NCBI gene;Acc:100492216][more]
TNS35.682e-1625.64tensin 3 [Source:NCBI gene;Acc:100492216][more]
TNS36.063e-1625.64tensin 3 [Source:NCBI gene;Acc:100492216][more]
TNS31.360e-1526.37tensin 3 [Source:NCBI gene;Acc:100492216][more]
back to top
BLAST of Tensin 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tns34.611e-1627.37tensin 3 [Source:MGI Symbol;Acc:MGI:2443012][more]
Tns36.141e-1627.37tensin 3 [Source:MGI Symbol;Acc:MGI:2443012][more]
Tns37.386e-1627.37tensin 3 [Source:MGI Symbol;Acc:MGI:2443012][more]
Tns41.125e-1526.81tensin 4 [Source:MGI Symbol;Acc:MGI:2144377][more]
Tns15.495e-1424.33tensin 1 [Source:MGI Symbol;Acc:MGI:104552][more]
back to top
BLAST of Tensin 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|H2L045|TENSH_CAEEL6.522e-1626.30Tensin homolog OS=Caenorhabditis elegans OX=6239 G... [more]
sp|Q68CZ2|TENS3_HUMAN1.740e-1527.84Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2[more]
sp|Q5SSZ5|TENS3_MOUSE3.226e-1527.37Tensin-3 OS=Mus musculus OX=10090 GN=Tns3 PE=1 SV=... [more]
sp|Q8BZ33|TENS4_MOUSE7.869e-1526.81Tensin-4 OS=Mus musculus OX=10090 GN=Tns4 PE=2 SV=... [more]
sp|Q9GLM4|TENS1_BOVIN1.198e-1325.00Tensin-1 OS=Bos taurus OX=9913 GN=TNS1 PE=2 SV=1[more]
back to top
BLAST of Tensin 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2R5L3T59.421e-1828.07Putative clathrin coat dissociation kinase gak/pte... [more]
Q4SUW31.429e-1727.21Chromosome undetermined SCAF13838, whole genome sh... [more]
A0A1W7R9G22.318e-1727.76Tensin OS=Hadrurus spadix OX=141984 PE=4 SV=1[more]
A0A293N2E93.722e-1728.42SH2 domain-containing protein (Fragment) OS=Ornith... [more]
A0A1Y1N8P74.567e-1724.84SH2 domain-containing protein OS=Photinus pyralis ... [more]
back to top
BLAST of Tensin 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000049936.17.674e-1626.67pep primary_assembly:Astyanax_mexicanus-2.0:13:818... [more]
TNS39.279e-1626.12tensin-3 [Source:NCBI gene;Acc:103027377][more]
ENSAMXT00000013817.21.516e-1425.44pep primary_assembly:Astyanax_mexicanus-2.0:13:818... [more]
tns1b9.015e-1422.46tensin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-6933][more]
ENSAMXT00000036434.11.182e-1327.55pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Tensin 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TNS18.442e-1826.64tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973][more]
ENSPMAT00000003653.12.429e-1725.32pep scaffold:Pmarinus_7.0:GL476944:428913:445548:-... [more]
ENSPMAT00000005743.11.818e-1426.69pep scaffold:Pmarinus_7.0:GL478791:187748:191319:1... [more]
ENSPMAT00000001958.19.959e-1425.82pep scaffold:Pmarinus_7.0:GL480048:14054:23824:1 g... [more]
ENSPMAT00000010484.12.282e-1328.65pep scaffold:Pmarinus_7.0:GL477590:9709:49115:-1 g... [more]
back to top
BLAST of Tensin 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tensin 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO457831.561e-1123.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457824.220e-829.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tensin 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000032068.11.235e-1728.31tensin 4 [Source:NCBI gene;Acc:101172468][more]
TNS32.244e-1726.10tensin 3 [Source:NCBI gene;Acc:101166006][more]
TNS33.458e-1726.09tensin-3 [Source:NCBI gene;Acc:101166465][more]
TNS34.846e-1726.09tensin-3 [Source:NCBI gene;Acc:101166465][more]
TNS35.237e-1726.10tensin 3 [Source:NCBI gene;Acc:101166006][more]
back to top
BLAST of Tensin 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029243.10.000e+0100.00SMESG000029243.1[more]
SMESG000019881.11.058e-1932.11SMESG000019881.1[more]
SMESG000060707.11.843e-1326.32SMESG000060707.1[more]
SMESG000060707.12.063e-1326.32SMESG000060707.1[more]
SMESG000033851.11.834e-823.99SMESG000033851.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032325 ID=SMED30032325|Name=Tensin 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3397bp
GATGGAAATCAGCAGAGAATTTGTGCAATCTCGCACATCGAGATGATCAA
ATATGCTCCAATCAGTTGCGATTAATTGTTATTGAATCCAATCTGATGCT
TGTCTGTGTATTTGCGTTATAGATTACATCATTTGTTGGTAGCAATAATT
TTCGGTTTCTACAATAAATTACATTGATAAATTAATTTGATAATAACAAA
TAACAGTTGACAAACTAAAAGCGCAGAAATCAAAGGATTTAATGCAAATG
AAAATCATTAAATTATTTATCTTCACATTTATCTAAAAATATAATTGCGG
AAAACTACAAAAAGTATTTAGAAAATATCCATGTATGAAAAGAAATCTGT
CCATGGAATTACCAAAAATTGTTGGTGTTTGAAAAATGATGTTCCAACAC
AAATGAAAGAGATATCCAATCCAATCCCGTTTTGTTCTATCCTTAATCCA
AGTTCTAAAACAGATATAAAAAAGCTAAAAGAAAAGATGAGAAAAAGTTC
AAAAGCTGAAGAATTGCACATTGACAACAAAATGTCAAAGTCTTTTGATT
TTATCTACAGCCAGTCAAAAAACGATGCCTTAGGAGAAGAAATTACAAAG
ACAATAAAAAAAGATTTAGTAAATCATGAACAAAATTTTAAGAATATTCA
ATGGAAACCTCTTGTAAATCAAAAGAAAAAGATTAATTTAATATATATAA
CCAATCGGATTATAGTGGCTGATGATGATTGTACTGATTCAATTGAATAT
GACAAGGCTTTGAGATCATTAAGCATTTGCTATGGAAAATATTTAAAAAC
ATTCTACCTATCAGTTCGCTCGACAGTAGAAAATCCTCATAAAGACCAAA
CAAACTATTTGTCAAGCCTCCCATTCCTAATGCCGTTTCTGTACGAATCC
TATTATTTTCTTACAAATATACATAGTTGGTTGTTAAAATCAAAGAAAAA
CATCATTTTACTGAAAGGCAAAGAAAATTCATATCATTTATTGGAAGCAG
TTGTTCGATTCCTTATTATCACTGATGAAACAAATGAAAGACTTTATAAA
CCTGAAAATGTTGTCCTGTCGAATCACGAAACGAATGCACTGATATTTTA
CGAAAAGTTGCATTTAGAAAAATTCATTAATTCCTCATTAAAAAGATATG
TAGCTACTATTTCAAGTATTTCCTTCGGGATTCTTCAGTATAATTCCAAT
CCTAAACAATTACATTTTATTATAATCAAAAATATGTCATATACAAGAAA
AATTACAAGCAAAGCAAATACGAGTTCTTCAAAGATGTCGGAATGTTCGA
ATAAAAATGAAAAATTAAAATCGGTTTTTGTAACTGTTTACCAAAATTTT
CATTTGATTTACACGTCAGACAAAATATTGTTAAGTCAAGAAAAAGAGGC
GAACCAAATTATTTTTGTAATTGATCCAATTTTACCGATCACTGGTGATA
TATTAATAATGGCTAATGTTCTTAACAGATCAAATTTACAATATATATAT
TTTCGTATTCAACTCCATACATGTTGGATCAACGGTAGCTCATTGGTATT
TAAAAATTCAGAATTAGATAAATCTAGAGACTGTTCTTCGCAATTTCCCG
ATAGTGTTGAATTGTTATTTAAACCAAATCCCGTAATTGTTAAAGATCAT
GAAAATATGTTGCTCTCCGAGAAATATTCGATGTCGAATCAAAGGATTAG
CGCTGTAAACATATTTGAACAAATTAAAATATTAGACCAAACAATTAAAA
AATCTAAACTTTCTTACCAAGTTGGACCACTCAATGGTAATATTTATGCA
TCAATTTCGAATAGCAGGAGCATTGAAAAAGAACAAATGGATGATTTTAC
TTGCAAAAGAGAAAATTCAAATGTATTGCGGAAATTTAATTTGCTGGAAA
ACGAAATATCAAGTGCCGTTGAACTTTTAACAAACAATGAAAAAAATTGT
CCAAAGTTTGAAAATCGAATGAAAAATACAAAAGTGTATGAAAATGATAG
TATACAAACAAATTTACTGGAAGAACGATGCAAAGAATCTAATGAGAAAG
TAGCTGTTAGTAAAGAATTAAATCAAGTCAAAGGTTTCAGTATAAAACCC
ACAAATAATTGTATCGAATTTAATAAACTTGATGATGGAAAACTAGAAGC
AAAACTGAAAAGTTCAAAGAATATTTCTCCTTATGATAACTTCAACATTC
AAATAAAGCTTTCAGATGATTTGAATAATTCATTTACTTCAAAAGAAGAG
AAAATTTTACCCCTAGAAAAAGTCATGGAGAGATCACTTTTAAAAAACGT
GCAAAGTGAAAATAAATACATTTCTAATTTAAATGTATGCAAAGAACTCA
AAGATTCAACAAGGTGTTCGTCAATTTATTCGAAGATTCTTTCAGTCGAT
CAACAGTTAATTGCTGAAAATGATAATTTATTGTATGATAATTTACCCCC
GAAGCAATCAAAAGTGATCATAGATGCAATCACCACCCAGCATTTATGGT
ATAGACATTATTTTACAAGGCAAACCGCAACTATGTACTTGCTAAATAAA
CCGGTTGGGAATTTCGTCATTCGTCCAAGCACTTCACTGTGGAAATCGCT
GTCAATTGCATTGAAATATAGCACTTCGATTTTCAATTCAACTAATTCTG
ATGACGATAAACATATAAAACATTTCATTATTGATATCAACACCGAAGGT
TATCGAATAAGAGGTTTCGTGAATGAGAAATATTATAAGACCCTGCCTAT
GCTTGTTCAAGATCATACAGAGAATCATTTAGGATTACCATGCAATCTAA
TATTGCCTGAAAATAATTGTGATGATGATTTTAATGTTCACAATAATTTT
GAGTGCGCTGAACATTACTCACTTACTTCAGATTTAAATGATTTTCAAGT
GATTTATCTTGGATCTTTTATTCTATCAAATACAACCGAAAATGCGACTA
TAGCTTCCGCCATTGATAAATTACAAGAAAAATTTACACATTTTCCGATT
TCATTGAATGATTTTCCTCACAATAAACTGAATTTGAAATTCCGGACAGA
TCGAATTATTTTCACAGATATAAAAAAAAAGTTTTTTCTTCGAAAATATT
GTAAATTCAACGACATTATATATTGTGGTGTAGATCCTAAATGTCGAGTA
TGGAAAAATATAAAAAGTTCAGATGTGAGTTCAAAAATTACAGATCCACA
CAGCCCAATTTTTGGTATTGTGTCAAAAGTTGCTTCTCAAGAAATTTCTG
ATCAAGTACATTGTCAATTATTTGCTACGATTAATTGTAACTCTGAAGAG
CTTTGTGCCATTGTAAGGAAATCACTTGTCAAATTTTGAAACTAATTTGT
AAACTGAATTTGAATTTAAATGTGTCTGAAATTAAATATTTTATTAG
back to top

protein sequence of SMED30032325-orf-1

>SMED30032325-orf-1 ID=SMED30032325-orf-1|Name=SMED30032325-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1003bp
MYEKKSVHGITKNCWCLKNDVPTQMKEISNPIPFCSILNPSSKTDIKKLK
EKMRKSSKAEELHIDNKMSKSFDFIYSQSKNDALGEEITKTIKKDLVNHE
QNFKNIQWKPLVNQKKKINLIYITNRIIVADDDCTDSIEYDKALRSLSIC
YGKYLKTFYLSVRSTVENPHKDQTNYLSSLPFLMPFLYESYYFLTNIHSW
LLKSKKNIILLKGKENSYHLLEAVVRFLIITDETNERLYKPENVVLSNHE
TNALIFYEKLHLEKFINSSLKRYVATISSISFGILQYNSNPKQLHFIIIK
NMSYTRKITSKANTSSSKMSECSNKNEKLKSVFVTVYQNFHLIYTSDKIL
LSQEKEANQIIFVIDPILPITGDILIMANVLNRSNLQYIYFRIQLHTCWI
NGSSLVFKNSELDKSRDCSSQFPDSVELLFKPNPVIVKDHENMLLSEKYS
MSNQRISAVNIFEQIKILDQTIKKSKLSYQVGPLNGNIYASISNSRSIEK
EQMDDFTCKRENSNVLRKFNLLENEISSAVELLTNNEKNCPKFENRMKNT
KVYENDSIQTNLLEERCKESNEKVAVSKELNQVKGFSIKPTNNCIEFNKL
DDGKLEAKLKSSKNISPYDNFNIQIKLSDDLNNSFTSKEEKILPLEKVME
RSLLKNVQSENKYISNLNVCKELKDSTRCSSIYSKILSVDQQLIAENDNL
LYDNLPPKQSKVIIDAITTQHLWYRHYFTRQTATMYLLNKPVGNFVIRPS
TSLWKSLSIALKYSTSIFNSTNSDDDKHIKHFIIDINTEGYRIRGFVNEK
YYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSLTS
DLNDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNKL
NLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVDPKCRVWKNIKSSDVS
SKITDPHSPIFGIVSKVASQEISDQVHCQLFATINCNSEELCAIVRKSLV
KF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
GO:0008284positive regulation of cell proliferation
GO:0016477cell migration
GO:0048286lung alveolus development
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0005515protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0002028dorsal-ventral muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036860SH2_dom_sf
IPR000980SH2
IPR014020Tensin_C2-dom
IPR013625PTB
IPR011993PH-like_dom_sf
IPR000008C2_dom
Vocabulary: cellular component
TermDefinition
GO:0005829cytosol
GO:0005925focal adhesion
GO:0030054cell junction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014020Tensin phosphatase, C2 domainSMARTSM01326PTEN_C2_2coord: 287..432
e-value: 7.6E-11
score: 52.0
IPR014020Tensin phosphatase, C2 domainPFAMPF10409PTEN_C2coord: 322..426
e-value: 1.4E-9
score: 37.8
IPR014020Tensin phosphatase, C2 domainPROSITEPS51182C2_TENSINcoord: 289..433
score: 10.508
IPR000980SH2 domainSMARTSM00252SH2_5coord: 721..818
e-value: 4.4E-7
score: 39.5
IPR000980SH2 domainPFAMPF00017SH2coord: 723..812
e-value: 5.1E-6
score: 26.5
IPR000980SH2 domainPROSITEPS50001SH2coord: 723..827
score: 13.756
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 843..1001
e-value: 4.9E-16
score: 60.6
IPR036860SH2 domain superfamilyGENE3DG3DSA:3.30.505.10coord: 719..824
e-value: 2.4E-19
score: 71.6
IPR036860SH2 domain superfamilySUPERFAMILYSSF55550SH2 domaincoord: 711..827
IPR013625Tensin/EPS8 phosphotyrosine-binding domainPFAMPF08416PTBcoord: 856..995
e-value: 2.0E-7
score: 31.2
NoneNo IPR availablePANTHERPTHR45734FAMILY NOT NAMEDcoord: 719..995
coord: 119..585
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 847..995
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 328..431