RRM domain-containing protein

Overview
NameRRM domain-containing protein
Smed IDSMED30032319
Length (bp)1780
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RRM domain-containing protein (SMED30032319) t-SNE clustered cells

Violin plots show distribution of expression levels for RRM domain-containing protein (SMED30032319) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RRM domain-containing protein (SMED30032319) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RRM domain-containing protein (SMED30032319) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032319

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30032319h1SMcG0018409 SmedASXL_016031SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30032319h1SMcG0018409 SmedASXL_016031SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: NCL (nucleolin [Source:HGNC Symbol;Acc:HGNC:7667])

HSP 1 Score: 70.8626 bits (172), Expect = 4.082e-12
Identity = 67/247 (27.13%), Postives = 110/247 (44.53%), Query Frame = 3
Query:  843 TLRIGNLSETTSYETIKSLEFNCSSMHLTKKSGKR--ICFLSFKSNKDLTEAYQALLNKEIDGSKVTVKLV-------EFKTNKLSEEEFDLMKLHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSNKERLAKKKLEGNVVTLF--NLPKSVTVDEIKAKFDHVKFVHII--KKDNIFKGIAEVHFIKPDFAKAA 1544
            TL   NL    + + +K +  + + + L  K GK   I ++ FK+  D  + ++     EIDG  +++          +++  K S    +   L ++NL +S T+E L++ F+ A+ +K P N NGKSKG  ++ F S E A  A+     + I GR IR +       L+  +   N      K       TLF   L +  T + +K  FD      I+  ++    KG   V F   + AKAA
Sbjct:  394 TLLAKNLPYKVTQDELKEVFEDAAEIRLVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWSGESKTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLE-------LQGPRGSPNARSQPSK-------TLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAA 626          
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: NCL (nucleolin [Source:HGNC Symbol;Acc:HGNC:7667])

HSP 1 Score: 62.7734 bits (151), Expect = 4.240e-10
Identity = 64/250 (25.60%), Postives = 104/250 (41.60%), Query Frame = 3
Query:  906 NCSSMHLTKKSGKR--ICFLSFKSNKDLTEAYQALLNKEIDGSKVTVKLV-------EFKTNKLSEEEFDLMK------------------------LHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSNKERLAKKKLEGNVVTLF--NLPKSVTVDEIKAKFDHVKFVHII--KKDNIFKGIAEVHFIKPDFAKAA 1544
            + + + L  K GK   I ++ FK+  D  + ++     EIDG  +++          +++  K S    D  K                        L ++NL +S T+E L++ F+ A+ +K P N NGKSKG  ++ F S E A  A+     + I GR IR         LEL+  + +    ++        TLF   L +  T + +K  FD      I+  ++    KG   V F   + AKAA
Sbjct:   16 DAAEIRLVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWSDDSRKTDQSSAYVRTTSRTLQHVLGESKTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIR---------LELQGPRGSPNARSQPSK-----TLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAA 251          

HSP 2 Score: 53.1434 bits (126), Expect = 6.659e-7
Identity = 54/200 (27.00%), Postives = 95/200 (47.50%), Query Frame = 3
Query: 1113 LPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYM---KRDQDLELKK--------KKSNKE----RLAKKKL-----EGNVVTLFNLPKSVTVDEIKAKFDHVKFVHIIKKDNI-FKGIAEVHFIKPDFAKAAIDV-PLFKMSGREIRKELKGGKWRDRVVTNSRFKP 1646
            LP+  T++EL++ F+ A+ ++  ++ +GKSKG  Y+ F++   A    E  +   I+GR I   Y     ++QD    K        +K+++     R   + L     E   + L NL  S T + ++  F+   F+ + +  N   KG A + F   + AK A++     ++ GR IR EL+G     R   N+R +P
Sbjct:    1 LPYKVTQDELKEVFEDAAEIRL-VSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWSDDSRKTDQSSAYVRTTSRTLQHVLGESKTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQG----PRGSPNARSQP 195          
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: PABPC4L (poly(A) binding protein cytoplasmic 4 like [Source:HGNC Symbol;Acc:HGNC:31955])

HSP 1 Score: 51.9878 bits (123), Expect = 2.042e-6
Identity = 76/315 (24.13%), Postives = 134/315 (42.54%), Query Frame = 3
Query:  705 ALIEFVNPLVTDAVIDKLNSSIIDGNKLVAEFKHKLVTETEEEKLFTLRIGN---------LSETTSYETIKSLEFNCSSMHLTKKSG-KRICFLSFKSNKDLTEAYQALLNKEIDGSKVTVKLVEFKTNKLSEEEF-----DLMKLHITNLPFSCTKEELEKEFQMAS---SLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKI---RCQYMKRDQDLELKKKKSNKERLAKKKLEGNVVTLFNLPKSVTVDEIK---AKFDHVKFVHIIKKDNIFKGIAEVHFIKPDFAKAAIDVPLFKMSGR 1577
            A + F+        +D +N  II G  +      +L+    +  L    IGN         +   T YE   +     SS  ++   G K   F+ F++      A + +  K + G KV V    FK  K  E E      +   ++I N       E L+  F       S+K   +++GKSKG  ++SF+S E A  A+E    + ING+ I   R Q  K ++  ELK+     +R   +  +G  + + NL  ++  ++++   + F  +  V +++++   KG   + F  P+ A  A+     +M+GR
Sbjct:   54 AYVNFLQLADAQKALDTMNFDIIKGKSI------RLMWSQRDAYLRRSGIGNVFIKNLDKSIDNKTLYEHFSAFGKILSSKVMSDDQGSKGYAFVHFQNQSAADRAIEEMNGKLLKGCKVFVG--RFKNRKDREAELRSKASEFTNVYIKNFGGDMDDERLKDVFSKYGKTLSVKVMTDSSGKSKGFGFVSFDSHEAAKKAVEEMNGRDINGQLIFVGRAQ-KKVERQAELKQMFEQLKRERIRGCQGVKLYIKNLDDTIDDEKLRNEFSSFGSISRVKVMQEEGQSKGFGLICFSSPEDATKAMT----EMNGR 355          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: pab-1 (Polyadenylate-binding protein [Source:UniProtKB/TrEMBL;Acc:Q7K797])

HSP 1 Score: 53.9138 bits (128), Expect = 2.651e-7
Identity = 62/265 (23.40%), Postives = 120/265 (45.28%), Query Frame = 3
Query:  705 ALIEFVNPLVTDAVIDKLNSSIIDGNKL-VAEFKHKLVTE---TEEEKLFT-LRIGNLSETTSYETIKSL--EFN----CSSMHLTKKSGKRICFLSFKSNKDLTEAYQALLNKEIDGS--KVTVKLVEFKTNKLSE-------------EEFDLMKLHITNLPFSCTKEELEKEFQMA---SSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSNKERLAKKKLEGNV--VTLFN 1406
              + F         I K+N  ++ G K+ V +F+ +        E  K FT + + N  +  + ET++ L  +F     C  M +  KS K   F++F + ++   A QAL +  I+G+  K+ V   + K+ + +E             +++  + L++ NL  +   + L+K+F+     +S K   + NG+SKG  ++ FE  E A  A+     K++  + +     +R +D   +      +RLA  ++ GNV    ++N
Sbjct:  163 GFVHFETEEAAQNAIQKVNGMLLAGKKVFVGKFQPRAQRNRELGETAKQFTNVYVKNFGDHYNKETLEKLFAKFGNITSCEVMTVEGKS-KGFGFVAFANPEEAETAVQALHDSTIEGTDLKLHVCRAQKKSERHAELKKKHEQHKAERMQKYQGVNLYVKNLDETVDDDGLKKQFESYGNITSAKVMTDENGRSKGFGFVCFEKPEEATSAVTEMNSKMVCSKPLYVAIAQRKEDRRAQLASQYMQRLASMRMHGNVPGAAMYN 426          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: pab-1 (Polyadenylate-binding protein [Source:UniProtKB/TrEMBL;Acc:Q7K797])

HSP 1 Score: 53.9138 bits (128), Expect = 2.651e-7
Identity = 62/265 (23.40%), Postives = 120/265 (45.28%), Query Frame = 3
Query:  705 ALIEFVNPLVTDAVIDKLNSSIIDGNKL-VAEFKHKLVTE---TEEEKLFT-LRIGNLSETTSYETIKSL--EFN----CSSMHLTKKSGKRICFLSFKSNKDLTEAYQALLNKEIDGS--KVTVKLVEFKTNKLSE-------------EEFDLMKLHITNLPFSCTKEELEKEFQMA---SSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSNKERLAKKKLEGNV--VTLFN 1406
              + F         I K+N  ++ G K+ V +F+ +        E  K FT + + N  +  + ET++ L  +F     C  M +  KS K   F++F + ++   A QAL +  I+G+  K+ V   + K+ + +E             +++  + L++ NL  +   + L+K+F+     +S K   + NG+SKG  ++ FE  E A  A+     K++  + +     +R +D   +      +RLA  ++ GNV    ++N
Sbjct:  163 GFVHFETEEAAQNAIQKVNGMLLAGKKVFVGKFQPRAQRNRELGETAKQFTNVYVKNFGDHYNKETLEKLFAKFGNITSCEVMTVEGKS-KGFGFVAFANPEEAETAVQALHDSTIEGTDLKLHVCRAQKKSERHAELKKKHEQHKAERMQKYQGVNLYVKNLDETVDDDGLKKQFESYGNITSAKVMTDENGRSKGFGFVCFEKPEEATSAVTEMNSKMVCSKPLYVAIAQRKEDRRAQLASQYMQRLASMRMHGNVPGAAMYN 426          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: pab-1 (Polyadenylate-binding protein [Source:UniProtKB/TrEMBL;Acc:Q7K797])

HSP 1 Score: 53.9138 bits (128), Expect = 2.651e-7
Identity = 62/265 (23.40%), Postives = 120/265 (45.28%), Query Frame = 3
Query:  705 ALIEFVNPLVTDAVIDKLNSSIIDGNKL-VAEFKHKLVTE---TEEEKLFT-LRIGNLSETTSYETIKSL--EFN----CSSMHLTKKSGKRICFLSFKSNKDLTEAYQALLNKEIDGS--KVTVKLVEFKTNKLSE-------------EEFDLMKLHITNLPFSCTKEELEKEFQMA---SSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSNKERLAKKKLEGNV--VTLFN 1406
              + F         I K+N  ++ G K+ V +F+ +        E  K FT + + N  +  + ET++ L  +F     C  M +  KS K   F++F + ++   A QAL +  I+G+  K+ V   + K+ + +E             +++  + L++ NL  +   + L+K+F+     +S K   + NG+SKG  ++ FE  E A  A+     K++  + +     +R +D   +      +RLA  ++ GNV    ++N
Sbjct:  163 GFVHFETEEAAQNAIQKVNGMLLAGKKVFVGKFQPRAQRNRELGETAKQFTNVYVKNFGDHYNKETLEKLFAKFGNITSCEVMTVEGKS-KGFGFVAFANPEEAETAVQALHDSTIEGTDLKLHVCRAQKKSERHAELKKKHEQHKAERMQKYQGVNLYVKNLDETVDDDGLKKQFESYGNITSAKVMTDENGRSKGFGFVCFEKPEEATSAVTEMNSKMVCSKPLYVAIAQRKEDRRAQLASQYMQRLASMRMHGNVPGAAMYN 426          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: pab-1 (Polyadenylate-binding protein [Source:UniProtKB/TrEMBL;Acc:Q7K797])

HSP 1 Score: 53.9138 bits (128), Expect = 2.651e-7
Identity = 62/265 (23.40%), Postives = 120/265 (45.28%), Query Frame = 3
Query:  705 ALIEFVNPLVTDAVIDKLNSSIIDGNKL-VAEFKHKLVTE---TEEEKLFT-LRIGNLSETTSYETIKSL--EFN----CSSMHLTKKSGKRICFLSFKSNKDLTEAYQALLNKEIDGS--KVTVKLVEFKTNKLSE-------------EEFDLMKLHITNLPFSCTKEELEKEFQMA---SSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSNKERLAKKKLEGNV--VTLFN 1406
              + F         I K+N  ++ G K+ V +F+ +        E  K FT + + N  +  + ET++ L  +F     C  M +  KS K   F++F + ++   A QAL +  I+G+  K+ V   + K+ + +E             +++  + L++ NL  +   + L+K+F+     +S K   + NG+SKG  ++ FE  E A  A+     K++  + +     +R +D   +      +RLA  ++ GNV    ++N
Sbjct:  163 GFVHFETEEAAQNAIQKVNGMLLAGKKVFVGKFQPRAQRNRELGETAKQFTNVYVKNFGDHYNKETLEKLFAKFGNITSCEVMTVEGKS-KGFGFVAFANPEEAETAVQALHDSTIEGTDLKLHVCRAQKKSERHAELKKKHEQHKAERMQKYQGVNLYVKNLDETVDDDGLKKQFESYGNITSAKVMTDENGRSKGFGFVCFEKPEEATSAVTEMNSKMVCSKPLYVAIAQRKEDRRAQLASQYMQRLASMRMHGNVPGAAMYN 426          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: pab-1 (Polyadenylate-binding protein [Source:UniProtKB/TrEMBL;Acc:Q7K797])

HSP 1 Score: 53.9138 bits (128), Expect = 2.651e-7
Identity = 62/265 (23.40%), Postives = 120/265 (45.28%), Query Frame = 3
Query:  705 ALIEFVNPLVTDAVIDKLNSSIIDGNKL-VAEFKHKLVTE---TEEEKLFT-LRIGNLSETTSYETIKSL--EFN----CSSMHLTKKSGKRICFLSFKSNKDLTEAYQALLNKEIDGS--KVTVKLVEFKTNKLSE-------------EEFDLMKLHITNLPFSCTKEELEKEFQMA---SSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSNKERLAKKKLEGNV--VTLFN 1406
              + F         I K+N  ++ G K+ V +F+ +        E  K FT + + N  +  + ET++ L  +F     C  M +  KS K   F++F + ++   A QAL +  I+G+  K+ V   + K+ + +E             +++  + L++ NL  +   + L+K+F+     +S K   + NG+SKG  ++ FE  E A  A+     K++  + +     +R +D   +      +RLA  ++ GNV    ++N
Sbjct:  163 GFVHFETEEAAQNAIQKVNGMLLAGKKVFVGKFQPRAQRNRELGETAKQFTNVYVKNFGDHYNKETLEKLFAKFGNITSCEVMTVEGKS-KGFGFVAFANPEEAETAVQALHDSTIEGTDLKLHVCRAQKKSERHAELKKKHEQHKAERMQKYQGVNLYVKNLDETVDDDGLKKQFESYGNITSAKVMTDENGRSKGFGFVCFEKPEEATSAVTEMNSKMVCSKPLYVAIAQRKEDRRAQLASQYMQRLASMRMHGNVPGAAMYN 426          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: ncl (nucleolin [Source:ZFIN;Acc:ZDB-GENE-030131-6986])

HSP 1 Score: 70.4774 bits (171), Expect = 2.916e-12
Identity = 63/242 (26.03%), Postives = 115/242 (47.52%), Query Frame = 3
Query:  840 FTLRIGNLSETTSYETIKS----------LEFNCSSMHLTKKSGKRICFLSFKSNKDLTEAYQALLNKEIDGSKV---TVKLVEFKTNKLSEE---EFDLMKLHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSNKERLAKKKLEGNVVTLFNLPKSVTVDEIKAKFDHVKFVHIIKKDNIFKGIAEVHF 1517
            F+L +GNL+    ++ +KS          LE     +  TKK G    ++ F S ++L +A       E++G K+    VKL + ++ + S+E   E D   L + NLP+S T+++L + F  A  ++ P+ N G S+G  Y+ F++  +A  A+E  +   + GR I   +         K ++  +   +  K    V+ + NL  S + D +++ F+    + I + +   KG A V F
Sbjct:  286 FSLFLGNLNNNKDFDELKSAISKFFSKEGLEIQDVRLGGTKKFG----YVDFASEEELQKAL------ELNGKKLLGQPVKLDKARSKENSQENKKERDARTLFVKNLPYSITQDDLREIFDQAVDIRVPMGNTGTSRGIAYIEFKTEAIAEKALEEAQGSDVQGRSIIVDFTGD------KSRQGGRGAPSASK----VLVVNNLAFSASEDSLQSVFEKAVSIRIPQNNGRPKGYAFVEF 507          

HSP 2 Score: 58.5362 bits (140), Expect = 1.569e-8
Identity = 35/129 (27.13%), Postives = 66/129 (51.16%), Query Frame = 3
Query:  942 KRICFLSFKSNKDLTEAYQALLNKEIDGSKVTVKLVEFKTNKLSEEEFDLMK-LHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQD 1325
            + I ++ FK+     +A +     ++ G  + V     K+ +         K L + NL FS +++ L+  F+ A S++ P  NNG+ KG  ++ FE++E +  A+E   +  I GR IR +Y + D++
Sbjct:  413 RGIAYIEFKTEAIAEKALEEAQGSDVQGRSIIVDFTGDKSRQGGRGAPSASKVLVVNNLAFSASEDSLQSVFEKAVSIRIP-QNNGRPKGYAFVEFENVEDSKEALENCNNTDIEGRSIRLEYSQNDRE 540          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: ncl (nucleolin [Source:ZFIN;Acc:ZDB-GENE-030131-6986])

HSP 1 Score: 70.4774 bits (171), Expect = 2.918e-12
Identity = 63/242 (26.03%), Postives = 115/242 (47.52%), Query Frame = 3
Query:  840 FTLRIGNLSETTSYETIKS----------LEFNCSSMHLTKKSGKRICFLSFKSNKDLTEAYQALLNKEIDGSKV---TVKLVEFKTNKLSEE---EFDLMKLHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSNKERLAKKKLEGNVVTLFNLPKSVTVDEIKAKFDHVKFVHIIKKDNIFKGIAEVHF 1517
            F+L +GNL+    ++ +KS          LE     +  TKK G    ++ F S ++L +A       E++G K+    VKL + ++ + S+E   E D   L + NLP+S T+++L + F  A  ++ P+ N G S+G  Y+ F++  +A  A+E  +   + GR I   +         K ++  +   +  K    V+ + NL  S + D +++ F+    + I + +   KG A V F
Sbjct:  287 FSLFLGNLNNNKDFDELKSAISKFFSKEGLEIQDVRLGGTKKFG----YVDFASEEELQKAL------ELNGKKLLGQPVKLDKARSKENSQENKKERDARTLFVKNLPYSITQDDLREIFDQAVDIRVPMGNTGTSRGIAYIEFKTEAIAEKALEEAQGSDVQGRSIIVDFTGD------KSRQGGRGAPSASK----VLVVNNLAFSASEDSLQSVFEKAVSIRIPQNNGRPKGYAFVEF 508          

HSP 2 Score: 58.5362 bits (140), Expect = 1.570e-8
Identity = 35/129 (27.13%), Postives = 66/129 (51.16%), Query Frame = 3
Query:  942 KRICFLSFKSNKDLTEAYQALLNKEIDGSKVTVKLVEFKTNKLSEEEFDLMK-LHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQD 1325
            + I ++ FK+     +A +     ++ G  + V     K+ +         K L + NL FS +++ L+  F+ A S++ P  NNG+ KG  ++ FE++E +  A+E   +  I GR IR +Y + D++
Sbjct:  414 RGIAYIEFKTEAIAEKALEEAQGSDVQGRSIIVDFTGDKSRQGGRGAPSASKVLVVNNLAFSASEDSLQSVFEKAVSIRIP-QNNGRPKGYAFVEFENVEDSKEALENCNNTDIEGRSIRLEYSQNDRE 541          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: ncl (nucleolin [Source:ZFIN;Acc:ZDB-GENE-030131-6986])

HSP 1 Score: 65.855 bits (159), Expect = 4.317e-11
Identity = 58/224 (25.89%), Postives = 109/224 (48.66%), Query Frame = 3
Query:  942 KRICFLSFKSNKDLTEAYQALLNKEIDGSKV---TVKLVEFKTNKLSEE---EFDLMKLHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSNKERLAKKKLEGNVVTLFNLPKSVTVDEIKAKFDHVKFVHIIKKDNIFKGIAEVHFIKPDFAKAAID-VPLFKMSGREIRKE 1592
            K+  ++ F S ++L +A       E++G K+    VKL + ++ + S+E   E D   L + NLP+S T+++L + F  A  ++ P+ N G S+G  Y+ F++  +A  A+E  +   + GR I   +         K ++  +   +  K    V+ + NL  S + D +++ F+    + I + +   KG A V F   + +K A++      + GR IR E
Sbjct:    9 KKFGYVDFASEEELQKAL------ELNGKKLLGQPVKLDKARSKENSQENKKERDARTLFVKNLPYSITQDDLREIFDQAVDIRVPMGNTGTSRGIAYIEFKTEAIAEKALEEAQGSDVQGRSIIVDFTGD------KSRQGGRGAPSASK----VLVVNNLAFSASEDSLQSVFEKAVSIRIPQNNGRPKGYAFVEFENVEDSKEALENCNNTDIEGRSIRLE 216          

HSP 2 Score: 58.151 bits (139), Expect = 1.248e-8
Identity = 35/129 (27.13%), Postives = 66/129 (51.16%), Query Frame = 3
Query:  942 KRICFLSFKSNKDLTEAYQALLNKEIDGSKVTVKLVEFKTNKLSEEEFDLMK-LHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQD 1325
            + I ++ FK+     +A +     ++ G  + V     K+ +         K L + NL FS +++ L+  F+ A S++ P  NNG+ KG  ++ FE++E +  A+E   +  I GR IR +Y + D++
Sbjct:   96 RGIAYIEFKTEAIAEKALEEAQGSDVQGRSIIVDFTGDKSRQGGRGAPSASKVLVVNNLAFSASEDSLQSVFEKAVSIRIP-QNNGRPKGYAFVEFENVEDSKEALENCNNTDIEGRSIRLEYSQNDRE 223          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000021867.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:110077918:110087594:1 gene:ENSXETG00000011157.1 transcript:ENSXETT00000021867.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.6406 bits (187), Expect = 5.502e-14
Identity = 73/268 (27.24%), Postives = 130/268 (48.51%), Query Frame = 3
Query:  822 TEEEKLFTLRIGNLSETTSYETIKSL--EF----NCSSMHLTKKSGKRICFLSFKSNKDLTEAYQALLNKEIDGSKVTV-KLVEFKTNKLSE--EEFDLMKLHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSNKERLAKKKLEGNVVTLFNLPKSVTVDEIKAKFDHVKFVHIIKKDNIFKGIAEVHFIKPDFAKAAID-VPLFKMSGREIRKEL 1595
            T+  +  ++ IGNL+ +  ++ +K    EF    N +   +   + K+  ++ F S +++ +A + L  K+I GS+V + K + F  NK +E  +E D   L + N+P+S T EEL++ F+ A  ++ P   +G +KG  Y+ F +   A  A+E  +   I GR I   +         K + S   R+  +  +  V+ + NL  S T D ++  F+    + I +     KG A + F   + AK A+D     ++ GR IR E 
Sbjct:  244 TDTSEGLSIFIGNLNASKDFDELKDALREFFSKKNLTVQDVRIGNSKKFGYVDFSSEEEVEQALK-LSGKKILGSEVKIEKAMAFDKNKNAENKKERDSRTLFVKNIPYSTTAEELQEIFENAKDIRIPTGKDGANKGIAYVEFSNETEATKALEEKQGAEIEGRSIFVDFTGE------KSQNSGSRRV--QGGDSKVLVVNNLSYSATEDSLREVFEKATSIRIPQNQGRAKGFAFIEFSSVEDAKEAMDSCNNTEIEGRSIRLEF 502          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000021886.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:110077918:110087594:1 gene:ENSXETG00000011157.1 transcript:ENSXETT00000021886.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.0998 bits (183), Expect = 1.520e-13
Identity = 73/268 (27.24%), Postives = 130/268 (48.51%), Query Frame = 3
Query:  822 TEEEKLFTLRIGNLSETTSYETIKSL--EF----NCSSMHLTKKSGKRICFLSFKSNKDLTEAYQALLNKEIDGSKVTV-KLVEFKTNKLSE--EEFDLMKLHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSNKERLAKKKLEGNVVTLFNLPKSVTVDEIKAKFDHVKFVHIIKKDNIFKGIAEVHFIKPDFAKAAID-VPLFKMSGREIRKEL 1595
            T+  +  ++ IGNL+ +  ++ +K    EF    N +   +   + K+  ++ F S +++ +A + L  K+I GS+V + K + F  NK +E  +E D   L + N+P+S T EEL++ F+ A  ++ P   +G +KG  Y+ F +   A  A+E  +   I GR I   +         K + S   R+  +  +  V+ + NL  S T D ++  F+    + I +     KG A + F   + AK A+D     ++ GR IR E 
Sbjct:  290 TDTSEGLSIFIGNLNASKDFDELKDALREFFSKKNLTVQDVRIGNSKKFGYVDFSSEEEVEQALK-LSGKKILGSEVKIEKAMAFDKNKNAENKKERDSRTLFVKNIPYSTTAEELQEIFENAKDIRIPTGKDGANKGIAYVEFSNETEATKALEEKQGAEIEGRSIFVDFTGE------KSQNSGSRRV--QGGDSKVLVVNNLSYSATEDSLREVFEKATSIRIPQNQGRAKGFAFIEFSSVEDAKEAMDSCNNTEIEGRSIRLEF 548          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000021882.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:110077918:110087594:1 gene:ENSXETG00000011157.1 transcript:ENSXETT00000021882.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.2478 bits (173), Expect = 2.723e-12
Identity = 63/222 (28.38%), Postives = 109/222 (49.10%), Query Frame = 3
Query:  942 KRICFLSFKSNKDLTEAYQALLNKEIDGSKVTV-KLVEFKTNKLSE--EEFDLMKLHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSNKERLAKKKLEGNVVTLFNLPKSVTVDEIKAKFDHVKFVHIIKKDNIFKGIAEVHFIKPDFAKAAID-VPLFKMSGREIRKEL 1595
            ++  ++ F S +++ +A + L  K+I GS+V + K + F  NK +E  +E D   L + N+P+S T EEL++ F+ A  ++ P   +G +KG  Y+ F +   A  A+E  +   I GR I   +         K + S   R+  +  +  V+ + NL  S T D ++  F+    + I +     KG A + F   + AK A+D     ++ GR IR E 
Sbjct:  315 RKFGYVDFSSEEEVEQALK-LSGKKILGSEVKIEKAMAFDKNKNAENKKERDSRTLFVKNIPYSTTAEELQEIFENAKDIRIPTGKDGANKGIAYVEFSNETEATKALEEKQGAEIEGRSIFVDFTGE------KSQNSGSRRV--QGGDSKVLVVNNLSYSATEDSLREVFEKATSIRIPQNQGRAKGFAFIEFSSVEDAKEAMDSCNNTEIEGRSIRLEF 527          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Ncl (nucleolin [Source:MGI Symbol;Acc:MGI:97286])

HSP 1 Score: 64.6994 bits (156), Expect = 2.326e-10
Identity = 50/162 (30.86%), Postives = 78/162 (48.15%), Query Frame = 3
Query:  843 TLRIGNLSETTSYETIKSLEFNCSSMHLTKKSGKR--ICFLSFKSNKDLTEAYQALLNKEIDGSKVTVKLV------EFKTNKLSEEEFDLMKLHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQ 1304
            TL   NLS   + + +K +  +   + L  + GK   I ++ FKS  D  +  +     EIDG  V++         + +T K S    +   L ++NL +S TKE LE+ F+ A+ +K P N +GK KG  ++ F S E A  A+       I GR IR +
Sbjct:  396 TLLAKNLSFNITEDELKEVFEDAMEIRLVSQDGKSKGIAYIEFKSEADAEKNLEEKQGAEIDGRSVSLYYTGEKGQRQERTGKTSTWSGESKTLVLSNLSYSATKETLEEVFEKATFIKVPQNPHGKPKGYAFIEFASFEDAKEALNSCNKMEIEGRTIRLE 557          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|P20397|NUCL_XENLA (Nucleolin OS=Xenopus laevis OX=8355 GN=ncl PE=2 SV=3)

HSP 1 Score: 78.5666 bits (192), Expect = 7.122e-14
Identity = 83/283 (29.33%), Postives = 139/283 (49.12%), Query Frame = 3
Query:  783 KLVAEFKHKLVTETEEEKLFTLRIGNLSETTSYETIKSL--EF----NCSSMHLTKKSGKRICFLSFKSNKDLTEAYQALLNKEIDGSKVTV-KLVEFKTNKLSE--EEFDLMKLHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSNKERLAKKKLEGN--VVTLFNLPKSVTVDEIKAKFDHVKFVHIIKKDNIFKGIAEVHFIKPDFAKAAID-VPLFKMSGREIRKEL 1595
            K + E K K  T+T  E L ++ IGNL+ T  ++ +K    EF    N +   +   + K+  ++ F S +++ +A + L  K+I G++V + K + F  NK +E  +E D   L + N+P+S T EEL++ F+ A  ++ P   +G +KG  Y+ F + + A  A+E  +   I GR I   +       E  +   N     KK  EG+  V+ + NL  S T D ++  F+    + I +     KG A + F   + AK A+D     ++ GR IR E 
Sbjct:  216 KTIPEAK-KTKTDTASEGL-SIFIGNLNSTKEFDELKDALREFFSKKNLTIQDIRIGNSKKFGYVDFSSEEEVEKALK-LTGKKILGTEVKIEKAMAFDKNKTAENKKERDSRTLFVKNIPYSTTVEELQEIFENAKDIRIPTGKDGSNKGIAYVEFSNEDEANKALEEKQGAEIEGRSIFVDFTG-----EKSQNSGN-----KKGPEGDSKVLVVNNLSYSATEDSLREVFEKATSIRIPQNQGRAKGFAFIEFSSAEDAKDAMDSCNNTEIEGRSIRLEF 485          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|P19338|NUCL_HUMAN (Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3)

HSP 1 Score: 70.8626 bits (172), Expect = 1.960e-11
Identity = 67/247 (27.13%), Postives = 110/247 (44.53%), Query Frame = 3
Query:  843 TLRIGNLSETTSYETIKSLEFNCSSMHLTKKSGKR--ICFLSFKSNKDLTEAYQALLNKEIDGSKVTVKLV-------EFKTNKLSEEEFDLMKLHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSNKERLAKKKLEGNVVTLF--NLPKSVTVDEIKAKFDHVKFVHII--KKDNIFKGIAEVHFIKPDFAKAA 1544
            TL   NL    + + +K +  + + + L  K GK   I ++ FK+  D  + ++     EIDG  +++          +++  K S    +   L ++NL +S T+E L++ F+ A+ +K P N NGKSKG  ++ F S E A  A+     + I GR IR +       L+  +   N      K       TLF   L +  T + +K  FD      I+  ++    KG   V F   + AKAA
Sbjct:  394 TLLAKNLPYKVTQDELKEVFEDAAEIRLVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWSGESKTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLE-------LQGPRGSPNARSQPSK-------TLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAA 626          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5RF26|NUCL_PONAB (Nucleolin OS=Pongo abelii OX=9601 GN=NCL PE=2 SV=3)

HSP 1 Score: 70.8626 bits (172), Expect = 1.964e-11
Identity = 67/247 (27.13%), Postives = 110/247 (44.53%), Query Frame = 3
Query:  843 TLRIGNLSETTSYETIKSLEFNCSSMHLTKKSGKR--ICFLSFKSNKDLTEAYQALLNKEIDGSKVTVKLV-------EFKTNKLSEEEFDLMKLHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSNKERLAKKKLEGNVVTLF--NLPKSVTVDEIKAKFDHVKFVHII--KKDNIFKGIAEVHFIKPDFAKAA 1544
            TL   NL    + + +K +  + + + L  K GK   I ++ FK+  D  + ++     EIDG  +++          +++  K S    +   L ++NL +S T+E L++ F+ A+ +K P N NGKSKG  ++ F S E A  A+     + I GR IR +       L+  +   N      K       TLF   L +  T + +K  FD      I+  ++    KG   V F   + AKAA
Sbjct:  396 TLLAKNLPYKVTQDELKEVFEDAAEIRLVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWSGESKTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLE-------LQGPRGSPNARSQPSK-------TLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAA 628          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4R4J7|NUCL_MACFA (Nucleolin OS=Macaca fascicularis OX=9541 GN=NCL PE=2 SV=3)

HSP 1 Score: 70.8626 bits (172), Expect = 2.067e-11
Identity = 47/163 (28.83%), Postives = 81/163 (49.69%), Query Frame = 3
Query:  843 TLRIGNLSETTSYETIKSLEFNCSSMHLTKKSGKR--ICFLSFKSNKDLTEAYQALLNKEIDGSKVTVKLV-------EFKTNKLSEEEFDLMKLHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQ 1304
            TL   NL    + + +K +  + + + L  K GK   I ++ FK+  D  + ++     EIDG  +++          +++  K S    +   L ++NL +S T+E L++ F+ A+ +K P N NGKSKG  ++ F S E A  A+     + I GR IR +
Sbjct:  395 TLLAKNLPYKVTQDELKEVFEDAAEIRLVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWSGESKTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLE 557          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|P09405|NUCL_MOUSE (Nucleolin OS=Mus musculus OX=10090 GN=Ncl PE=1 SV=2)

HSP 1 Score: 64.6994 bits (156), Expect = 1.627e-9
Identity = 50/162 (30.86%), Postives = 78/162 (48.15%), Query Frame = 3
Query:  843 TLRIGNLSETTSYETIKSLEFNCSSMHLTKKSGKR--ICFLSFKSNKDLTEAYQALLNKEIDGSKVTVKLV------EFKTNKLSEEEFDLMKLHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQ 1304
            TL   NLS   + + +K +  +   + L  + GK   I ++ FKS  D  +  +     EIDG  V++         + +T K S    +   L ++NL +S TKE LE+ F+ A+ +K P N +GK KG  ++ F S E A  A+       I GR IR +
Sbjct:  396 TLLAKNLSFNITEDELKEVFEDAMEIRLVSQDGKSKGIAYIEFKSEADAEKNLEEKQGAEIDGRSVSLYYTGEKGQRQERTGKTSTWSGESKTLVLSNLSYSATKETLEEVFEKATFIKVPQNPHGKPKGYAFIEFASFEDAKEALNSCNKMEIEGRTIRLE 557          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A0X3NVL6 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR135955 PE=4 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 9.156e-22
Identity = 78/246 (31.71%), Postives = 122/246 (49.59%), Query Frame = 3
Query:  897 LEFNCSSMHLTKKSGKRICFLSFKSNKDLTEAYQALLNKEIDGSKVTVKLVEFKTNKLSEEEFDLMKL----------HITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSNKERLAKKK--LEGNVVTLFNLPKSVTVDEIKAKFDHVKFVHIIKKDNIFKGIAEVHFIKPDFAKAAI-DVPLFKMSGREIRKEL 1595
            L F C S+ L KKSGKR   +SF + ++   A+ AL + E +GSKV    V+ +      +  +L KL          +ITN+PFS ++E+LE+ F  A  +      +GKSKG C LSF + +     ++  + K I+GR+I C  +   ++L     ++    L K+K  LEG  + LFN+P   +  E+K  F   + +   +      GIA V F  P   K A+      K+  R+IR E+
Sbjct:    2 LPFRCKSLELFKKSGKRNGVISFSTPEECGAAFDALQSFEYEGSKVIASFVQPRAKPPVPKPAELAKLLPSGKQEYCLNITNIPFSTSQEQLEESFPTAEHVIMRRRKDGKSKGSCMLSFSNADDCKSVLDACRHKEIDGRRIICT-LGTSEELSALVAETIARGLPKRKLDLEGCQLKLFNVPYDTSERELKKIFPQSRHIFFPEVKGSPAGIALVTFKTPTICKVALKKASHLKLQNRKIRAEI 246          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A183T105 (RRM domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS10153 PE=4 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 1.357e-20
Identity = 82/259 (31.66%), Postives = 131/259 (50.58%), Query Frame = 3
Query:  735 TDAVIDKLNS--SIIDGNKLVAEFKHKLVTETEEEKLFTLRIGNLSETTSYETIKS-LEFNCSSMHLTKKSGKRICFLSFKSNKDLTEAYQALLNKEIDGSKVTVKLVEFKTNKLSEEEFDLMKL----------HITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSNKERLAKKK--LEGNVVTLFNLPKSVTVDEIKAKFDHVKFV 1466
            +++V+D  +S  S++D +  V EFK     E    K   L +  L  T  Y T K+ L F C S+ L KKSGKR   +SF + ++   A+ AL + E +GSKV    V+ +      +  +L KL          +ITN+PFS ++E+LE+ F  A  +      +GKSKG C LSF + +     ++  + K I+GR+I C  +   ++L     ++    L K+K  LEG  + LFN+P   +  E+K  F   + +
Sbjct:  117 SESVVDNAHSPSSLVDDHAGV-EFK---TNEDLRGKATALLLKELPSTVKYATFKTMLPFRCKSLELFKKSGKRNGVISFSTPEECGAAFDALQSFEYEGSKVIASFVQPRAKPPVPKPAELAKLLPSGKQEYCLNITNIPFSTSQEQLEESFPTAEHVIMRRRKDGKSKGSCMLSFSNADDCKSVLDACRHKEIDGRRIICT-LGTSEELSALVAETIARGLPKRKLDLEGCQLKLFNVPYDTSERELKKIFPQSRHI 370          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A3P7LAW2 (RRM domain-containing protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS6401 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.541e-17
Identity = 71/215 (33.02%), Postives = 106/215 (49.30%), Query Frame = 3
Query:  861 LSETTSYETIKS-LEFNCSSMHLTKKSGKRICFLSFKSNKDLTEAYQALLNKEIDGSKVTVKLVEFKTNKLSEEEFDLMKL----------HITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSNKERLAKKK--LEGNVVTLFNLPKSVTVDEIKAKFDHVKFV 1466
            L  T  Y T ++ L F C  + L KKSGKR   LSF +  +   A+ AL + E +GSKV    V+ +         +L KL          +ITN+ FS ++E+LE+ F  A  +      +GKSKG C LSF + +     ++  + K I+GR+I C  M   +DL     ++    L K+K  LEG  + LFN+P   T  E+K  F   + +
Sbjct:  205 LPSTVKYTTFRTMLPFRCK-LELFKKSGKRNGLLSFSTPTECGAAFDALQSFEYEGSKVVASFVQPRAKPPVPSPAELSKLLPSDKQEYCLNITNISFSTSQEKLEESFPTAEHVIMRRRKDGKSKGSCMLSFSNADDCKTVLDACRHKEIDGRRIVCT-MGTSEDLSALVAETIARGLPKRKPDLEGCQLKLFNVPYDTTEQELKKIFPQSRHI 417          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A504YNC6 (RRM domain-containing protein OS=Fasciola gigantica OX=46835 GN=FGIG_09232 PE=4 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.809e-15
Identity = 64/214 (29.91%), Postives = 107/214 (50.00%), Query Frame = 3
Query:  843 TLRIGNLSETTSYETIKSLEFNCSSMHLTKKSGKRICFLSFKSNKDLTEAYQALLNKEIDGSKVTVKLV---EFKTNK--LSEEEFDLMKLHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSN-KERLAKKKLEGNVVTLFNLPKSVTVDEIKAKFDHVKFV 1466
            +L + +L  T  Y  +K++    S + L KK+GKR  F  F S ++ +     L N +I G +V V       FK +    S E  D   LH++NLPF+ T+E+LE+EF  AS +    N++G+ +G C L F+S +      +  + + I GR +RC        +++  K +N K   A  KL G  + +  +P  +   E++A F+  K +
Sbjct:   77 SLILKHLPPTIDYSQLKAIVPTASRLELYKKNGKRHAFARFSSTEECSTVASKLRNLKISGQEVAVAFASHSRFKQSHAATSSEADDSTTLHLSNLPFNITQEKLEEEFPTASQIVMNRNSHGRFRGSCLLQFDSPDDCCTVRDACRGRQIEGRPLRCSLA-----IKMDVKHTNTKSEAASAKLFG--LKVKGVPTHIDESELRALFNQHKLI 283          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A183AQX7 (RRM domain-containing protein OS=Echinostoma caproni OX=27848 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 9.243e-15
Identity = 49/160 (30.63%), Postives = 84/160 (52.50%), Query Frame = 3
Query:  846 LRIGNLSETTSYETIKSLEFNCSSMHLTKKSGKRICFLSFKSNKDLTEAYQALLNKEIDGSKVTVKLVEFKTNKLSEEEFDLMK--------LHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRC 1301
            L + NL  T  Y  +K +    S + L KK GKR  F  F + ++ +     L N +I G ++ V    F ++ LS++              LH++NLPFS T++ LE+EF  AS +   +N++G+ +G C L F+S++   +  +  + + I+GR +RC
Sbjct:    1 LVLKNLPPTIDYSQLKGVVPTASRLELYKKHGKRHAFARFSTTEECSLVASKLRNLKIGGHEIGV---AFASHSLSKQPRPATSPDVENATVLHVSNLPFSITQQRLEEEFPTASRVVMNINSHGRFRGSCLLHFDSVDDCRIVRDACRGRQIDGRPLRC 157          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: ncl (nucleolin [Source:ZFIN;Acc:ZDB-GENE-030131-6986])

HSP 1 Score: 65.855 bits (159), Expect = 3.302e-11
Identity = 62/218 (28.44%), Postives = 97/218 (44.50%), Query Frame = 3
Query:  936 SGKRICFLSFKSNKDLTEAYQALLNKEIDGSKVTVK--LVEFKTNKLSEEEFDLMKLHIT---------NLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSNKERLAKKKLEGNVVTLF--NLPKSVTVDEIKAKFDHVKFVHII--KKDNIFKGIAEVHFIKPDFAKAA 1544
            SG+ I ++ FK     TEA    + +E  GS V  +  +V+F   K  +++       ++         NL FS T++ L+  F+ A S++ P  NNG+SKG  ++ FE+ + +  A+E   +  I GR +R +YM RD+           E    K   G   TLF   L +  T + +K  F+      I   K+    KG   V F      KAA
Sbjct:   92 SGRGIAYIEFK-----TEAIAEKILEETQGSDVQGRSIMVDFTGAKSQQQQQGGRGGAVSQVNKVIVVNNLAFSATEDTLQSVFEKAVSIRIP-QNNGRSKGYAFVEFENTDDSKEALESCNNTDIEGRSVRLEYMSRDR----------GEGFGGKGSSGPTKTLFVKGLSEDTTDESLKDSFEGAVAARIATDKETGASKGFGFVDFDSEQDCKAA 293          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: ncl (nucleolin [Source:ZFIN;Acc:ZDB-GENE-030131-6986])

HSP 1 Score: 57.3806 bits (137), Expect = 3.011e-8
Identity = 49/179 (27.37%), Postives = 93/179 (51.96%), Query Frame = 3
Query:  813 VTETEEEKLFTLRIGNLSETTSYETIKSLEFNCS---SMHLTKKSGKRICFLSFKSNKDLTEAYQALLNKEIDGSKVTVK--LVEFKTNKLSEEEFDLMKLH----ITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQ 1322
            + E +++   TL + NL  + + + ++ L F+ +    + L      RI ++ FK     TEA    + +E  GS V  +  +V+F   K  +++    +++    + NL FS T++ L+  F+ A S++ P  NNG+SK   ++ FE+ + +  A+E   +  I GR +R +YM RD+
Sbjct:  326 IQENKKKDARTLFVKNLPYSVTQDELREL-FDQAIDIRIPLGHTGSGRIAYIEFK-----TEAIAEKILEETQGSDVQGRSIMVDFTGAKSQQQQQGGSQVNKVIVVNNLAFSATEDTLQSVFEKAVSIRIP-QNNGRSK-YAFVEFENTDDSKEALESCNNTDIEGRSVRLEYMSRDR 496          

HSP 2 Score: 55.8398 bits (133), Expect = 1.043e-7
Identity = 40/161 (24.84%), Postives = 79/161 (49.07%), Query Frame = 3
Query:  840 FTLRIGNLSETTSYETIK---SLEFNCSSMHL--TKKSGKRICFLSFKSNKDLTEAYQALLNKEIDGSKVTVKLVEFKTNKLSEEEFDLMKLHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQY 1307
            F++ +GNL+    Y+T+K   +  F   S+ +   +  G +  ++ F S ++L +A   L  K+  G ++ +     K N    ++ D   L + NLP+S T++EL + F  A  ++ PL + G  +   Y+ F++  +A   +E  +   + GR I   +
Sbjct:  247 FSIFVGNLNPEKDYDTLKEAITKFFKKESLEIQDVRLGGSKFGYVDFASEEELQKAL-TLNGKKCMGQELKLDRARSKENIQENKKKDARTLFVKNLPYSVTQDELRELFDQAIDIRIPLGHTGSGR-IAYIEFKTEAIAEKILEETQGSDVQGRSIMVDF 405          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: grsf1 (G-rich sequence factor 1 [Source:NCBI gene;Acc:103034094])

HSP 1 Score: 53.1434 bits (126), Expect = 5.992e-7
Identity = 61/277 (22.02%), Postives = 127/277 (45.85%), Query Frame = 3
Query:  804 HKLVTETEEEKLFTLRIGNLSETTSYETIKSLEFNC------SSMHL-----TKKSGKRICFLSFKSNKDLTEAY----QALLNKEIDGSKVTVKLVEFKTNKLSEEEFDLMKLHITNLPFSCTKEELEKEFQ----MASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKK--KKSNKERLAKKKLEG-----NVVTLFNLPKSVTVDEIKAKFDHVKFVHIIKK---DNIFKGIAEVHFIKPDFAKAAI 1547
            H    ET+ +++F +R+  L  +   E +      C      + +HL      K +G+    +  +  KDL++A     Q + ++ I+  KVT + VE     L     +   + +  LPF+C++E++ + F     + + + F L+N G+  G  Y+ F + E A  A++  +DK   G++    ++ +  D+E  +  K+++      +++       + V +  LP   T  +I   F  ++ + ++ +   D   +G+AEV+F     A AA+
Sbjct:  278 HTPPQETDTKEVFVVRVKGLPWSCLAEDLVKYFSECQIRGGVNGIHLMYNKIGKPNGE--ALIELEDEKDLSKAMERHGQYIGSRYIEVYKVTNQDVEAIMKGLDRSHSEDGVVCLRGLPFNCSEEDVLEFFSGLDVVKNGVTFVLDNRGRKSGNAYVQFANQETAIEALQ--RDKGYIGKRYIEVFLSKRSDIEYSRVSKEASDTTFHTQRINSVSEPIHHVNMRGLPYQATAGDIVNFFSPIRVLKVLIEYCPDGQPRGVAEVYFRSHQDALAAM 550          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: grsf1 (G-rich sequence factor 1 [Source:NCBI gene;Acc:103034094])

HSP 1 Score: 53.1434 bits (126), Expect = 6.194e-7
Identity = 61/277 (22.02%), Postives = 127/277 (45.85%), Query Frame = 3
Query:  804 HKLVTETEEEKLFTLRIGNLSETTSYETIKSLEFNC------SSMHL-----TKKSGKRICFLSFKSNKDLTEAY----QALLNKEIDGSKVTVKLVEFKTNKLSEEEFDLMKLHITNLPFSCTKEELEKEFQ----MASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKK--KKSNKERLAKKKLEG-----NVVTLFNLPKSVTVDEIKAKFDHVKFVHIIKK---DNIFKGIAEVHFIKPDFAKAAI 1547
            H    ET+ +++F +R+  L  +   E +      C      + +HL      K +G+    +  +  KDL++A     Q + ++ I+  KVT + VE     L     +   + +  LPF+C++E++ + F     + + + F L+N G+  G  Y+ F + E A  A++  +DK   G++    ++ +  D+E  +  K+++      +++       + V +  LP   T  +I   F  ++ + ++ +   D   +G+AEV+F     A AA+
Sbjct:  339 HTPPQETDTKEVFVVRVKGLPWSCLAEDLVKYFSECQIRGGVNGIHLMYNKIGKPNGE--ALIELEDEKDLSKAMERHGQYIGSRYIEVYKVTNQDVEAIMKGLDRSHSEDGVVCLRGLPFNCSEEDVLEFFSGLDVVKNGVTFVLDNRGRKSGNAYVQFANQETAIEALQ--RDKGYIGKRYIEVFLSKRSDIEYSRVSKEASDTTFHTQRINSVSEPIHHVNMRGLPYQATAGDIVNFFSPIRVLKVLIEYCPDGQPRGVAEVYFRSHQDALAAM 611          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: grsf1 (G-rich sequence factor 1 [Source:NCBI gene;Acc:103034094])

HSP 1 Score: 53.1434 bits (126), Expect = 6.920e-7
Identity = 61/277 (22.02%), Postives = 127/277 (45.85%), Query Frame = 3
Query:  804 HKLVTETEEEKLFTLRIGNLSETTSYETIKSLEFNC------SSMHL-----TKKSGKRICFLSFKSNKDLTEAY----QALLNKEIDGSKVTVKLVEFKTNKLSEEEFDLMKLHITNLPFSCTKEELEKEFQ----MASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKK--KKSNKERLAKKKLEG-----NVVTLFNLPKSVTVDEIKAKFDHVKFVHIIKK---DNIFKGIAEVHFIKPDFAKAAI 1547
            H    ET+ +++F +R+  L  +   E +      C      + +HL      K +G+    +  +  KDL++A     Q + ++ I+  KVT + VE     L     +   + +  LPF+C++E++ + F     + + + F L+N G+  G  Y+ F + E A  A++  +DK   G++    ++ +  D+E  +  K+++      +++       + V +  LP   T  +I   F  ++ + ++ +   D   +G+AEV+F     A AA+
Sbjct:  294 HTPPQETDTKEVFVVRVKGLPWSCLAEDLVKYFSECQIRGGVNGIHLMYNKIGKPNGE--ALIELEDEKDLSKAMERHGQYIGSRYIEVYKVTNQDVEAIMKGLDRSHSEDGVVCLRGLPFNCSEEDVLEFFSGLDVVKNGVTFVLDNRGRKSGNAYVQFANQETAIEALQ--RDKGYIGKRYIEVFLSKRSDIEYSRVSKEASDTTFHTQRINSVSEPIHHVNMRGLPYQATAGDIVNFFSPIRVLKVLIEYCPDGQPRGVAEVYFRSHQDALAAM 566          
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Match: ncl (nucleolin [Source:ZFIN;Acc:ZDB-GENE-030131-6986])

HSP 1 Score: 70.4774 bits (171), Expect = 5.848e-13
Identity = 52/175 (29.71%), Postives = 87/175 (49.71%), Query Frame = 3
Query: 1080 EFDLMKLHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSNKERLAKKKLEGNVVTLFNLPKSVTVDEIKAKFDHVKFVHII--KKDNIFKGIAEVHFIKPDFAKAAIDV-PLFKMSGREIRKEL 1595
            E D   L + N+ +S T E L + F+ A  ++ PL  NGKS+G  Y+ F S E A  AM+ ++   ++GR +   Y+           KSNK +   +  E N + + NL      D +++ F++ + V ++  ++    +G+A V F   D AKAA+      ++ GR IR E 
Sbjct:  368 ERDAKTLFVKNIAWSSTVESLTEAFEGAVEVRIPLGPNGKSRGIAYVEFPSEEDAEAAMKEYQGADVDGRAVLLDYV---------GDKSNKAK--PQGPESNTLMVRNLSFQADEDSLRSVFENAEAVRVLMDRETGKPRGMAFVDFASIDDAKAAMKAHSGAEVEGRAIRLEF 531          

HSP 2 Score: 56.6102 bits (135), Expect = 1.147e-8
Identity = 53/219 (24.20%), Postives = 93/219 (42.47%), Query Frame = 3
Query:  942 KRICFLSFKSNKDLTEAYQALLNKEIDGSKVTVKLVEFKTNKLSEEEFDLMKLHITNLPFSCTKEELEKEFQMASSLKFPLNN-NGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSNKERLAKKKLEGNVVTLF--NLPKSVTVDEIKAKFDHVKFVHII--KKDNIFKGIAEVHFIKPDFAKAAIDVPLFKMSGREI 1583
            + I ++ F S +D   A +     ++DG  V +  V  K+NK   +  +   L + NL F   ++ L   F+ A +++  ++   GK +G  ++ F S++ A  AM+      + GR IR ++              +  R      E +  TLF   L +  + D +   F+      I+  +     KG A V F   D AK+A++     M G EI
Sbjct:  409 RGIAYVEFPSEEDAEAAMKEYQGADVDGRAVLLDYVGDKSNKAKPQGPESNTLMVRNLSFQADEDSLRSVFENAEAVRVLMDRETGKPRGMAFVDFASIDDAKAAMKAHSGAEVEGRAIRLEF--------------STPRGTPGPSEAS-STLFVRGLGEDTSEDTLMDSFEGATAARIVTDRDSGQSKGYAYVDFSSADEAKSALNA----MKGVEI 608          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: ncl (nucleolin [Source:NCBI gene;Acc:101158432])

HSP 1 Score: 73.559 bits (179), Expect = 2.886e-13
Identity = 68/259 (26.25%), Postives = 124/259 (47.88%), Query Frame = 3
Query:  840 FTLRIGNLSETTSYETIK-SLE--FNCSSMHLTK---KSGKRICFLSFKSNKDLTEAYQALLNKEIDGSKVTVKLVEFKTN-KLSEEEFDLMKLHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSNKERLAKKKLEGNVVTLFNLPKSVTVDEIKAKFDHVKFVHIIKKDNIFKGIAEVHFIKPDFAKAAID-VPLFKMSGREIRKE 1592
            F L +GNL+    ++ IK SL   F+ +S+ +        K+  ++ F S +D+ +A + L  K+  G ++ +     K N +  ++E D   L + NLPFS T ++L++ F+ A  ++ P   NG ++G  Y+ F+S  +A   ME  +   + GR I   +        +  K     R++        + + NL  S T D +++ F+    + I ++D   KG A + F   + AK A++     ++ GR IR E
Sbjct:  315 FCLFVGNLNSNKDFDEIKASLRKFFSKNSLEIVDVRLGGSKKFGYVDFASEEDMNKAME-LNGKKFMGQELKLDKARQKDNSQEGKKERDARTLFVKNLPFSATVDDLKELFEDAVDVRLPQGQNGSNRGIAYIEFKSEAVAEKMMEEAQGADVQGRSIILDF--------VGDKSQKGGRMSASGGVNKTLVVNNLAFSATEDVLQSTFEKAASIRIPQRDGRPKGFAFIEFENAEDAKEALENFNNTEIEGRSIRLE 564          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000029031.1 (SMESG000029031.1)

HSP 1 Score: 984.941 bits (2545), Expect = 0.000e+0
Identity = 528/534 (98.88%), Postives = 531/534 (99.44%), Query Frame = 3
Query:   54 MDKVMTKPLXXXXXXXXXXXXXXXNLTKEGRLEEGINYFDKNVKSESKDVVDNKENENLIVSMDLENCDTIHADVKELETVNESSKYNAVILNLPLDATPEEMSNFLSKRGIPVNAFSIENGKYAVIESSDIHSHEKIKKSLAAKSLVNSENMIASKLLGNSQKLETLCQSNAILNRSLITVKNINSQTDIDDILCLIPSDFEXXXXXXXXXXXXXXALIEFVNPLVTDAVIDKLNSSIIDGNKLVAEFKHKLVTETEEEKLFTLRIGNLSETTSYETIKSLEFNCSSMHLTKKSGKRICFLSFKSNKDLTEAYQALLNKEIDGSKVTVKLVEFKTNKLSEEEFDLMKLHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSNKERLAKKKLEGNVVTLFNLPKSVTVDEIKAKFDHVKFVHIIKKDNIFKGIAEVHFIKPDFAKAAIDVPLFKMSGREIRKELKGGKWRDRVVTNSRFKPKDR 1655
            MDKVMTKPLKSSRRKEKKISKKIKNLTKEGRLEEGINYFDKNVKSESKDVVDNKENENLIVSMDLENCDTIHADVKELETVNESSKYNAVILNLPLDATPEEMSNFLSKRGIPVNAFSIENGKYAVIESSDIHSHEKIKKSLAAKSLVNSENMIASKLLGNSQKLETLCQSNAILNRSLITVKNINSQT IDDILCLIPSDFEIKKHQYIKKSKKHIALIEF+NPLVTDAVIDKLNSSI+DGNKLVAEFKHKLV+ETEEEKLFTLRIGNLSETTSYETIKSLEFNCSSMHLTKKSGKRICFLSFKSNKDLTEAYQALLNKEIDGSKVTVKLVEFKTNKLSEEEFDLMKLHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKS KERLAKKKLEGNVVTLFNLPKSVTVDEIKAKFDHVKFVHIIKKDNIFKGIAEVHFIKPDFAKAAID PLFKMSGREIRKELKGGKWRDRVVTNSRFKPKDR
Sbjct:    1 MDKVMTKPLKSSRRKEKKISKKIKNLTKEGRLEEGINYFDKNVKSESKDVVDNKENENLIVSMDLENCDTIHADVKELETVNESSKYNAVILNLPLDATPEEMSNFLSKRGIPVNAFSIENGKYAVIESSDIHSHEKIKKSLAAKSLVNSENMIASKLLGNSQKLETLCQSNAILNRSLITVKNINSQTAIDDILCLIPSDFEIKKHQYIKKSKKHIALIEFLNPLVTDAVIDKLNSSILDGNKLVAEFKHKLVSETEEEKLFTLRIGNLSETTSYETIKSLEFNCSSMHLTKKSGKRICFLSFKSNKDLTEAYQALLNKEIDGSKVTVKLVEFKTNKLSEEEFDLMKLHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSKKERLAKKKLEGNVVTLFNLPKSVTVDEIKAKFDHVKFVHIIKKDNIFKGIAEVHFIKPDFAKAAIDAPLFKMSGREIRKELKGGKWRDRVVTNSRFKPKDR 534          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000029031.1 (SMESG000029031.1)

HSP 1 Score: 976.467 bits (2523), Expect = 0.000e+0
Identity = 524/530 (98.87%), Postives = 527/530 (99.43%), Query Frame = 3
Query:   66 MTKPLXXXXXXXXXXXXXXXNLTKEGRLEEGINYFDKNVKSESKDVVDNKENENLIVSMDLENCDTIHADVKELETVNESSKYNAVILNLPLDATPEEMSNFLSKRGIPVNAFSIENGKYAVIESSDIHSHEKIKKSLAAKSLVNSENMIASKLLGNSQKLETLCQSNAILNRSLITVKNINSQTDIDDILCLIPSDFEXXXXXXXXXXXXXXALIEFVNPLVTDAVIDKLNSSIIDGNKLVAEFKHKLVTETEEEKLFTLRIGNLSETTSYETIKSLEFNCSSMHLTKKSGKRICFLSFKSNKDLTEAYQALLNKEIDGSKVTVKLVEFKTNKLSEEEFDLMKLHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSNKERLAKKKLEGNVVTLFNLPKSVTVDEIKAKFDHVKFVHIIKKDNIFKGIAEVHFIKPDFAKAAIDVPLFKMSGREIRKELKGGKWRDRVVTNSRFKPKDR 1655
            MTKPLKSSRRKEKKISKKIKNLTKEGRLEEGINYFDKNVKSESKDVVDNKENENLIVSMDLENCDTIHADVKELETVNESSKYNAVILNLPLDATPEEMSNFLSKRGIPVNAFSIENGKYAVIESSDIHSHEKIKKSLAAKSLVNSENMIASKLLGNSQKLETLCQSNAILNRSLITVKNINSQT IDDILCLIPSDFEIKKHQYIKKSKKHIALIEF+NPLVTDAVIDKLNSSI+DGNKLVAEFKHKLV+ETEEEKLFTLRIGNLSETTSYETIKSLEFNCSSMHLTKKSGKRICFLSFKSNKDLTEAYQALLNKEIDGSKVTVKLVEFKTNKLSEEEFDLMKLHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKS KERLAKKKLEGNVVTLFNLPKSVTVDEIKAKFDHVKFVHIIKKDNIFKGIAEVHFIKPDFAKAAID PLFKMSGREIRKELKGGKWRDRVVTNSRFKPKDR
Sbjct:    1 MTKPLKSSRRKEKKISKKIKNLTKEGRLEEGINYFDKNVKSESKDVVDNKENENLIVSMDLENCDTIHADVKELETVNESSKYNAVILNLPLDATPEEMSNFLSKRGIPVNAFSIENGKYAVIESSDIHSHEKIKKSLAAKSLVNSENMIASKLLGNSQKLETLCQSNAILNRSLITVKNINSQTAIDDILCLIPSDFEIKKHQYIKKSKKHIALIEFLNPLVTDAVIDKLNSSILDGNKLVAEFKHKLVSETEEEKLFTLRIGNLSETTSYETIKSLEFNCSSMHLTKKSGKRICFLSFKSNKDLTEAYQALLNKEIDGSKVTVKLVEFKTNKLSEEEFDLMKLHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSKKERLAKKKLEGNVVTLFNLPKSVTVDEIKAKFDHVKFVHIIKKDNIFKGIAEVHFIKPDFAKAAIDAPLFKMSGREIRKELKGGKWRDRVVTNSRFKPKDR 530          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000067402.1 (SMESG000067402.1)

HSP 1 Score: 59.3066 bits (142), Expect = 4.343e-9
Identity = 74/336 (22.02%), Postives = 139/336 (41.37%), Query Frame = 3
Query:  309 KYNAVILNLPLDATPEEMSNFLSKRGIPVNAFSIENGKYAVIESSDIHSHEKIKKSLAAKSLVNSENMIASKLLGNSQKLET---LCQSNAILNRSLITVKNINSQTDIDDILCLIPSDFEXXXXXXXXXXXXXXALIEFVNPLVTDAVIDKLNSSIIDGNKLVAEFKHKLVTETEEEKLFTLRIGNLSETTSYETIKSLEFNCSSMHLTKKSGKRICFLSFKSNKDLTEAYQALLNKEIDGSKVTV-KLVEFKTNKLSEEEFDLMKLHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQ 1304
            K   +I N+    TP+++ N L + GI  +   + +G  A++        EK+          ++E  I   L  N   +++   LC+++  L    +T+    S+ DI   L  +P             ++K  A+IEF +       ID L+  +    K+ A F    + +++   +FTL++ NL +  +   ++      + +   +KS +  C + FK+ +D     Q      I   ++TV + V  KT K  E+      L+I NLPF  T  +L   +     ++   N  G   G   L ++       A++  K K    R++R +
Sbjct:  122 KTYTLIENIDSSLTPKDLKNHLLENGISFDNVLVMSGSVAIVNFERQKDMEKLFNVCQGVQYKSNELFIFKLLNENKSDVKSVSNLCENSIHLKNLDVTI----SEEDITSELGDLP------LKSITLNTEKKTAVIEFTDNQSARICIDLLDQKLFGDKKVQASF----LVKSQRPDVFTLKLSNLPKDVTKHQVQIAFPTATKVKFQRKSSEE-CLIHFKTAEDFNAVLQGGTEFLIGDQRITVEEYVGNKTKKQPEQPIKQFVLNIFNLPFDTTVNDLRAHYPGVRYVEMLKNAEGNFMGSARLMYDDRACCEEALKSSKGKTFKHRRVRAE 442          

HSP 2 Score: 50.0618 bits (118), Expect = 4.010e-6
Identity = 51/226 (22.57%), Postives = 101/226 (44.69%), Query Frame = 3
Query:  843 TLRIGNLSETTSYETIKSLEFNCSSMHLTKKSGKRICFLSFKSNKDLTEAYQALLNKEIDGSKVTVKLVEFKTNKLSEEEFDLMKLHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQYMKRDQDLELKKKKSNKERLAKKKLEGNVVTLFNLPKSVTVDEIKAKFDHVKFVHIIKK-DNIFKGIAEVHF 1517
            ++ + NL  T S E I S   +     +T  + K+   + F  N+        L  K     KV    +      +  +  D+  L ++NLP   TK +++  F  A+ +KF      KS   C + F++ E     ++G  + +I  ++I  +        E    K+ K+   ++ ++  V+ +FNLP   TV++++A +  V++V ++K  +  F G A + +
Sbjct:  211 SIHLKNLDVTISEEDITSELGDLPLKSITLNTEKKTAVIEFTDNQSARICIDLLDQKLFGDKKVQASFL------VKSQRPDVFTLKLSNLPKDVTKHQVQIAFPTATKVKF----QRKSSEECLIHFKTAEDFNAVLQGGTEFLIGDQRITVE--------EYVGNKTKKQ--PEQPIKQFVLNIFNLPFDTTVNDLRAHYPGVRYVEMLKNAEGNFMGSARLMY 416          
The following BLAST results are available for this feature:
BLAST of RRM domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
NCL4.082e-1227.13nucleolin [Source:HGNC Symbol;Acc:HGNC:7667][more]
NCL4.240e-1025.60nucleolin [Source:HGNC Symbol;Acc:HGNC:7667][more]
PABPC4L2.042e-624.13poly(A) binding protein cytoplasmic 4 like [Source... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pab-12.651e-723.40Polyadenylate-binding protein [Source:UniProtKB/T... [more]
pab-12.651e-723.40Polyadenylate-binding protein [Source:UniProtKB/T... [more]
pab-12.651e-723.40Polyadenylate-binding protein [Source:UniProtKB/T... [more]
pab-12.651e-723.40Polyadenylate-binding protein [Source:UniProtKB/T... [more]
pab-12.651e-723.40Polyadenylate-binding protein [Source:UniProtKB/T... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ncl2.916e-1226.03nucleolin [Source:ZFIN;Acc:ZDB-GENE-030131-6986][more]
ncl2.918e-1226.03nucleolin [Source:ZFIN;Acc:ZDB-GENE-030131-6986][more]
ncl4.317e-1125.89nucleolin [Source:ZFIN;Acc:ZDB-GENE-030131-6986][more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSXETT00000021867.15.502e-1427.24pep primary_assembly:Xenopus_tropicalis_v9.1:5:110... [more]
ENSXETT00000021886.11.520e-1327.24pep primary_assembly:Xenopus_tropicalis_v9.1:5:110... [more]
ENSXETT00000021882.12.723e-1228.38pep primary_assembly:Xenopus_tropicalis_v9.1:5:110... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ncl2.326e-1030.86nucleolin [Source:MGI Symbol;Acc:MGI:97286][more]
back to top
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P20397|NUCL_XENLA7.122e-1429.33Nucleolin OS=Xenopus laevis OX=8355 GN=ncl PE=2 SV... [more]
sp|P19338|NUCL_HUMAN1.960e-1127.13Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3[more]
sp|Q5RF26|NUCL_PONAB1.964e-1127.13Nucleolin OS=Pongo abelii OX=9601 GN=NCL PE=2 SV=3[more]
sp|Q4R4J7|NUCL_MACFA2.067e-1128.83Nucleolin OS=Macaca fascicularis OX=9541 GN=NCL PE... [more]
sp|P09405|NUCL_MOUSE1.627e-930.86Nucleolin OS=Mus musculus OX=10090 GN=Ncl PE=1 SV=... [more]
back to top
BLAST of RRM domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3NVL69.156e-2231.71Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A183T1051.357e-2031.66RRM domain-containing protein OS=Schistocephalus s... [more]
A0A3P7LAW21.541e-1733.02RRM domain-containing protein OS=Dibothriocephalus... [more]
A0A504YNC61.809e-1529.91RRM domain-containing protein OS=Fasciola gigantic... [more]
A0A183AQX79.243e-1530.63RRM domain-containing protein OS=Echinostoma capro... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncl3.302e-1128.44nucleolin [Source:ZFIN;Acc:ZDB-GENE-030131-6986][more]
ncl3.011e-827.37nucleolin [Source:ZFIN;Acc:ZDB-GENE-030131-6986][more]
grsf15.992e-722.02G-rich sequence factor 1 [Source:NCBI gene;Acc:103... [more]
grsf16.194e-722.02G-rich sequence factor 1 [Source:NCBI gene;Acc:103... [more]
grsf16.920e-722.02G-rich sequence factor 1 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ncl5.848e-1329.71nucleolin [Source:ZFIN;Acc:ZDB-GENE-030131-6986][more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ncl2.886e-1326.25nucleolin [Source:NCBI gene;Acc:101158432][more]
back to top
BLAST of RRM domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000029031.10.000e+098.88SMESG000029031.1[more]
SMESG000029031.10.000e+098.87SMESG000029031.1[more]
SMESG000067402.14.343e-922.02SMESG000067402.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032319 ID=SMED30032319|Name=RRM domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1780bp
CTCTTCCGATCTGTTGAAAATTAGTTTAAATATTCATAATTTAAATTTTA
CTAATGGATAAGGTCATGACAAAACCATTGAAGTCATCTCGACGGAAGGA
GAAGAAAATTAGTAAAAAAATTAAAAATCTTACTAAAGAAGGACGTTTAG
AAGAAGGAATTAACTATTTCGATAAGAATGTAAAATCTGAAAGTAAAGAT
GTCGTAGATAATAAAGAAAATGAAAATTTAATTGTATCTATGGATCTTGA
AAACTGTGATACCATTCATGCCGATGTCAAAGAACTAGAAACTGTGAACG
AGAGTTCAAAATATAATGCAGTTATTTTAAATTTACCTCTTGACGCCACA
CCAGAAGAAATGAGTAATTTCTTATCAAAACGAGGCATTCCAGTCAATGC
ATTTAGCATAGAAAACGGTAAATATGCAGTTATCGAATCAAGCGATATCC
ACTCACATGAGAAAATTAAAAAATCTCTTGCAGCGAAGTCCTTAGTAAAT
TCTGAAAATATGATTGCCTCGAAATTGTTGGGGAATTCTCAAAAGTTAGA
GACATTATGTCAAAGTAATGCCATACTCAACAGATCCCTAATAACTGTCA
AGAACATCAACAGTCAAACAGATATTGATGATATTTTATGCTTAATACCC
AGCGATTTTGAAATAAAAAAGCATCAATATATAAAAAAGTCAAAGAAGCA
CATAGCACTGATAGAATTCGTGAATCCATTGGTTACCGATGCTGTCATAG
ACAAATTGAATAGCAGCATTATAGATGGCAATAAATTGGTCGCTGAATTT
AAACATAAATTAGTCACTGAAACCGAGGAGGAAAAATTATTTACTCTTCG
AATCGGAAATCTTTCTGAAACAACAAGTTACGAAACAATAAAGAGCTTGG
AATTTAACTGTTCATCAATGCATTTGACGAAAAAATCAGGAAAGCGTATT
TGTTTTCTATCTTTCAAATCAAACAAAGATCTAACAGAAGCTTATCAAGC
GCTTTTGAATAAAGAAATCGACGGAAGCAAAGTAACAGTGAAACTCGTGG
AATTCAAAACCAATAAATTGTCAGAAGAGGAATTTGATTTGATGAAATTA
CATATCACAAATCTGCCGTTTTCTTGCACAAAAGAAGAATTGGAAAAGGA
ATTTCAAATGGCATCGTCTCTGAAATTTCCGTTGAATAATAATGGAAAAA
GCAAAGGATGTTGCTATTTGTCATTCGAATCCATGGAGTTAGCTGCATTA
GCGATGGAAGGATTTAAGGATAAGATAATCAATGGGAGAAAAATCAGGTG
CCAATACATGAAAAGAGATCAAGACCTGGAATTGAAAAAGAAAAAATCGA
ATAAAGAAAGATTGGCAAAGAAGAAGCTGGAAGGAAATGTTGTAACTTTG
TTCAATCTTCCCAAATCTGTCACAGTCGATGAAATTAAAGCTAAATTCGA
CCATGTCAAATTTGTTCATATTATTAAGAAAGATAATATTTTCAAAGGAA
TTGCAGAGGTGCATTTTATCAAACCGGATTTTGCAAAAGCTGCTATAGAT
GTTCCCTTGTTTAAAATGAGTGGCAGAGAAATTAGGAAGGAATTAAAAGG
CGGAAAATGGAGAGATCGGGTGGTAACGAATTCGAGATTTAAGCCGAAGG
ATCGGGAGGAAGTCATATCTGAAGTTGAAGATAGTGATGAATAAATTTGT
CAATTTTTCTGATTTTATTTTTTTATAGTAAATTTTTAAATTGTTATTTT
GTAATTTTAAAAAAAATGGTTATAATGTCG
back to top

protein sequence of SMED30032319-orf-1

>SMED30032319-orf-1 ID=SMED30032319-orf-1|Name=SMED30032319-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=547bp
MDKVMTKPLKSSRRKEKKISKKIKNLTKEGRLEEGINYFDKNVKSESKDV
VDNKENENLIVSMDLENCDTIHADVKELETVNESSKYNAVILNLPLDATP
EEMSNFLSKRGIPVNAFSIENGKYAVIESSDIHSHEKIKKSLAAKSLVNS
ENMIASKLLGNSQKLETLCQSNAILNRSLITVKNINSQTDIDDILCLIPS
DFEIKKHQYIKKSKKHIALIEFVNPLVTDAVIDKLNSSIIDGNKLVAEFK
HKLVTETEEEKLFTLRIGNLSETTSYETIKSLEFNCSSMHLTKKSGKRIC
FLSFKSNKDLTEAYQALLNKEIDGSKVTVKLVEFKTNKLSEEEFDLMKLH
ITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALA
MEGFKDKIINGRKIRCQYMKRDQDLELKKKKSNKERLAKKKLEGNVVTLF
NLPKSVTVDEIKAKFDHVKFVHIIKKDNIFKGIAEVHFIKPDFAKAAIDV
PLFKMSGREIRKELKGGKWRDRVVTNSRFKPKDREEVISEVEDSDE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0003677DNA binding
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 9..29
NoneNo IPR availableCOILSCoilCoilcoord: 420..440
NoneNo IPR availablePANTHERPTHR23003RNA RECOGNITION MOTIF RRM DOMAIN CONTAINING PROTEINcoord: 264..423
NoneNo IPR availableCDDcd00590RRM_SFcoord: 447..511
e-value: 9.30346E-6
score: 41.5217
NoneNo IPR availableCDDcd00590RRM_SFcoord: 349..417
e-value: 5.39708E-13
score: 62.3225
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 264..330
e-value: 0.0099
score: 24.4
coord: 179..248
e-value: 0.56
score: 8.8
coord: 446..513
e-value: 0.022
score: 21.4
coord: 348..417
e-value: 2.0E-13
score: 60.6
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 351..415
e-value: 6.3E-10
score: 38.7
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 445..531
score: 8.893
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 347..421
score: 12.356
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 252..339
e-value: 3.9E-7
score: 32.0
coord: 340..424
e-value: 3.9E-16
score: 60.9
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 425..522
e-value: 1.6E-7
score: 33.0
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 180..333
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 347..499