Peptidylglycine alpha-hydroxylating monooxygenase

Overview
NamePeptidylglycine alpha-hydroxylating monooxygenase
Smed IDSMED30032314
Length (bp)1411
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peptidylglycine alpha-hydroxylating monooxygenase (SMED30032314) t-SNE clustered cells

Violin plots show distribution of expression levels for Peptidylglycine alpha-hydroxylating monooxygenase (SMED30032314) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peptidylglycine alpha-hydroxylating monooxygenase (SMED30032314) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peptidylglycine alpha-hydroxylating monooxygenase (SMED30032314) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032314

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30032314SMESG000073851.1 SmedASXL_010783SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30032314SMESG000073851.1 dd_Smed_v4_2646_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032314SMESG000073851.1 dd_Smed_v4_2646_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30032314SMESG000073851.1 dd_Smed_v4_2646_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30032314SMESG000073851.1 dd_Smed_v4_2646_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30032314SMESG000073851.1 dd_Smed_v4_2646_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30032314SMESG000073851.1 dd_Smed_v4_2646_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30032314SMESG000073851.1 dd_Smed_v4_2646_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032314SMESG000081574.1 SMESG000079557.1 SMESG000077813.1 SMESG000077556.1 SMESG000073961.1 SMESG000073852.1 SMESG000073851.1 SMESG000073618.1 SMESG000071859.1 SMESG000071073.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015102.1 SMESG000012464.1 SMESG000007021.1 SMESG000068881.1 SMESG000056926.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000005066.1 Contig11477newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032314SMESG000081574.1 SMESG000079557.1 SMESG000077813.1 SMESG000077556.1 SMESG000073961.1 SMESG000073852.1 SMESG000073851.1 SMESG000073618.1 SMESG000071859.1 SMESG000071073.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015102.1 SMESG000012464.1 SMESG000007021.1 SMESG000068881.1 SMESG000056926.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000005066.1 Contig11477uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032314SMESG000073851.1 Contig49426newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032314SMESG000073851.1 Contig49426uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
prepharyngeal regionSMED30032314SMESG000073851.1 dd_Smed_v6_2646_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30032314SMESG000073851.1 OX_Smed_1.0.02391ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
neuronSMED30032314SMESG000073851.1 dd_Smed_v6_2646_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30032314SMESG000073851.1 dd_Smed_v6_2646_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Human
Match: PAM (peptidylglycine alpha-amidating monooxygenase [Source:HGNC Symbol;Acc:HGNC:8596])

HSP 1 Score: 188.734 bits (478), Expect = 1.250e-51
Identity = 108/269 (40.15%), Postives = 148/269 (55.02%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDLKNDT-LFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLL-ATDGSIP-GHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKG-DKLVKIGNTRKDEMCNFYIYYWVD 949
            ++MP V P + D Y C ++ +  D   F+  F P+AS    HH+L+  C  P S   YW C+E         C     IL++WA  A   RLPK V   +G   G +Y V+Q HY ++  FR  N   D SG+ + + R P   +AG+YL+ + D  IP G   V  + +C Y     +H FAYRVHTH LGK+VSGY +    WT IG++SPQ+ Q FYPV   V +  GD LAARC+   +G  +   IG T  DEMCN YI Y+++
Sbjct:   61 IRMPGVTPKQSDTYFCMSMRIPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGT-------CTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNK--DCSGVSLHLTRLPQPLIAGMYLMMSVDTVIPAGEKVVNSDISCHYKNYP-MHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQSPQLPQAFYPVGHPVDVSFGDLLAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYME 319          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Human
Match: PAM (peptidylglycine alpha-amidating monooxygenase [Source:HGNC Symbol;Acc:HGNC:8596])

HSP 1 Score: 188.734 bits (478), Expect = 1.527e-51
Identity = 108/269 (40.15%), Postives = 148/269 (55.02%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDLKNDT-LFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLL-ATDGSIP-GHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKG-DKLVKIGNTRKDEMCNFYIYYWVD 949
            ++MP V P + D Y C ++ +  D   F+  F P+AS    HH+L+  C  P S   YW C+E         C     IL++WA  A   RLPK V   +G   G +Y V+Q HY ++  FR  N   D SG+ + + R P   +AG+YL+ + D  IP G   V  + +C Y     +H FAYRVHTH LGK+VSGY +    WT IG++SPQ+ Q FYPV   V +  GD LAARC+   +G  +   IG T  DEMCN YI Y+++
Sbjct:   61 IRMPGVTPKQSDTYFCMSMRIPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGT-------CTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNK--DCSGVSLHLTRLPQPLIAGMYLMMSVDTVIPAGEKVVNSDISCHYKNYP-MHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQSPQLPQAFYPVGHPVDVSFGDLLAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYME 319          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Human
Match: PAM (peptidylglycine alpha-amidating monooxygenase [Source:HGNC Symbol;Acc:HGNC:8596])

HSP 1 Score: 188.734 bits (478), Expect = 1.632e-51
Identity = 108/269 (40.15%), Postives = 148/269 (55.02%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDLKNDT-LFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLL-ATDGSIP-GHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKG-DKLVKIGNTRKDEMCNFYIYYWVD 949
            ++MP V P + D Y C ++ +  D   F+  F P+AS    HH+L+  C  P S   YW C+E         C     IL++WA  A   RLPK V   +G   G +Y V+Q HY ++  FR  N   D SG+ + + R P   +AG+YL+ + D  IP G   V  + +C Y     +H FAYRVHTH LGK+VSGY +    WT IG++SPQ+ Q FYPV   V +  GD LAARC+   +G  +   IG T  DEMCN YI Y+++
Sbjct:   61 IRMPGVTPKQSDTYFCMSMRIPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGT-------CTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNK--DCSGVSLHLTRLPQPLIAGMYLMMSVDTVIPAGEKVVNSDISCHYKNYP-MHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQSPQLPQAFYPVGHPVDVSFGDLLAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYME 319          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Human
Match: PAM (peptidylglycine alpha-amidating monooxygenase [Source:HGNC Symbol;Acc:HGNC:8596])

HSP 1 Score: 189.119 bits (479), Expect = 1.910e-51
Identity = 108/269 (40.15%), Postives = 148/269 (55.02%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDLKNDT-LFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLL-ATDGSIP-GHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKG-DKLVKIGNTRKDEMCNFYIYYWVD 949
            ++MP V P + D Y C ++ +  D   F+  F P+AS    HH+L+  C  P S   YW C+E         C     IL++WA  A   RLPK V   +G   G +Y V+Q HY ++  FR  N   D SG+ + + R P   +AG+YL+ + D  IP G   V  + +C Y     +H FAYRVHTH LGK+VSGY +    WT IG++SPQ+ Q FYPV   V +  GD LAARC+   +G  +   IG T  DEMCN YI Y+++
Sbjct:   61 IRMPGVTPKQSDTYFCMSMRIPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGT-------CTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNK--DCSGVSLHLTRLPQPLIAGMYLMMSVDTVIPAGEKVVNSDISCHYKNYP-MHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQSPQLPQAFYPVGHPVDVSFGDLLAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYME 319          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Human
Match: PAM (peptidylglycine alpha-amidating monooxygenase [Source:HGNC Symbol;Acc:HGNC:8596])

HSP 1 Score: 188.734 bits (478), Expect = 2.199e-51
Identity = 108/269 (40.15%), Postives = 148/269 (55.02%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDLKNDT-LFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLL-ATDGSIP-GHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKG-DKLVKIGNTRKDEMCNFYIYYWVD 949
            ++MP V P + D Y C ++ +  D   F+  F P+AS    HH+L+  C  P S   YW C+E         C     IL++WA  A   RLPK V   +G   G +Y V+Q HY ++  FR  N   D SG+ + + R P   +AG+YL+ + D  IP G   V  + +C Y     +H FAYRVHTH LGK+VSGY +    WT IG++SPQ+ Q FYPV   V +  GD LAARC+   +G  +   IG T  DEMCN YI Y+++
Sbjct:   61 IRMPGVTPKQSDTYFCMSMRIPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGT-------CTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNK--DCSGVSLHLTRLPQPLIAGMYLMMSVDTVIPAGEKVVNSDISCHYKNYP-MHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQSPQLPQAFYPVGHPVDVSFGDLLAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYME 319          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Celegans
Match: pghm-1 (Probable peptidylglycine alpha-hydroxylating monooxygenase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q95XM2])

HSP 1 Score: 225.328 bits (573), Expect = 7.341e-70
Identity = 125/310 (40.32%), Postives = 175/310 (56.45%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDLKNDTLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSK----PICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSIPGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVI-----HRKNWTEIGKKSPQVEQMFYPVKG-TVKIYPGDTLAARCIMENKGDKLVKIGNTRKDEMCNFYIYYWVDREDSSQIYDDQNQICFSAGWPKFKWDSFFDSLKIP 1054
            ++MP V P + D Y+C +L+L +   ++TGF    +   AHHIL+  C EPGS +  W+C EMN  D +    P C S   IL++WA+ A    LP+DV   +G     ++LV+Q HY +         EPDE+G+EIT   +P  KLA   LL T G++P + T   E AC      V+HPFAYR HTH  GK VSG+++     H  +W  IG++ PQ+ QMF PV+   + I  GD + ARCI++N  ++ + +G T +DEMCNFYI YW D E        Q+  C+S G P +KW    D   IP
Sbjct:   27 IRMPGVVP-EADSYLCTSLELSDQENYLTGFKALTTKGTAHHILLFGCEEPGSDELVWDCGEMNKPDDEMPRAPTCGSKPAILYAWALDAPPLELPQDVGFRVGGDSNIRHLVMQVHYMHS------KQEPDETGLEITHTEEPQPKLAATMLLVTGGTLPRNKTESFETACMIEEDVVMHPFAYRTHTHRHGKEVSGWLVKEDQKHEDHWKLIGRRDPQLAQMFVPVEDQAMTIQQGDMVTARCILQNNENRDISMGATEEDEMCNFYIMYWTDGEVM------QDNTCYSPGAPDYKWAREADLNHIP 323          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Celegans
Match: pamn-1 (Probable peptidyl-glycine alpha-amidating monooxygenase pamn-1 Probable peptidylglycine alpha-hydroxylating monooxygenase Probable peptidyl-alpha-hydroxyglycine alpha-amidating lyase [Source:UniProtKB/Swiss-Prot;Acc:P83388])

HSP 1 Score: 134.42 bits (337), Expect = 1.162e-33
Identity = 86/268 (32.09%), Postives = 135/268 (50.37%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDLKNDTLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIG-KAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSIPGHSTVFME-AACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKG-DKLVKIGNTRKDEMCNFYIYYWVD 949
            ++M    P K D Y+  A+ ++    ++  F P A A   HH+L++ CT P S + +W   E            G  IL++WA  A    LPKDV+  +G +  G +Y V+Q HY             D SG+ + + +K    LA + L  +   IP     F     C +   T +HPFA+R HTH++G+LVS +  H  +WT+IGK++PQ  Q+F  +   + I  GD ++A C  ++   ++ V +G    DEMCNFY+ +  D
Sbjct:   37 IQMIGYSPQKTDDYV--AVSIEATPGYVVAFEPMAHADRVHHMLLYGCTMPASEQGFWRGMETCG------WGGGSYILYAWARNAPNLVLPKDVAFSVGHEQDGIKYFVLQVHYAQ----PFAGEVHDFSGVTMHISQKKPMNLAAVMLFVSGTPIPPQLPAFQNNITCMFESSTPIHPFAFRTHTHAMGRLVSAFFKHDGHWTKIGKRNPQWPQLFEGIPSKLMIGSGDQMSASCRFDSMDKNRTVNMGAMGVDEMCNFYMMFHYD 292          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Celegans
Match: tbh-1 (Tyramine beta-hydroxylase [Source:UniProtKB/Swiss-Prot;Acc:Q9XTQ6])

HSP 1 Score: 64.6994 bits (156), Expect = 6.209e-11
Identity = 61/211 (28.91%), Postives = 93/211 (44.08%), Query Frame = 2
Query:  362 PICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQ---RKPTSKLAGIYLLATDG-SIPGHSTVF-MEAAC-SYTGKTV----LHPFAYRVHTHSLGKLV------SGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKGDKLVKIGNTR-KDEMCNFYIYYW 943
            P  KS   ++ +WAM       PK+  + IG      Y++++ HY N +  +      D SG +  V    RK  + +  + L+ +D  S+P +   + M   C S   K +    ++ FA ++H H  G+ +      SG  I   N  E      Q  Q   PV   VK+ PGDTL   C+ + +    V  G  R  DEMC  YIYY+
Sbjct:  265 PKSKSCSHVIAAWAMGEGPIHYPKEAGLPIGGKGKNAYVMVEIHYNNPELHK---GVIDSSGFQFFVTGQLRKYDAGIMELGLIYSDANSVPPNQKAWAMNGYCPSQCTKNLPEEGINIFASQLHAHLTGRKLFTSQYRSGVRIGDVNRDEHYSPHWQHLQQLRPV---VKVMPGDTLVTTCVYDTRKRSKVTFGGYRIVDEMCVNYIYYY 469          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Celegans
Match: tbh-1 (Tyramine beta-hydroxylase [Source:UniProtKB/Swiss-Prot;Acc:Q9XTQ6])

HSP 1 Score: 64.6994 bits (156), Expect = 6.762e-11
Identity = 61/211 (28.91%), Postives = 93/211 (44.08%), Query Frame = 2
Query:  362 PICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQ---RKPTSKLAGIYLLATDG-SIPGHSTVF-MEAAC-SYTGKTV----LHPFAYRVHTHSLGKLV------SGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKGDKLVKIGNTR-KDEMCNFYIYYW 943
            P  KS   ++ +WAM       PK+  + IG      Y++++ HY N +  +      D SG +  V    RK  + +  + L+ +D  S+P +   + M   C S   K +    ++ FA ++H H  G+ +      SG  I   N  E      Q  Q   PV   VK+ PGDTL   C+ + +    V  G  R  DEMC  YIYY+
Sbjct:  286 PKSKSCSHVIAAWAMGEGPIHYPKEAGLPIGGKGKNAYVMVEIHYNNPELHK---GVIDSSGFQFFVTGQLRKYDAGIMELGLIYSDANSVPPNQKAWAMNGYCPSQCTKNLPEEGINIFASQLHAHLTGRKLFTSQYRSGVRIGDVNRDEHYSPHWQHLQQLRPV---VKVMPGDTLVTTCVYDTRKRSKVTFGGYRIVDEMCVNYIYYY 490          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Celegans
Match: tbh-1 (Tyramine beta-hydroxylase [Source:UniProtKB/Swiss-Prot;Acc:Q9XTQ6])

HSP 1 Score: 64.6994 bits (156), Expect = 8.467e-11
Identity = 61/211 (28.91%), Postives = 93/211 (44.08%), Query Frame = 2
Query:  362 PICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQ---RKPTSKLAGIYLLATDG-SIPGHSTVF-MEAAC-SYTGKTV----LHPFAYRVHTHSLGKLV------SGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKGDKLVKIGNTR-KDEMCNFYIYYW 943
            P  KS   ++ +WAM       PK+  + IG      Y++++ HY N +  +      D SG +  V    RK  + +  + L+ +D  S+P +   + M   C S   K +    ++ FA ++H H  G+ +      SG  I   N  E      Q  Q   PV   VK+ PGDTL   C+ + +    V  G  R  DEMC  YIYY+
Sbjct:  337 PKSKSCSHVIAAWAMGEGPIHYPKEAGLPIGGKGKNAYVMVEIHYNNPELHK---GVIDSSGFQFFVTGQLRKYDAGIMELGLIYSDANSVPPNQKAWAMNGYCPSQCTKNLPEEGINIFASQLHAHLTGRKLFTSQYRSGVRIGDVNRDEHYSPHWQHLQQLRPV---VKVMPGDTLVTTCVYDTRKRSKVTFGGYRIVDEMCVNYIYYY 541          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Fly
Match: Phm (gene:FBgn0283509 transcript:FBtr0072203)

HSP 1 Score: 224.172 bits (570), Expect = 8.774e-69
Identity = 123/301 (40.86%), Postives = 172/301 (57.14%), Query Frame = 2
Query:  161 MPKVRPTKEDQYICHALDLK-NDTLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMN---AKDSKPIC--KSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSIPGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIH-----RKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKGDKLVKIGNTRKDEMCNFYIYYWVDREDSSQIYDDQNQICFSAGWPKFKWDS 1030
            MP V P   D Y+C  + +    T +I GFNP A+ + AHH+L++ C EPG+ K  WNC EMN    ++S   C   S  +I+++WA  A    LP+ V   +GK    +YLV+Q HY ++D F+  +   D+SG+ +    +P  KLAG  LL TDG IP   T  +E AC    + VLHPFAYRVHTH LGK+VSGY +       + W ++GK+ P   QMFY    T  I  GD +A RC M++   +  KIG T +DEMCNFY+ Y+VD  ++  +     + CFS G P + W +
Sbjct:   56 MPNVSPQTPDLYLCTPIKVDPTTTYYIVGFNPNATMNTAHHMLLYGCGEPGTSKTTWNCGEMNRASQEESASPCGPHSNSQIVYAWARDAQKLNLPEGVGFKVGKNSPIKYLVLQVHYAHIDKFK--DGSTDDSGVFLDYTEEPRKKLAGTLLLGTDGQIPAMKTEHLETACEVNEQKVLHPFAYRVHTHGLGKVVSGYRVRTNSDGEQEWLQLGKRDPLTPQMFYNTSNTDPIIEGDKIAVRCTMQSTRHRTTKIGPTNEDEMCNFYLMYYVDHGETLNM-----KFCFSQGAPYYFWSN 349          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Fly
Match: Phm (gene:FBgn0283509 transcript:FBtr0072202)

HSP 1 Score: 224.172 bits (570), Expect = 8.774e-69
Identity = 123/301 (40.86%), Postives = 172/301 (57.14%), Query Frame = 2
Query:  161 MPKVRPTKEDQYICHALDLK-NDTLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMN---AKDSKPIC--KSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSIPGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIH-----RKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKGDKLVKIGNTRKDEMCNFYIYYWVDREDSSQIYDDQNQICFSAGWPKFKWDS 1030
            MP V P   D Y+C  + +    T +I GFNP A+ + AHH+L++ C EPG+ K  WNC EMN    ++S   C   S  +I+++WA  A    LP+ V   +GK    +YLV+Q HY ++D F+  +   D+SG+ +    +P  KLAG  LL TDG IP   T  +E AC    + VLHPFAYRVHTH LGK+VSGY +       + W ++GK+ P   QMFY    T  I  GD +A RC M++   +  KIG T +DEMCNFY+ Y+VD  ++  +     + CFS G P + W +
Sbjct:   56 MPNVSPQTPDLYLCTPIKVDPTTTYYIVGFNPNATMNTAHHMLLYGCGEPGTSKTTWNCGEMNRASQEESASPCGPHSNSQIVYAWARDAQKLNLPEGVGFKVGKNSPIKYLVLQVHYAHIDKFK--DGSTDDSGVFLDYTEEPRKKLAGTLLLGTDGQIPAMKTEHLETACEVNEQKVLHPFAYRVHTHGLGKVVSGYRVRTNSDGEQEWLQLGKRDPLTPQMFYNTSNTDPIIEGDKIAVRCTMQSTRHRTTKIGPTNEDEMCNFYLMYYVDHGETLNM-----KFCFSQGAPYYFWSN 349          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Fly
Match: Tbh (gene:FBgn0010329 transcript:FBtr0089999)

HSP 1 Score: 62.003 bits (149), Expect = 6.624e-10
Identity = 72/292 (24.66%), Postives = 118/292 (40.41%), Query Frame = 2
Query:  146 EILLKMPKVRPTKEDQYICHALDLKNDTL---FITGFNPKXXXXXXXXXXXXXCTEPGSVK--PYWN--CEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATD----GSIPGHSTVF----------MEAACSYTGKTVLHPFAYRVHTHSLG-KLVSGYVIHRKNWTEIGKK---SPQVEQMFYPVKGTVKIYPGDTLAARCIMENKGDKLVKIGN-TRKDEMCNFYIYYW 943
            EI L+   + P++E  Y CH   L+ +      I  F P        H +     E G  +  P +N  CE++      P  K   K++  WAM A  F  P +  + IG      Y+ ++ H+ N +   K +   D SG  I + +      A +  L  +     +IP   T F            AA   TG  +   F  ++HTH  G ++++ +    +   E+ +    S   ++M   +    ++ PGD L   C    K DK   +G  +  DEMC  YI+Y+
Sbjct:  266 EITLQEAPI-PSQETTYWCHVQRLEGNLRRRHHIVQFEPLIRTPGIVHHMEVFHCEAGEHEEIPLYNGDCEQL-----PPRAKICSKVMVLWAMGAGTFTYPPEAGLPIGGPGFNPYVRLEVHFNNPE---KQSGLVDNSGFRIKMSKTLRQYDAAVMELGLEYTDKMAIPPGQTAFPLSGYCVADCTRAALPATGIII---FGSQLHTHLRGVRVLTRHFRGEQELREVNRDDYYSNHFQEM-RTLHYKPRVLPGDALVTTCYYNTKDDKTAALGGFSISDEMCVNYIHYY 544          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Fly
Match: Tbh (gene:FBgn0010329 transcript:FBtr0340409)

HSP 1 Score: 62.003 bits (149), Expect = 6.624e-10
Identity = 72/292 (24.66%), Postives = 118/292 (40.41%), Query Frame = 2
Query:  146 EILLKMPKVRPTKEDQYICHALDLKNDTL---FITGFNPKXXXXXXXXXXXXXCTEPGSVK--PYWN--CEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATD----GSIPGHSTVF----------MEAACSYTGKTVLHPFAYRVHTHSLG-KLVSGYVIHRKNWTEIGKK---SPQVEQMFYPVKGTVKIYPGDTLAARCIMENKGDKLVKIGN-TRKDEMCNFYIYYW 943
            EI L+   + P++E  Y CH   L+ +      I  F P        H +     E G  +  P +N  CE++      P  K   K++  WAM A  F  P +  + IG      Y+ ++ H+ N +   K +   D SG  I + +      A +  L  +     +IP   T F            AA   TG  +   F  ++HTH  G ++++ +    +   E+ +    S   ++M   +    ++ PGD L   C    K DK   +G  +  DEMC  YI+Y+
Sbjct:  266 EITLQEAPI-PSQETTYWCHVQRLEGNLRRRHHIVQFEPLIRTPGIVHHMEVFHCEAGEHEEIPLYNGDCEQL-----PPRAKICSKVMVLWAMGAGTFTYPPEAGLPIGGPGFNPYVRLEVHFNNPE---KQSGLVDNSGFRIKMSKTLRQYDAAVMELGLEYTDKMAIPPGQTAFPLSGYCVADCTRAALPATGIII---FGSQLHTHLRGVRVLTRHFRGEQELREVNRDDYYSNHFQEM-RTLHYKPRVLPGDALVTTCYYNTKDDKTAALGGFSISDEMCVNYIHYY 544          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Fly
Match: olf413 (gene:FBgn0037153 transcript:FBtr0333219)

HSP 1 Score: 51.9878 bits (123), Expect = 1.080e-6
Identity = 58/227 (25.55%), Postives = 91/227 (40.09%), Query Frame = 2
Query:  335 EEMNAKDSKP------ICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNV--DYFR-KPNSEPDESGIEITVQRKPTSKLAGIYLLATDGS-----IPGHSTVFMEAAC--SYTG----KTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVE---QMFYPVKGTVKIYPGDTLAARCIMENKGDKLVKIGN-TRKDEMCNFYIYYW 943
            EEM  +  +P      I  +   I+ SW+  + GF  P +    I     K YL +++HY N+  D+ +       D SG++I          AG   +  D +      PG   V  E  C    TG    +  ++ FA  + TH +GK V    I +            ++   Q F  +  +V   PGD L A CI ++   K + +G  T K+E C     Y+
Sbjct:  347 EEMAREQGRPCLGARSIPLACNAIVASWSRGSEGFTYPHEAGYPIESRQAKYYL-METHYNNLKPDFAQLHARQMADNSGLKIYFTHVLRPNDAGTLSIGMDPNWRHIIPPGQKRVVSEGQCIEDCTGYAFPQQGINIFAVMMRTHQIGKEVKLRQIRQTEELPPIAHDSNIDVAYQDFRRLPQSVHSMPGDRLIAECIYDSSSRKAITLGGLTMKEESCTVLTLYY 572          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Zebrafish
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:ZFIN;Acc:ZDB-GENE-090313-384])

HSP 1 Score: 188.734 bits (478), Expect = 8.705e-54
Identity = 104/270 (38.52%), Postives = 158/270 (58.52%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDLKNDT-LFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNC-EEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSI--PGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKG-DKLVKIGNTRKDEMCNFYIYYWVD 949
            +++P V PT+ D Y C A+ +      +I  F P AS   AHH++++ C  P + + YW+C +E+        C+   KI+++WA  A   +LPKDV   +G      Y V+Q HY +V+ FR  +   D SG+ + +  KP   +AG+YL+ +  ++  PG      + AC+YT  + ++PFA+R HTHSLGK+VSGY +    WT+IG++SP + Q FYP   T+ +  GD LAARC+   +G     +IG T  DEMCNFYI Y++D
Sbjct:   62 IRLPGVVPTESDSYYCMAVPVPTSREAYIVDFVPHASMDTAHHMILYGCKTPYATQGYWDCGKELGT------CRDQAKIMYAWARNAPPTKLPKDVGFKVGGDTRINYFVLQIHYGDVNNFR--DHHRDCSGLSLRMTSKPQPFIAGMYLMMSVDTLIPPGKKVTNADIACTYT-SSPMYPFAFRTHTHSLGKVVSGYRVRNGQWTQIGRQSPLLPQAFYPATNTIDVKDGDILAARCVFTGEGRTTTTQIGGTSNDEMCNFYIMYYMD 322          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Zebrafish
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:ZFIN;Acc:ZDB-GENE-090313-384])

HSP 1 Score: 189.504 bits (480), Expect = 9.491e-52
Identity = 104/270 (38.52%), Postives = 158/270 (58.52%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDLKNDT-LFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNC-EEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSI--PGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKG-DKLVKIGNTRKDEMCNFYIYYWVD 949
            +++P V PT+ D Y C A+ +      +I  F P AS   AHH++++ C  P + + YW+C +E+        C+   KI+++WA  A   +LPKDV   +G      Y V+Q HY +V+ FR  +   D SG+ + +  KP   +AG+YL+ +  ++  PG      + AC+YT  + ++PFA+R HTHSLGK+VSGY +    WT+IG++SP + Q FYP   T+ +  GD LAARC+   +G     +IG T  DEMCNFYI Y++D
Sbjct:   62 IRLPGVVPTESDSYYCMAVPVPTSREAYIVDFVPHASMDTAHHMILYGCKTPYATQGYWDCGKELGT------CRDQAKIMYAWARNAPPTKLPKDVGFKVGGDTRINYFVLQIHYGDVNNFR--DHHRDCSGLSLRMTSKPQPFIAGMYLMMSVDTLIPPGKKVTNADIACTYT-SSPMYPFAFRTHTHSLGKVVSGYRVRNGQWTQIGRQSPLLPQAFYPATNTIDVKDGDILAARCVFTGEGRTTTTQIGGTSNDEMCNFYIMYYMD 322          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Zebrafish
Match: moxd1 (monooxygenase, DBH-like 1 [Source:NCBI gene;Acc:570584])

HSP 1 Score: 62.003 bits (149), Expect = 8.480e-10
Identity = 52/217 (23.96%), Postives = 93/217 (42.86%), Query Frame = 2
Query:  332 CEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEI----TVQRKPTSKL-AGIYLLATDGSIPGHSTVFMEAACSYTG----KTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVE---QMFYPVKGTVKIYPGDTLAARCIMENKGDKLVKIGN-TRKDEMC-NFYIYY 940
            C   N  DS   C++   +LF+WA+   GF  P  V + IG ++   Y+ ++ H+ N           D SG+ +    +++R     +  G+++       PG +    E  C+        + +H FA  +H H  G+ ++     ++   +      Q +   Q F P+     I PGD+L   C    KG   +  G  + ++EMC +F +YY
Sbjct:  259 CYHPNMPDSFLTCET---VLFAWAIGGEGFTYPPHVGMSIGTSIDPVYVQLEIHFDNPSL---QGGIVDSSGLRLYYSPSLRRYDAGVIETGVWVSLYHMLPPGMTDYITEGHCTQECLQEMPSGVHVFAVLLHAHLAGRAITARHFRQQLELQPLASDDQFDFNFQEFQPLSQERLILPGDSLITECRYNTKGRMNMTWGGLSTREEMCLSFLLYY 469          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Zebrafish
Match: dbh (dopamine beta-hydroxylase (dopamine beta-monooxygenase) [Source:ZFIN;Acc:ZDB-GENE-990621-3])

HSP 1 Score: 60.077 bits (144), Expect = 3.078e-9
Identity = 67/278 (24.10%), Postives = 110/278 (39.57%), Query Frame = 2
Query:  176 PTKEDQYICHALDL-----KNDTLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWN--CEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLAT----DGSIPGHS-----TVFMEAACSYTGKTV--LHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVE---QMFYPVKGTVKIYPGDTLAARCIMENKGDKLVKIGNTR-KDEMCNFYIYYW 943
            PT+E  Y CH   L     KN  +         + +  HHI +  C+    + P ++  C+      +   C+    +L +WAM A  F  P D  + +G     ++L ++ HY N       +   D SGI +          AGI  L        +IP        T +  A C+ T   V  +H FA ++HTH  G  V   ++      E+ ++        Q+   ++  V + PGD L   C    +    V +G     +EMC  Y++Y+
Sbjct:  220 PTQETTYWCHIYQLPPNLPKNHIVMYESVITPGNEAIVHHIEVFECSPQMDIVPQYSGSCDSKMKPRNLNYCR---HVLAAWAMGAEPFYYPADAGLPMGGEGSSRFLRLEVHYHNPLLL---SGRRDSSGIRLWYSPSLRRFDAGIMELGLVYTPVMAIPPRQRSFQLTGYCTAKCTQTALPVGGIHIFASQLHTHLAGLGVRTVLVRGGQEVEVVQEDKHFSTHYQIIRVLQKMVTVLPGDALLTTCRFNTEDRSKVTVGGFGIMEEMCVNYVHYY 491          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Zebrafish
Match: dbh (dopamine beta-hydroxylase (dopamine beta-monooxygenase) [Source:ZFIN;Acc:ZDB-GENE-990621-3])

HSP 1 Score: 60.077 bits (144), Expect = 3.187e-9
Identity = 67/278 (24.10%), Postives = 110/278 (39.57%), Query Frame = 2
Query:  176 PTKEDQYICHALDL-----KNDTLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWN--CEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLAT----DGSIPGHS-----TVFMEAACSYTGKTV--LHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVE---QMFYPVKGTVKIYPGDTLAARCIMENKGDKLVKIGNTR-KDEMCNFYIYYW 943
            PT+E  Y CH   L     KN  +         + +  HHI +  C+    + P ++  C+      +   C+    +L +WAM A  F  P D  + +G     ++L ++ HY N       +   D SGI +          AGI  L        +IP        T +  A C+ T   V  +H FA ++HTH  G  V   ++      E+ ++        Q+   ++  V + PGD L   C    +    V +G     +EMC  Y++Y+
Sbjct:  220 PTQETTYWCHIYQLPPNLPKNHIVMYESVITPGNEAIVHHIEVFECSPQMDIVPQYSGSCDSKMKPRNLNYCR---HVLAAWAMGAEPFYYPADAGLPMGGEGSSRFLRLEVHYHNPLLL---SGRRDSSGIRLWYSPSLRRFDAGIMELGLVYTPVMAIPPRQRSFQLTGYCTAKCTQTALPVGGIHIFASQLHTHLAGLGVRTVLVRGGQEVEVVQEDKHFSTHYQIIRVLQKMVTVLPGDALLTTCRFNTEDRSKVTVGGFGIMEEMCVNYVHYY 491          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Xenopus
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:NCBI gene;Acc:100170159])

HSP 1 Score: 192.2 bits (487), Expect = 9.811e-53
Identity = 112/292 (38.36%), Postives = 160/292 (54.79%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDLK-NDTLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYL-LATDGSIP-GHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKGDKL-VKIGNTRKDEMCNFYIYYWVDREDSSQIYDDQNQICFSAGWPKF 1018
            ++MP V PT+ D Y+C +  L  +D  ++  F P AS   AHH+L+  C  P S   YW+C       S   C     I+++WA  A   +LP+ V   +G   G +Y V+Q HY +V  F+  + +     + IT +++P   +AGIYL ++ D  IP G   V  + AC Y  +  +HPFAYRVHTH LG++VSG+ +    WT IG++SPQ+ Q FYPV+  ++I PGD +A RC+   KG      IG T KDEMCN YI Y++D   +S         C   G PK 
Sbjct:   62 IRMPGVTPTESDTYLCKSYRLPVDDEAYVVDFRPHASMDTAHHMLLFGCNMPSSTDDYWDC-------SAGTCTDKSSIMYAWAKNAPPTKLPEGVGFRVGGKSGNRYFVLQVHYGDVKAFQDKHKDCTGVTVRITPEKQPL--IAGIYLSMSVDTVIPPGVDAVNSDIACLYN-RPAIHPFAYRVHTHQLGQVVSGFRVRHGKWTLIGRQSPQLPQAFYPVEHPLEISPGDIIATRCLFTGKGKTTPTYIGGTAKDEMCNLYIMYYMDAAHASSY-----MTCVQTGEPKL 338          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Xenopus
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:NCBI gene;Acc:100170159])

HSP 1 Score: 192.2 bits (487), Expect = 1.310e-52
Identity = 112/292 (38.36%), Postives = 160/292 (54.79%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDLK-NDTLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYL-LATDGSIP-GHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKGDKL-VKIGNTRKDEMCNFYIYYWVDREDSSQIYDDQNQICFSAGWPKF 1018
            ++MP V PT+ D Y+C +  L  +D  ++  F P AS   AHH+L+  C  P S   YW+C       S   C     I+++WA  A   +LP+ V   +G   G +Y V+Q HY +V  F+  + +     + IT +++P   +AGIYL ++ D  IP G   V  + AC Y  +  +HPFAYRVHTH LG++VSG+ +    WT IG++SPQ+ Q FYPV+  ++I PGD +A RC+   KG      IG T KDEMCN YI Y++D   +S         C   G PK 
Sbjct:   62 IRMPGVTPTESDTYLCKSYRLPVDDEAYVVDFRPHASMDTAHHMLLFGCNMPSSTDDYWDC-------SAGTCTDKSSIMYAWAKNAPPTKLPEGVGFRVGGKSGNRYFVLQVHYGDVKAFQDKHKDCTGVTVRITPEKQPL--IAGIYLSMSVDTVIPPGVDAVNSDIACLYN-RPAIHPFAYRVHTHQLGQVVSGFRVRHGKWTLIGRQSPQLPQAFYPVEHPLEISPGDIIATRCLFTGKGKTTPTYIGGTAKDEMCNLYIMYYMDAAHASSY-----MTCVQTGEPKL 338          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Xenopus
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:NCBI gene;Acc:100170159])

HSP 1 Score: 192.2 bits (487), Expect = 1.378e-52
Identity = 112/292 (38.36%), Postives = 160/292 (54.79%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDLK-NDTLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYL-LATDGSIP-GHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKGDKL-VKIGNTRKDEMCNFYIYYWVDREDSSQIYDDQNQICFSAGWPKF 1018
            ++MP V PT+ D Y+C +  L  +D  ++  F P AS   AHH+L+  C  P S   YW+C       S   C     I+++WA  A   +LP+ V   +G   G +Y V+Q HY +V  F+  + +     + IT +++P   +AGIYL ++ D  IP G   V  + AC Y  +  +HPFAYRVHTH LG++VSG+ +    WT IG++SPQ+ Q FYPV+  ++I PGD +A RC+   KG      IG T KDEMCN YI Y++D   +S         C   G PK 
Sbjct:   62 IRMPGVTPTESDTYLCKSYRLPVDDEAYVVDFRPHASMDTAHHMLLFGCNMPSSTDDYWDC-------SAGTCTDKSSIMYAWAKNAPPTKLPEGVGFRVGGKSGNRYFVLQVHYGDVKAFQDKHKDCTGVTVRITPEKQPL--IAGIYLSMSVDTVIPPGVDAVNSDIACLYN-RPAIHPFAYRVHTHQLGQVVSGFRVRHGKWTLIGRQSPQLPQAFYPVEHPLEISPGDIIATRCLFTGKGKTTPTYIGGTAKDEMCNLYIMYYMDAAHASSY-----MTCVQTGEPKL 338          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Xenopus
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:NCBI gene;Acc:100170159])

HSP 1 Score: 182.57 bits (462), Expect = 2.657e-49
Identity = 109/291 (37.46%), Postives = 153/291 (52.58%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDLK-NDTLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYL-LATDGSIPGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKGDKL-VKIGNTRKDEMCNFYIYYWVDREDSSQIYDDQNQICFSAGWPKF 1018
            ++MP V PT+ D Y+C +  L  +D  ++  F P AS   AHH+L+  C  P S   YW+C       S   C     I+++WA  A   +LP+ V   +G   G +Y V+Q HY +V  F+                ++P   +AGIYL ++ D  IP    V  + AC Y  +  +HPFAYRVHTH LG++VSG+ +    WT IG++SPQ+ Q FYPV+  ++I PGD +A RC+   KG      IG T KDEMCN YI Y++D   +S         C   G PK 
Sbjct:   62 IRMPGVTPTESDTYLCKSYRLPVDDEAYVVDFRPHASMDTAHHMLLFGCNMPSSTDDYWDC-------SAGTCTDKSSIMYAWAKNAPPTKLPEGVGFRVGGKSGNRYFVLQVHYGDVKAFQG---------------KQPL--IAGIYLSMSVDTVIPPGVDVNSDIACLYN-RPAIHPFAYRVHTHQLGQVVSGFRVRHGKWTLIGRQSPQLPQAFYPVEHPLEISPGDIIATRCLFTGKGKTTPTYIGGTAKDEMCNLYIMYYMDAAHASSY-----MTCVQTGEPKL 322          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Xenopus
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:NCBI gene;Acc:100170159])

HSP 1 Score: 177.948 bits (450), Expect = 1.062e-47
Identity = 109/291 (37.46%), Postives = 151/291 (51.89%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDLK-NDTLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYL-LATDGSIPGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKGDKL-VKIGNTRKDEMCNFYIYYWVDREDSSQIYDDQNQICFSAGWPKF 1018
            ++MP V PT+ D Y+C +  L  +D  ++  F P AS   AHH+L+  C  P S   YW+C       S   C     I+++WA  A   +LP+ V   +G   G +Y V+Q HY              +      V R+P   +AGIYL ++ D  IP    V  + AC Y  +  +HPFAYRVHTH LG++VSG+ +    WT IG++SPQ+ Q FYPV+  ++I PGD +A RC+   KG      IG T KDEMCN YI Y++D   +S         C   G PK 
Sbjct:   48 IRMPGVTPTESDTYLCKSYRLPVDDEAYVVDFRPHASMDTAHHMLLFGCNMPSSTDDYWDC-------SAGTCTDKSSIMYAWAKNAPPTKLPEGVGFRVGGKSGNRYFVLQVHY-------------GDKYCCFYVCRQPL--IAGIYLSMSVDTVIPPGVDVNSDIACLYN-RPAIHPFAYRVHTHQLGQVVSGFRVRHGKWTLIGRQSPQLPQAFYPVEHPLEISPGDIIATRCLFTGKGKTTPTYIGGTAKDEMCNLYIMYYMDAAHASSY-----MTCVQTGEPKL 310          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Mouse
Match: Pam (peptidylglycine alpha-amidating monooxygenase [Source:MGI Symbol;Acc:MGI:97475])

HSP 1 Score: 190.66 bits (483), Expect = 2.238e-52
Identity = 106/269 (39.41%), Postives = 150/269 (55.76%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDLKNDT-LFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSI--PGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKG-DKLVKIGNTRKDEMCNFYIYYWVD 949
            ++MP V P + D Y C ++ L  D   F+  F P+AS    HH+L+  C  P S   YW C+E         C     IL++WA  A   RLPK V   +G   G +Y V+Q HY ++  FR  ++  D SG+ + + R P   +AG+YL+ +  ++  PG   V  + +C Y     +H FAYRVHTH LGK+VSGY +    WT IG++SPQ+ Q FYPV+  V +  GD LAARC+   +G  +   IG T  DEMCN YI Y+++
Sbjct:   65 IRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGT-------CTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFR--DNHKDCSGVSLHLTRVPQPLIAGMYLMMSVNTVIPPGEKVVNSDISCHYK-MYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQSPQLPQAFYPVEHPVDVAFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYME 323          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Mouse
Match: Pam (peptidylglycine alpha-amidating monooxygenase [Source:MGI Symbol;Acc:MGI:97475])

HSP 1 Score: 191.045 bits (484), Expect = 2.628e-52
Identity = 106/269 (39.41%), Postives = 150/269 (55.76%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDLKNDT-LFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSI--PGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKG-DKLVKIGNTRKDEMCNFYIYYWVD 949
            ++MP V P + D Y C ++ L  D   F+  F P+AS    HH+L+  C  P S   YW C+E         C     IL++WA  A   RLPK V   +G   G +Y V+Q HY ++  FR  ++  D SG+ + + R P   +AG+YL+ +  ++  PG   V  + +C Y     +H FAYRVHTH LGK+VSGY +    WT IG++SPQ+ Q FYPV+  V +  GD LAARC+   +G  +   IG T  DEMCN YI Y+++
Sbjct:   65 IRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGT-------CTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFR--DNHKDCSGVSLHLTRVPQPLIAGMYLMMSVNTVIPPGEKVVNSDISCHYK-MYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQSPQLPQAFYPVEHPVDVAFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYME 323          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Mouse
Match: Pam (peptidylglycine alpha-amidating monooxygenase [Source:MGI Symbol;Acc:MGI:97475])

HSP 1 Score: 190.66 bits (483), Expect = 3.115e-52
Identity = 106/269 (39.41%), Postives = 150/269 (55.76%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDLKNDT-LFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSI--PGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKG-DKLVKIGNTRKDEMCNFYIYYWVD 949
            ++MP V P + D Y C ++ L  D   F+  F P+AS    HH+L+  C  P S   YW C+E         C     IL++WA  A   RLPK V   +G   G +Y V+Q HY ++  FR  ++  D SG+ + + R P   +AG+YL+ +  ++  PG   V  + +C Y     +H FAYRVHTH LGK+VSGY +    WT IG++SPQ+ Q FYPV+  V +  GD LAARC+   +G  +   IG T  DEMCN YI Y+++
Sbjct:   65 IRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGT-------CTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFR--DNHKDCSGVSLHLTRVPQPLIAGMYLMMSVNTVIPPGEKVVNSDISCHYK-MYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQSPQLPQAFYPVEHPVDVAFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYME 323          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Mouse
Match: Dbh (dopamine beta hydroxylase [Source:MGI Symbol;Acc:MGI:94864])

HSP 1 Score: 67.0106 bits (162), Expect = 2.699e-11
Identity = 59/224 (26.34%), Postives = 89/224 (39.73%), Query Frame = 2
Query:  332 CEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATD----GSIPGHSTVFMEAA-----CSYTG--KTVLHPFAYRVHTHSLGKLVSGYVIH----RKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKGDKLVKIGNTR-KDEMCNFYIYYWVDRE 955
            C+     D    C+    +L +WA+ A  F  PK+  V  G      +L ++ HY N    RK     D SGI +          AGI  L        +IP   T F+        C+      + +H FA ++HTH  G+ V   +      RK        SP  +++   +K  V +YPGD L   C    +   L  +G     +EMC  Y++Y+   E
Sbjct:  287 CDSKMKPDRLNYCR---HVLAAWALGAKAFYYPKEAGVPFGGPGSSPFLRLEVHYHNP---RKIQGRQDSSGIRLHYTATLRRYDAGIMELGLVYTPLMAIPPQETAFVLTGYCTDKCTQMALQDSGIHIFASQLHTHLTGRKVVTVLARDGQERKVVNRDNHYSPHFQEIRM-LKKVVTVYPGDVLITSCTYNTENKTLATVGGFGILEEMCVNYVHYYPQTE 503          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Mouse
Match: Moxd1 (monooxygenase, DBH-like 1 [Source:MGI Symbol;Acc:MGI:1921582])

HSP 1 Score: 55.8398 bits (133), Expect = 8.070e-8
Identity = 55/244 (22.54%), Postives = 101/244 (41.39%), Query Frame = 2
Query:  332 CEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEI----TVQRKPTSKLAGIYLLATDGSIP---------GHSTV-FMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVE-----QMFYPVKGTVKIYPGDTLAARCIMENKGDKLVKIGN-TRKDEMCNFYIYYW--VDREDSSQIYDDQNQICF 997
            C   N  D+   C++   ++ +W +   GF  P  V + +G  +  +Y++++ HY N     +     D SG+ +     ++R     +     ++   +IP         GH T+  +E A      + +H FA  +H H  GK +   + H +   E+   +   +     Q F  ++    I PGD L   C    K   ++  G  + ++EMC  Y+ Y+  V+    S I D   Q+ F
Sbjct:  257 CYHPNMPDAFLTCET---VILAWGIGGEGFTYPPHVGLSLGMPLDPRYVLLEVHYDNP---ARRKGLIDSSGLRVFHTTDIRRYDAGVIEAGLWVSLFHTIPPGMPEFHSEGHCTLECLEEALGAEKPSGIHVFAVLLHAHLAGKGIR--LRHFRKGEEMKLLAYDDDYDFNFQEFQYLREEQTILPGDNLITECRYNTKDRAVMTWGGLSTRNEMCLSYLLYYPRVNLTRCSSIPDIMEQLQF 492          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. UniProt/SwissProt
Match: sp|Q95XM2|PHM_CAEEL (Probable peptidylglycine alpha-hydroxylating monooxygenase 1 OS=Caenorhabditis elegans OX=6239 GN=pghm-1 PE=1 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 9.338e-69
Identity = 125/310 (40.32%), Postives = 175/310 (56.45%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDLKNDTLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSK----PICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSIPGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVI-----HRKNWTEIGKKSPQVEQMFYPVKG-TVKIYPGDTLAARCIMENKGDKLVKIGNTRKDEMCNFYIYYWVDREDSSQIYDDQNQICFSAGWPKFKWDSFFDSLKIP 1054
            ++MP V P + D Y+C +L+L +   ++TGF    +   AHHIL+  C EPGS +  W+C EMN  D +    P C S   IL++WA+ A    LP+DV   +G     ++LV+Q HY +         EPDE+G+EIT   +P  KLA   LL T G++P + T   E AC      V+HPFAYR HTH  GK VSG+++     H  +W  IG++ PQ+ QMF PV+   + I  GD + ARCI++N  ++ + +G T +DEMCNFYI YW D E        Q+  C+S G P +KW    D   IP
Sbjct:   27 IRMPGVVP-EADSYLCTSLELSDQENYLTGFKALTTKGTAHHILLFGCEEPGSDELVWDCGEMNKPDDEMPRAPTCGSKPAILYAWALDAPPLELPQDVGFRVGGDSNIRHLVMQVHYMHS------KQEPDETGLEITHTEEPQPKLAATMLLVTGGTLPRNKTESFETACMIEEDVVMHPFAYRTHTHRHGKEVSGWLVKEDQKHEDHWKLIGRRDPQLAQMFVPVEDQAMTIQQGDMVTARCILQNNENRDISMGATEEDEMCNFYIMYWTDGEVM------QDNTCYSPGAPDYKWAREADLNHIP 323          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. UniProt/SwissProt
Match: sp|O01404|PHM_DROME (Peptidylglycine alpha-hydroxylating monooxygenase OS=Drosophila melanogaster OX=7227 GN=Phm PE=1 SV=2)

HSP 1 Score: 224.172 bits (570), Expect = 8.795e-68
Identity = 123/301 (40.86%), Postives = 172/301 (57.14%), Query Frame = 2
Query:  161 MPKVRPTKEDQYICHALDLK-NDTLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMN---AKDSKPIC--KSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSIPGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIH-----RKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKGDKLVKIGNTRKDEMCNFYIYYWVDREDSSQIYDDQNQICFSAGWPKFKWDS 1030
            MP V P   D Y+C  + +    T +I GFNP A+ + AHH+L++ C EPG+ K  WNC EMN    ++S   C   S  +I+++WA  A    LP+ V   +GK    +YLV+Q HY ++D F+  +   D+SG+ +    +P  KLAG  LL TDG IP   T  +E AC    + VLHPFAYRVHTH LGK+VSGY +       + W ++GK+ P   QMFY    T  I  GD +A RC M++   +  KIG T +DEMCNFY+ Y+VD  ++  +     + CFS G P + W +
Sbjct:   56 MPNVSPQTPDLYLCTPIKVDPTTTYYIVGFNPNATMNTAHHMLLYGCGEPGTSKTTWNCGEMNRASQEESASPCGPHSNSQIVYAWARDAQKLNLPEGVGFKVGKNSPIKYLVLQVHYAHIDKFK--DGSTDDSGVFLDYTEEPRKKLAGTLLLGTDGQIPAMKTEHLETACEVNEQKVLHPFAYRVHTHGLGKVVSGYRVRTNSDGEQEWLQLGKRDPLTPQMFYNTSNTDPIIEGDKIAVRCTMQSTRHRTTKIGPTNEDEMCNFYLMYYVDHGETLNM-----KFCFSQGAPYYFWSN 349          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. UniProt/SwissProt
Match: sp|P08478|AMDA_XENLA (Peptidyl-glycine alpha-amidating monooxygenase A OS=Xenopus laevis OX=8355 GN=pam-a PE=1 SV=3)

HSP 1 Score: 192.971 bits (489), Expect = 3.629e-52
Identity = 111/292 (38.01%), Postives = 159/292 (54.45%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDLK-NDTLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYL-LATDGSIP-GHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKG-DKLVKIGNTRKDEMCNFYIYYWVDREDSSQIYDDQNQICFSAGWPKF 1018
            ++MP V PT+ D Y+C +  L  +D  ++  F P A+   AHH+L+  C  P S   YW+C       S   C     I+++WA  A   +LP+ V   +G   G +Y V+Q HY NV  F+  +   D +G+ + V  +   ++AGIYL ++ D  IP G   V  + AC Y   T+ HPFAYRVHTH LG++VSG+ +    W+ IG++SPQ+ Q FYPV+  V+I PGD +A RC+   KG      IG T  DEMCN YI Y++D   ++         C   G PK 
Sbjct:   62 IRMPGVTPTESDTYLCKSYRLPVDDEAYVVDFRPHANMDTAHHMLLFGCNIPSSTDDYWDC-------SAGTCMDKSSIMYAWAKNAPPTKLPEGVGFRVGGKSGSRYFVLQVHYGNVKAFQ--DKHKDCTGVTVRVTPEKQPQIAGIYLSMSVDTVIPPGEEAVNSDIACLYNRPTI-HPFAYRVHTHQLGQVVSGFRVRHGKWSLIGRQSPQLPQAFYPVEHPVEISPGDIIATRCLFTGKGRTSATYIGGTSNDEMCNLYIMYYMDAAHATSY-----MTCVQTGEPKL 338          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. UniProt/SwissProt
Match: sp|P10731|AMD_BOVIN (Peptidyl-glycine alpha-amidating monooxygenase OS=Bos taurus OX=9913 GN=PAM PE=1 SV=2)

HSP 1 Score: 192.586 bits (488), Expect = 5.056e-52
Identity = 107/269 (39.78%), Postives = 152/269 (56.51%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDLKNDT-LFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSI--PGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKG-DKLVKIGNTRKDEMCNFYIYYWVD 949
            ++MP V P + D Y C ++ L  D   F+  F P+AS    HH+L+  C  P S   YW C+E         C     IL++WA  A   RLPK V   +G   G +Y V+Q HY ++  FR  ++  D SG+ + + R P   +AG+YL+ +  ++  PG   V  + +C Y  K  +H FAYRVHTH LGK+VSGY +    WT IG++SPQ+ Q FYPV+  V +  GD LAARC+   +G  ++  IG T  DEMCN YI Y+++
Sbjct:   61 IRMPGVTPKQSDTYFCMSVRLPMDEEAFVIDFKPRASMDTVHHMLLFGCNMPASTGNYWFCDEGT-------CTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFR--DNHKDCSGVSLHLTRLPQPLIAGMYLMMSVDTVIPPGGKVVNSDISCHYK-KYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQSPQLPQAFYPVEHPVDVSFGDILAARCVFTGEGRTEVTHIGGTSSDEMCNLYIMYYME 319          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. UniProt/SwissProt
Match: sp|P97467|AMD_MOUSE (Peptidyl-glycine alpha-amidating monooxygenase OS=Mus musculus OX=10090 GN=Pam PE=1 SV=2)

HSP 1 Score: 191.045 bits (484), Expect = 1.838e-51
Identity = 106/269 (39.41%), Postives = 150/269 (55.76%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDLKNDT-LFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSI--PGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKG-DKLVKIGNTRKDEMCNFYIYYWVD 949
            ++MP V P + D Y C ++ L  D   F+  F P+AS    HH+L+  C  P S   YW C+E         C     IL++WA  A   RLPK V   +G   G +Y V+Q HY ++  FR  ++  D SG+ + + R P   +AG+YL+ +  ++  PG   V  + +C Y     +H FAYRVHTH LGK+VSGY +    WT IG++SPQ+ Q FYPV+  V +  GD LAARC+   +G  +   IG T  DEMCN YI Y+++
Sbjct:   65 IRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGT-------CTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFR--DNHKDCSGVSLHLTRVPQPLIAGMYLMMSVNTVIPPGEKVVNSDISCHYK-MYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQSPQLPQAFYPVEHPVDVAFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYME 323          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. TrEMBL
Match: Q4W7B5 (Peptidylglycine a-hydroxylating monooxygenase OS=Dugesia japonica OX=6161 GN=phm PE=2 SV=1)

HSP 1 Score: 555.829 bits (1431), Expect = 0.000e+0
Identity = 272/370 (73.51%), Postives = 316/370 (85.41%), Query Frame = 2
Query:  146 EILLKMPKVRPTKEDQYICHALDLKNDTLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSIPGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKGDKLVKIGNTRKDEMCNFYIYYWVDREDSSQIYDDQNQICFSAGWPKFKWDSFFDSLKIPSAAAMLPGANNIINEIVNDMEKQERNMDKLISNMWDDNPKENSDDILDDTLFD---HKKFENFDELF 1246
            E+LLKMP V+PTKED+YICHA+DLKN+T+FITGF PKA+ASHAHHILIHSC EPGS+K +WNC EM  KD++P+CKSG K+++SWAM ASGFRLPKDVS+MIGK++GKQYLVIQSHYK+VDYFR+PNSEPDESGI + +Q KPT KLAG+YLLATDGSIPGHSTVFMEAACSYTG  VLHPFAYRVHTHSLGKLVSGYV+HRKNWTEIGKKSPQ EQMFYPVKG V I PGD+LAARC+MENKGDKLV+IG+TR DEMCNFYIYYWV+R DS+QIYDD+NQICF+ GWP +KWD+F D  KIP  AAMLPG+N    E++N+M   E+ MDKL+S    D   E  DD  D++  D   HKKFEN ++ F
Sbjct:   17 ELLLKMPGVKPTKEDEYICHAMDLKNETVFITGFQPKANASHAHHILIHSCVEPGSIKSFWNCLEMKIKDTRPVCKSGEKLIYSWAMNASGFRLPKDVSIMIGKSIGKQYLVIQSHYKHVDYFREPNSEPDESGIILKIQHKPTKKLAGLYLLATDGSIPGHSTVFMEAACSYTGGIVLHPFAYRVHTHSLGKLVSGYVVHRKNWTEIGKKSPQEEQMFYPVKGNVIIQPGDSLAARCVMENKGDKLVRIGSTRNDEMCNFYIYYWVNRADSAQIYDDKNQICFTQGWPDYKWDNFIDPSKIPVTAAMLPGSNEAFKEMINNMNNDEKEMDKLMS----DELNEIYDD-FDNSFIDLPNHKKFENVEDEF 381          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. TrEMBL
Match: A0A1I8JKY8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014389g2 PE=4 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 6.775e-85
Identity = 144/344 (41.86%), Postives = 209/344 (60.76%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDLKNDTLFITGFNPKXXXXXXXXXXXXXCTEPGSV-KPYWNCEEMNAKD----------SKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSIPGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKGDKLVKIGNTRKDEMCNFYIYYWVDREDSSQIYDDQNQICFSAGWPKFKWDSFFDSLKIPSAAAMLPGANNIINEIVNDMEKQERNMDKLISN 1153
            L MP V P +ED Y+C A+ L  +  +I  FNP+  + HAHHI++ +C EPGS  +  WNC EM  K             P C S  +I++++AM A   +LP  V+  +G      +LV+Q HYK    F K  S  D SG+++T Q  P+ KL G+++  TDG IP HS   ME +CSY G+T LHPFA+R HTHS G++VSGY +   +W+ IG  +PQ+ QMFYPV G+  I PGD LAA+C+MEN GDK V IG T+KDEMCNFY+ YW+  +D   +  D +++C+++G     WD       + +A+A +PG   +  E+  +M++ +R M +++ N
Sbjct:   38 LLMPGVSPKQEDTYLCTAVKLDKNR-YIRAFNPQHQSGHAHHIILTACKEPGSATEKVWNCGEMLTKSEGAAGDKTYKQAPQCASDTRIIYAYAMDAPALQLPDGVTFGVGPGFDLPWLVVQVHYKKASDFVKNPSLKDNSGVKMTYQTTPSPKLGGVHISLTDGVIPAHSVTHMETSCSYDGQTTLHPFAFRTHTHSHGRVVSGYRVRDGHWSLIGSANPQMPQMFYPVNGSGVIRPGDMLAAKCVMENTGDKDVSIGATQKDEMCNFYMMYWIRADD---VGKDGSRMCYTSGE---LWD--LAPSSVMAASATVPGTERVFREMNREMDRMDRMMKQMLLN 372          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. TrEMBL
Match: A0A1I8H4G9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 274.248 bits (700), Expect = 1.294e-84
Identity = 143/342 (41.81%), Postives = 208/342 (60.82%), Query Frame = 2
Query:  161 MPKVRPTKEDQYICHALDLKNDTLFITGFNPKXXXXXXXXXXXXXCTEPGSV-KPYWNCEEMNAKD----------SKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSIPGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKGDKLVKIGNTRKDEMCNFYIYYWVDREDSSQIYDDQNQICFSAGWPKFKWDSFFDSLKIPSAAAMLPGANNIINEIVNDMEKQERNMDKLISN 1153
            MP V P +ED Y+C A+ L  +  +I  FNP+  + HAHHI++ +C EPGS  +  WNC EM  K             P C S  +I++++AM A   +LP  V+  +G      +LV+Q HYK    F K  S  D SG+++T Q  P+ KL G+++  TDG IP HS   ME +CSY G+T LHPFA+R HTHS G++VSGY +   +W+ IG  +PQ+ QMFYPV G+  I PGD LAA+C+MEN GDK V IG T+KDEMCNFY+ YW+  +D   +  D +++C+++G     WD       + +A+A +PG   +  E+  +M++ +R M +++ N
Sbjct:    1 MPGVSPKQEDTYLCTAVKLDKNR-YIRAFNPQHQSGHAHHIILTACKEPGSATEKVWNCGEMLTKSEGAAGDKTYKQAPQCASDTRIIYAYAMDAPALQLPDGVTFGVGPGFDLPWLVVQVHYKKASDFVKNPSLKDNSGVKMTYQTTPSPKLGGVHISLTDGVIPAHSVTHMETSCSYDGQTTLHPFAFRTHTHSHGRVVSGYRVRDGHWSLIGSANPQMPQMFYPVNGSGVIRPGDMLAAKCVMENTGDKDVSIGATQKDEMCNFYMMYWIRADD---VGKDGSRMCYTSGE---LWD--LAPSSVMAASATVPGTERVFREMNREMDRMDRMMKQMLLN 333          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. TrEMBL
Match: A0A1I8GEQ7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014389g3 PE=4 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 3.018e-84
Identity = 143/344 (41.57%), Postives = 210/344 (61.05%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDLKNDTLFITGFNPKXXXXXXXXXXXXXCTEPGSV-KPYWNCEEMNAKD----------SKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSIPGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKGDKLVKIGNTRKDEMCNFYIYYWVDREDSSQIYDDQNQICFSAGWPKFKWDSFFDSLKIPSAAAMLPGANNIINEIVNDMEKQERNMDKLISN 1153
            L MP V P +ED Y+C A+ L  +  +I  FNP+  + HAHHI++ +C EPGS  +  W+C EM  K             P C S  +I++++AM A   +LP  V+  +G      +LV+Q HYK    F K  S  D SG+++T Q  P+ KL G+++  TDG IP HS   ME +CSY G+T LHPFA+R HTHS G++VSGY +   +W+ IG  +PQ+ QMFYPV G+  I PGD LAA+C+MEN GDK V IG T+KDEMCNFY+ YW+  +D   +  D +++C+++G     WD       + +A+A +PG   +  E+  +M++ +R M++++ N
Sbjct:   38 LLMPGVSPKQEDTYLCTAVKLDKNR-YIRAFNPQHQSGHAHHIILTACKEPGSATEKVWSCGEMLTKSEGATGGKTYKQAPQCASDTRIIYAYAMDAPALQLPDGVTFGVGPGFDLPWLVVQVHYKKASDFVKNPSLKDNSGVKMTYQTTPSPKLGGVHISLTDGVIPAHSVTHMETSCSYDGQTTLHPFAFRTHTHSHGRVVSGYRVRDGHWSLIGSANPQMPQMFYPVNGSGVIRPGDMLAAKCVMENTGDKDVSIGATQKDEMCNFYMMYWIRADD---VGKDGSRMCYTSGE---LWD--LAPSSVMAASATVPGTERVFREMNREMDRMDRMMNQMLLN 372          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. TrEMBL
Match: A0A0B7AQ08 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF129574 PE=4 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 1.460e-80
Identity = 155/374 (41.44%), Postives = 215/374 (57.49%), Query Frame = 2
Query:  146 EILLKMPKVRPTKEDQYICHALDLKNDTLFITGFNPKXXXXXXXXXXXXXCTEPGSVK-PYWNCEEMNAKDSK----PICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSIPGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGT-VKIYPGDTLAARCIMENKGDKLVKIGNTRKDEMCNFYIYYWVDREDSSQIYDDQNQICFSAGWPKFKWDSFFDSLKI-----PSAAAMLPGANN--IINEIVNDMEKQERNMDKLISNMWDDNPKENSDDILDDTLFDHKKFE 1228
            EI L MPKVRP + D Y+C A+++++   +ITGF P A ++ AHH+L++ C+ PG+     WNC EM++  S      +C+ G  IL++WAM A    LPKDVS  IG+    ++LV+Q HYKNV  F  P++  D SG+ +   + PTSK AG+YL+ TDG IP HS  + E AC +     + PFAYR H H LG+++SGY I    WTEIG+K P++ +MFY      + +  GD LAARC MEN  +  V +G T+ DEMCNFYI Y+V+R   + I +D   IC S G P + W  F D  KI     P   ++LPG     I N    D +K E  +  +     D     N D+I+D T+ D    E
Sbjct:   32 EINLLMPKVRPQEPDIYLCKAMEVEDAHRYITGFVPNADSNIAHHMLLYGCSMPGAPPGEVWNCGEMSSTSSSYRVGAVCQEGNTILYAWAMEAPKLSLPKDVSFEIGQKTPIKFLVVQVHYKNVTKFLPPHNGDDSSGLTLITTKVPTSKQAGVYLMLTDGFIPAHSIEYFETACEFEEDIEIVPFAYRTHAHGLGRVISGYRIRDGKWTEIGRKDPRLPEMFYNTTNPDITVRRGDILAARCTMENTLEHDVAVGLTQNDEMCNFYIMYYVNR---APILND--HICGSNGPPAWYWSDFEDQKKINLQKAPETVSVLPGTQKPLIRNATYGDDDKTEETLVGIPGKFGDI----NEDEIVDKTIGDMSSNE 396          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Cavefish
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:NCBI gene;Acc:103031431])

HSP 1 Score: 188.348 bits (477), Expect = 1.247e-51
Identity = 106/273 (38.83%), Postives = 155/273 (56.78%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDLKND-TLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSI--PGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKG-DKLVKIGNTRKDEMCNFYIYYWVDREDS 961
            ++MP V P+  D Y C A+ +      +I  F P AS   AHH+L++ C  P S K YW+C           C+   KI+++WA  A   +LPKDV   +G      Y V+Q HY ++  FR  +   D SG+ + +  KP   +AG+YL+ +  ++  PG +    + AC+Y     ++PFA+R HTH LGK+VSGY I    WT IG++SPQ+ Q FYPV   +++  GDTLAARC+   +G     +IG T  DEMCNFY+ Y++D + S
Sbjct:   62 IRMPGVVPSASDSYYCVAVPVPTSWEAYIVDFVPHASMDTAHHMLLYGCRNPTSTKGYWDCGREQG-----TCEDEAKIMYAWARNAPPTKLPKDVGFKVGGDTRITYFVLQIHYGDIKNFR--DHHKDCSGLTLRMTSKPQPFIAGMYLMMSVDTVIPPGKTVTNADIACTYLSYP-MYPFAFRTHTHRLGKVVSGYRIRNGQWTLIGRQSPQLPQAFYPVSNDIEVKYGDTLAARCVFTGEGRSSKTRIGGTSNDEMCNFYMMYYMDNKHS 326          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Cavefish
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:NCBI gene;Acc:103031431])

HSP 1 Score: 188.734 bits (478), Expect = 1.359e-51
Identity = 106/273 (38.83%), Postives = 155/273 (56.78%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDLKND-TLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSI--PGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKG-DKLVKIGNTRKDEMCNFYIYYWVDREDS 961
            ++MP V P+  D Y C A+ +      +I  F P AS   AHH+L++ C  P S K YW+C           C+   KI+++WA  A   +LPKDV   +G      Y V+Q HY ++  FR  +   D SG+ + +  KP   +AG+YL+ +  ++  PG +    + AC+Y     ++PFA+R HTH LGK+VSGY I    WT IG++SPQ+ Q FYPV   +++  GDTLAARC+   +G     +IG T  DEMCNFY+ Y++D + S
Sbjct:   62 IRMPGVVPSASDSYYCVAVPVPTSWEAYIVDFVPHASMDTAHHMLLYGCRNPTSTKGYWDCGREQG-----TCEDEAKIMYAWARNAPPTKLPKDVGFKVGGDTRITYFVLQIHYGDIKNFR--DHHKDCSGLTLRMTSKPQPFIAGMYLMMSVDTVIPPGKTVTNADIACTYLSYP-MYPFAFRTHTHRLGKVVSGYRIRNGQWTLIGRQSPQLPQAFYPVSNDIEVKYGDTLAARCVFTGEGRSSKTRIGGTSNDEMCNFYMMYYMDNKHS 326          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Cavefish
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:NCBI gene;Acc:103031431])

HSP 1 Score: 188.348 bits (477), Expect = 1.837e-51
Identity = 106/273 (38.83%), Postives = 155/273 (56.78%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDLKND-TLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSI--PGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKG-DKLVKIGNTRKDEMCNFYIYYWVDREDS 961
            ++MP V P+  D Y C A+ +      +I  F P AS   AHH+L++ C  P S K YW+C           C+   KI+++WA  A   +LPKDV   +G      Y V+Q HY ++  FR  +   D SG+ + +  KP   +AG+YL+ +  ++  PG +    + AC+Y     ++PFA+R HTH LGK+VSGY I    WT IG++SPQ+ Q FYPV   +++  GDTLAARC+   +G     +IG T  DEMCNFY+ Y++D + S
Sbjct:   62 IRMPGVVPSASDSYYCVAVPVPTSWEAYIVDFVPHASMDTAHHMLLYGCRNPTSTKGYWDCGREQG-----TCEDEAKIMYAWARNAPPTKLPKDVGFKVGGDTRITYFVLQIHYGDIKNFR--DHHKDCSGLTLRMTSKPQPFIAGMYLMMSVDTVIPPGKTVTNADIACTYLSYP-MYPFAFRTHTHRLGKVVSGYRIRNGQWTLIGRQSPQLPQAFYPVSNDIEVKYGDTLAARCVFTGEGRSSKTRIGGTSNDEMCNFYMMYYMDNKHS 326          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Cavefish
Match: moxd1 (monooxygenase DBH like 1 [Source:NCBI gene;Acc:103035147])

HSP 1 Score: 63.5438 bits (153), Expect = 2.506e-10
Identity = 55/228 (24.12%), Postives = 94/228 (41.23%), Query Frame = 2
Query:  329 NCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSI-----PGHSTVFMEAACSY------------TGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVE-----QMFYPVKGTVKIYPGDTLAARCIMENKG-DKLVKIGNTRKDEMCNFYIYYW 943
            NC   N  DS   C++   ++F+WA+   GF  P  V + IG  +   Y++++ H+ N           D SG+ +    K  +  AG+       S+     PG      E  C+             +G +V   FA  +H H  G+ +     H +   E+   +   +     Q F P+    +I PGD+L   C+   KG + +   G + ++EMC  Y+ Y+
Sbjct:  285 NCFHPNMPDSFTTCET---VIFAWAIGGEGFTYPPHVGMSIGTDIDPVYVLMEMHFDNPAL---QTDVVDSSGLRLFYTPKLRTYDAGVIETGVWVSLYHMLPPGMEDFITEGHCTQECLQESLESEMPSGVSV---FAALLHAHLAGRAIR--TRHFRQQVELPPMALDDQFDFNFQEFQPLSPERQILPGDSLITECVYNTKGRNNMTWGGLSTRNEMCLSYLLYY 501          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Cavefish
Match: dbh (dopamine beta-hydroxylase (dopamine beta-monooxygenase) [Source:ZFIN;Acc:ZDB-GENE-990621-3])

HSP 1 Score: 53.9138 bits (128), Expect = 2.212e-7
Identity = 50/198 (25.25%), Postives = 81/198 (40.91%), Query Frame = 2
Query:  386 ILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLAT----DGSIPGHSTVFMEA-----ACSYTG--KTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKGDKLVKIGNTR-KDEMCNFYIYYW 943
            +L +WA+ A  F  P D  + IG     ++L ++ HY N       +   D SGI +   R      AGI  L        +IP   + F  +     AC+ T   +  +H FA ++HTH  G+ V   ++        G K  +V Q         ++  GD L  +C    +      +G     +EMC  Y++Y+
Sbjct:  278 VLAAWALGAEPFYYPMDAGLPIGGEGSSRFLRLEVHYHNPLII---SGRQDSSGIRLWYTRSLRRFDAGIMELGLVYTPVMAIPPRQSSFPLSGYCIPACTRTALPQGGIHIFASQLHTHLAGRTVRTVLVR-------GGKEVEVVQEDKHYSTHYQVLHGDALVTKCTFNTEDRNKPTVGGFGIMEEMCVNYVHYY 465          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Sea Lamprey
Match: moxd1l (monooxygenase, DBH-like 1, like [Source:NCBI gene;Acc:553484])

HSP 1 Score: 56.225 bits (134), Expect = 7.496e-9
Identity = 55/228 (24.12%), Postives = 92/228 (40.35%), Query Frame = 2
Query:  332 CEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKN------------VDYFRKPNSEPDESG-IEITVQRKPTSKLAGIYLLATDGSIPGHSTVFMEAACSYTGKTV---LHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMF-----YPVKGTVKIYPGDTLAARCIMENKG---DKLVKIGNTRKDEMCNFYIYYW 943
            C   N  DS   C  G  I+  WA+    F  P +    +G     Q++++++HY N            + ++  P     +SG +E+ V  +PT  +  +   +   SI GH  V +   C +T       +  FA  +H H LG  +   V H +   +IG     +   F       +K    + PGD L   C   +         K+G + +DEMC  ++YY+
Sbjct:  223 CNHPNMPDSFTHCFGG--IMAGWAVGGGTFDYPPEAGFSLGAQGDPQFVMLETHYDNPAQLAGVADSSGLRFYITPELRAYDSGMLEVGVNPQPTHFIPPM-TPSFMRSIYGHERVSL-CPCGHTQARQSGEIQVFATILHAHLLGAAMQ--VRHFRQGKQIGHLGRDMGYDFNYQEARYLKELTAVLPGDELITECTYRSTSRSHTTTFKVGLSTQDEMCIAFLYYY 444          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010103.1 (pep scaffold:Pmarinus_7.0:GL481541:935:16119:1 gene:ENSPMAG00000009144.1 transcript:ENSPMAT00000010103.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.6026 bits (122), Expect = 1.697e-7
Identity = 53/223 (23.77%), Postives = 85/223 (38.12%), Query Frame = 2
Query:  332 CEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIY----LLATDGSIPGHSTVFMEAACSYT-------GKTVLHPFAYR-VHTHSLGKLVSGYVIHRKNWTEIGKKSPQV------EQMFYPVKGTVKIYPGDTLAARCIMENKGDKLVKIGNT-RKDEMCNFYIYYW 943
            C + ++      CK+   ++ +WA+    F  P +    +G     Q+L++Q HY N     + N   D SG       +  +  AG+        +   IP ++  F       T         + L   A R +HTH  G  +S    H +N T+IG     +      ++  Y  K T  + PGD +   CI    G      G     DEMC  + YY+
Sbjct:   71 CYKYSSTHPFATCKT---VMAAWAVGGETFDYPANAGFSLGLDEDPQFLLLQMHYDNAGLVSRAN---DSSGFRFYYTPELRTYEAGLLETGIFAYSQHFIPPNTARFTSYGICNTKTFYTSNANSTLQVLAVRFLHTHLAG--ISVQARHFRNGTQIGNLGRDMGYDFDFQETRYLNKLT-SVLPGDQIITECIYNTAGRNTTTAGGLGTMDEMCLSFFYYY 284          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Nematostella
Match: EDO34601 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNT2])

HSP 1 Score: 217.624 bits (553), Expect = 3.884e-67
Identity = 115/277 (41.52%), Postives = 161/277 (58.12%), Query Frame = 2
Query:  149 ILLKMPKVRPTKEDQYICHALDLKNDTLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGL--KILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSIPGHS-TVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMEN-KGDKLVKIGNTRKDEMCNFYIYYWVDREDSSQ 967
            I +KMP VRP K D Y C A+ +K+D  FI G+ P A    AHH+L+  C+ P S + +WNC +M       +C SG   +I+++W   A    LPK V+  +G+A   +YLV+Q HY +VD F K     D SG+ +         LA I L A+ G IP H     ++  C+Y+ K  +HPFA+RVH HSLG +++GY +    WT IGK  PQ  Q FYP+K  V I  GDTLAARC     K D++  IG T KDEMCNFY+ ++ +  ++++
Sbjct:    8 IEMKMPNVRPLKHDSYFCTAVPVKSDEAFIVGYEPHAEMHTAHHMLLFGCSTPASKEGFWNCGDMGVG----VCASGSPERIMYAWGRNAPKLNLPKGVAFKVGQASSVKYLVLQVHYGHVDKFVKNPKLHDSSGVTLQTTHMRPKFLAAILLQASGGEIPPHKKAAHLDMGCAYSNKATMHPFAFRVHAHSLGSVITGYRVRDGKWTLIGKGDPQRPQAFYPIKQEVDIKDGDTLAARCTYNTMKKDRITYIGATMKDEMCNFYMMFYYNPNEAAR 280          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Nematostella
Match: EDO34395 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPI1])

HSP 1 Score: 202.601 bits (514), Expect = 1.850e-61
Identity = 116/289 (40.14%), Postives = 158/289 (54.67%), Query Frame = 2
Query:  161 MPKVRPTKEDQYICHALDLKNDTLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICK--SGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSIPGHSTV-FMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKN------WTEIGKKSPQVEQMFYPVKGT-VKIYPGDTLAARCIMEN-KGDKLVKIGNTRKDEMCNFYIYYWVDREDSSQIYDDQNQIC 994
            MP V P K D Y C AL +++D  +I G++P A    AHH+L+  C+ P S +P+WNC +M       +C   SG KI+++W   A    LP+ V+  +G+A   +YLV+Q HY +VD F K     D SGI I    +   +LA I LL + GSIP    V  ++ AC Y    V+HPFA+RVH H+LG +++GY +          W  IGK  PQ  Q FYPVK    +I  GD +A RC   + K DK   IG T KDEMCNFY+ ++ D E+      D    C
Sbjct:    1 MPNVHPVKHDSYFCTALPVESDETYIVGYDPHAEMHTAHHMLLFGCSTPASNEPHWNCGDMGVG----VCGKGSGEKIMYAWGKNAPTLELPEGVAFKVGQASSVKYLVLQVHYGHVDKFVKNPDLKDSSGITIRTTHERPKQLASILLLVSGGSIPPKQKVAHLDMACKYQNPAVMHPFAFRVHAHTLGTVITGYRVQNAENANDAKWDLIGKGDPQRPQAFYPVKDKHTEIKAGDVVAGRCTFNSMKKDKTTYIGATMKDEMCNFYMMFYYDPEEEGDSKYDPESSC 285          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Nematostella
Match: EDO42139 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2F4])

HSP 1 Score: 182.956 bits (463), Expect = 4.842e-50
Identity = 105/273 (38.46%), Postives = 149/273 (54.58%), Query Frame = 2
Query:  146 EILLKMPKVRPTKEDQYICHALDLKNDTLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLL-ATDGSIPGHST-VFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKGDKL---VKIGNTRKDEMCNFYIYYWVD 949
            E+ +KMP     + D Y+C ++ +  D  +I  F  +A+   AHH+++  C  PGS K  W C  M   +    C SG +ILF+WA  A   +LPK V+  IGK     YLV+Q HY++    +    + D SG  +         +AGIYLL + D  IP  +  V ++ AC Y     ++ FAYR H H LG+++SGY +    W+ +GK  PQ  Q FYP+   V I  GDT+AARC  +++G KL   V IG T  DEMCNFY+ Y+ D
Sbjct:   24 ELSVKMPGAAAKQNDDYLCTSVPVHADEEYIVSFEAEATEEVAHHMILSGCKIPGSRKKVWGCGLMGGLE----CASGQEILFAWAKNAPPKKLPKGVAFQIGKKFNINYLVLQVHYRH----KAKVGQSDHSGFVLHTTTTRPHYIAGIYLLWSGDADIPPDTQEVHVDLACKYQDDHPIYAFAYRTHAHGLGRVISGYRVQDSKWSLLGKGDPQAPQAFYPIDHPVTISKGDTVAARCTFDSRGHKLDHHVHIGATGADEMCNFYLMYYRD 288          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Medaka
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:NCBI gene;Acc:101164528])

HSP 1 Score: 188.348 bits (477), Expect = 1.308e-51
Identity = 108/271 (39.85%), Postives = 151/271 (55.72%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDL-KNDTLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSI--PGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKG-DKLVKIGNTRKDEMCNFYIYYWVDRE 955
            L+MP V P+  D Y+C A  +  N   +I  F P AS +  HH+++  C  P S    W+C       +   CK    I+++WA  A   +LPKDV   +GK  G  Y V+Q HY +V  FR  +   D SG+ + +  KP   +AGIYLL +  ++  PG +    + AC Y    + +PFA+R HTH LGK+VSGY I    WT IG++SPQ+ Q FYPV   + +  GDT+AARC+   +G      IG T  DEMCNFY+ Y++DR 
Sbjct:   82 LRMPGVSPSNSDTYLCMAFPVPTNQDSYIVDFIPHASMNTVHHMILFGCQSPSSASSSWDC-----GGALGTCKDDPSIMYAWARNAPPTKLPKDVGFRVGKGSGMSYFVLQVHYGDVSAFR--DHHRDCSGLTLRMTSKPQPFVAGIYLLMSVDTVIPPGKTVTNADVACDYASYPI-YPFAFRTHTHRLGKVVSGYRIRNGKWTLIGRQSPQLPQAFYPVNTELSVQYGDTVAARCVFTGEGRTSETVIGGTSDDEMCNFYMMYYMDRR 344          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Medaka
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:NCBI gene;Acc:101164528])

HSP 1 Score: 187.963 bits (476), Expect = 1.471e-51
Identity = 108/271 (39.85%), Postives = 151/271 (55.72%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDL-KNDTLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSI--PGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKG-DKLVKIGNTRKDEMCNFYIYYWVDRE 955
            L+MP V P+  D Y+C A  +  N   +I  F P AS +  HH+++  C  P S    W+C       +   CK    I+++WA  A   +LPKDV   +GK  G  Y V+Q HY +V  FR  +   D SG+ + +  KP   +AGIYLL +  ++  PG +    + AC Y    + +PFA+R HTH LGK+VSGY I    WT IG++SPQ+ Q FYPV   + +  GDT+AARC+   +G      IG T  DEMCNFY+ Y++DR 
Sbjct:   53 LRMPGVSPSNSDTYLCMAFPVPTNQDSYIVDFIPHASMNTVHHMILFGCQSPSSASSSWDC-----GGALGTCKDDPSIMYAWARNAPPTKLPKDVGFRVGKGSGMSYFVLQVHYGDVSAFR--DHHRDCSGLTLRMTSKPQPFVAGIYLLMSVDTVIPPGKTVTNADVACDYASYPI-YPFAFRTHTHRLGKVVSGYRIRNGKWTLIGRQSPQLPQAFYPVNTELSVQYGDTVAARCVFTGEGRTSETVIGGTSDDEMCNFYMMYYMDRR 315          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Medaka
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:NCBI gene;Acc:101164528])

HSP 1 Score: 186.037 bits (471), Expect = 1.012e-50
Identity = 108/273 (39.56%), Postives = 152/273 (55.68%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDL-KNDTLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSI--PGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKG-DKLVKIGNTRKDEMCNFYIYYWVDREDS 961
            L+MP V P+  D Y+C A  +  N   +I  F P AS +  HH+++  C  P S    W+C       +   CK    I+++WA  A   +LPKDV   +GK  G  Y V+Q HY +V  FR  +   D SG+ + +  KP   +AGIYLL +  ++  PG +    + AC Y    + +PFA+R HTH LGK+VSGY I    WT IG++SPQ+ Q FYPV   + +  GDT+AARC+   +G      IG T  DEMCNFY+ Y++DR  +
Sbjct:   82 LRMPGVSPSNSDTYLCMAFPVPTNQDSYIVDFIPHASMNTVHHMILFGCQSPSSASSSWDC-----GGALGTCKDDPSIMYAWARNAPPTKLPKDVGFRVGKGSGMSYFVLQVHYGDVSAFR--DHHRDCSGLTLRMTSKPQPFVAGIYLLMSVDTVIPPGKTVTNADVACDYASYPI-YPFAFRTHTHRLGKVVSGYRIRNGKWTLIGRQSPQLPQAFYPVNTELSVQYGDTVAARCVFTGEGRTSETVIGGTSDDEMCNFYMMYYMDRRHA 346          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Medaka
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:NCBI gene;Acc:101164528])

HSP 1 Score: 186.037 bits (471), Expect = 1.060e-50
Identity = 108/273 (39.56%), Postives = 152/273 (55.68%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDL-KNDTLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSI--PGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKG-DKLVKIGNTRKDEMCNFYIYYWVDREDS 961
            L+MP V P+  D Y+C A  +  N   +I  F P AS +  HH+++  C  P S    W+C       +   CK    I+++WA  A   +LPKDV   +GK  G  Y V+Q HY +V  FR  +   D SG+ + +  KP   +AGIYLL +  ++  PG +    + AC Y    + +PFA+R HTH LGK+VSGY I    WT IG++SPQ+ Q FYPV   + +  GDT+AARC+   +G      IG T  DEMCNFY+ Y++DR  +
Sbjct:   53 LRMPGVSPSNSDTYLCMAFPVPTNQDSYIVDFIPHASMNTVHHMILFGCQSPSSASSSWDC-----GGALGTCKDDPSIMYAWARNAPPTKLPKDVGFRVGKGSGMSYFVLQVHYGDVSAFR--DHHRDCSGLTLRMTSKPQPFVAGIYLLMSVDTVIPPGKTVTNADVACDYASYPI-YPFAFRTHTHRLGKVVSGYRIRNGKWTLIGRQSPQLPQAFYPVNTELSVQYGDTVAARCVFTGEGRTSETVIGGTSDDEMCNFYMMYYMDRRHA 317          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Medaka
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:NCBI gene;Acc:101164528])

HSP 1 Score: 186.037 bits (471), Expect = 1.184e-50
Identity = 108/273 (39.56%), Postives = 152/273 (55.68%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDL-KNDTLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSI--PGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKG-DKLVKIGNTRKDEMCNFYIYYWVDREDS 961
            L+MP V P+  D Y+C A  +  N   +I  F P AS +  HH+++  C  P S    W+C       +   CK    I+++WA  A   +LPKDV   +GK  G  Y V+Q HY +V  FR  +   D SG+ + +  KP   +AGIYLL +  ++  PG +    + AC Y    + +PFA+R HTH LGK+VSGY I    WT IG++SPQ+ Q FYPV   + +  GDT+AARC+   +G      IG T  DEMCNFY+ Y++DR  +
Sbjct:   53 LRMPGVSPSNSDTYLCMAFPVPTNQDSYIVDFIPHASMNTVHHMILFGCQSPSSASSSWDC-----GGALGTCKDDPSIMYAWARNAPPTKLPKDVGFRVGKGSGMSYFVLQVHYGDVSAFR--DHHRDCSGLTLRMTSKPQPFVAGIYLLMSVDTVIPPGKTVTNADVACDYASYPI-YPFAFRTHTHRLGKVVSGYRIRNGKWTLIGRQSPQLPQAFYPVNTELSVQYGDTVAARCVFTGEGRTSETVIGGTSDDEMCNFYMMYYMDRRHA 317          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Planmine SMEST
Match: SMESG000073851.1 (SMESG000073851.1)

HSP 1 Score: 742.265 bits (1915), Expect = 0.000e+0
Identity = 368/368 (100.00%), Postives = 368/368 (100.00%), Query Frame = 2
Query:  143 HEILLKMPKVRPTKEDQYICHALDLKNDTLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSIPGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKGDKLVKIGNTRKDEMCNFYIYYWVDREDSSQIYDDQNQICFSAGWPKFKWDSFFDSLKIPSAAAMLPGANNIINEIVNDMEKQERNMDKLISNMWDDNPKENSDDILDDTLFDHKKFENFDELF 1246
            HEILLKMPKVRPTKEDQYICHALDLKNDTLFITGFNPKASASHAHHILIHSCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSIPGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKGDKLVKIGNTRKDEMCNFYIYYWVDREDSSQIYDDQNQICFSAGWPKFKWDSFFDSLKIPSAAAMLPGANNIINEIVNDMEKQERNMDKLISNMWDDNPKENSDDILDDTLFDHKKFENFDELF
Sbjct:   16 HEILLKMPKVRPTKEDQYICHALDLKNDTLFITGFNPKASASHAHHILIHSCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSIPGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKGDKLVKIGNTRKDEMCNFYIYYWVDREDSSQIYDDQNQICFSAGWPKFKWDSFFDSLKIPSAAAMLPGANNIINEIVNDMEKQERNMDKLISNMWDDNPKENSDDILDDTLFDHKKFENFDELF 383          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Planmine SMEST
Match: SMESG000073851.1 (SMESG000073851.1)

HSP 1 Score: 729.939 bits (1883), Expect = 0.000e+0
Identity = 362/362 (100.00%), Postives = 362/362 (100.00%), Query Frame = 2
Query:  161 MPKVRPTKEDQYICHALDLKNDTLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSIPGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKGDKLVKIGNTRKDEMCNFYIYYWVDREDSSQIYDDQNQICFSAGWPKFKWDSFFDSLKIPSAAAMLPGANNIINEIVNDMEKQERNMDKLISNMWDDNPKENSDDILDDTLFDHKKFENFDELF 1246
            MPKVRPTKEDQYICHALDLKNDTLFITGFNPKASASHAHHILIHSCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSIPGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKGDKLVKIGNTRKDEMCNFYIYYWVDREDSSQIYDDQNQICFSAGWPKFKWDSFFDSLKIPSAAAMLPGANNIINEIVNDMEKQERNMDKLISNMWDDNPKENSDDILDDTLFDHKKFENFDELF
Sbjct:    1 MPKVRPTKEDQYICHALDLKNDTLFITGFNPKASASHAHHILIHSCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGSIPGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKGDKLVKIGNTRKDEMCNFYIYYWVDREDSSQIYDDQNQICFSAGWPKFKWDSFFDSLKIPSAAAMLPGANNIINEIVNDMEKQERNMDKLISNMWDDNPKENSDDILDDTLFDHKKFENFDELF 362          
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Planmine SMEST
Match: SMESG000057300.1 (SMESG000057300.1)

HSP 1 Score: 145.591 bits (366), Expect = 3.030e-37
Identity = 97/268 (36.19%), Postives = 143/268 (53.36%), Query Frame = 2
Query:  155 LKMPKVRPTKEDQYICHALDL--KNDTLFITGFNPKXXXXXXXXXXXXXCTEPGSVKPYWNCEEMNAKDSKPICK-SGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATD-GSI-PGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWT--EIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKG-DKLVKIGNTRKDEMCNFYI 934
            L+MP V     D+YIC +  +   N+  +I  + P A++S AHH+L+  C+ P S +P + C        + IC+ S  KILF WA  A  F  P +  + +G      Y V+Q HY       KP +  D+SG+ + +  KP   + GI+LL +  G I P    V ++ +C Y G +  +  A+R H H+LG+ +SGY +   +     IGK +PQ  Q FY     V+I PGD L ARC+ ++ G D + +IG T  DEMCNFYI
Sbjct:   24 LQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPC--------RSICENSREKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHY------LKPTTIEDKSGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYK-SAQVQIKPGDILMARCLFDSTGKDSVTEIGYTHMDEMCNFYI 276          
The following BLAST results are available for this feature:
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PAM1.250e-5140.15peptidylglycine alpha-amidating monooxygenase [Sou... [more]
PAM1.527e-5140.15peptidylglycine alpha-amidating monooxygenase [Sou... [more]
PAM1.632e-5140.15peptidylglycine alpha-amidating monooxygenase [Sou... [more]
PAM1.910e-5140.15peptidylglycine alpha-amidating monooxygenase [Sou... [more]
PAM2.199e-5140.15peptidylglycine alpha-amidating monooxygenase [Sou... [more]
back to top
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pghm-17.341e-7040.32Probable peptidylglycine alpha-hydroxylating monoo... [more]
pamn-11.162e-3332.09Probable peptidyl-glycine alpha-amidating monooxyg... [more]
tbh-16.209e-1128.91Tyramine beta-hydroxylase [Source:UniProtKB/Swiss... [more]
tbh-16.762e-1128.91Tyramine beta-hydroxylase [Source:UniProtKB/Swiss... [more]
tbh-18.467e-1128.91Tyramine beta-hydroxylase [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Phm8.774e-6940.86gene:FBgn0283509 transcript:FBtr0072203[more]
Phm8.774e-6940.86gene:FBgn0283509 transcript:FBtr0072202[more]
Tbh6.624e-1024.66gene:FBgn0010329 transcript:FBtr0089999[more]
Tbh6.624e-1024.66gene:FBgn0010329 transcript:FBtr0340409[more]
olf4131.080e-625.55gene:FBgn0037153 transcript:FBtr0333219[more]
back to top
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pam8.705e-5438.52peptidylglycine alpha-amidating monooxygenase [Sou... [more]
pam9.491e-5238.52peptidylglycine alpha-amidating monooxygenase [Sou... [more]
moxd18.480e-1023.96monooxygenase, DBH-like 1 [Source:NCBI gene;Acc:57... [more]
dbh3.078e-924.10dopamine beta-hydroxylase (dopamine beta-monooxyge... [more]
dbh3.187e-924.10dopamine beta-hydroxylase (dopamine beta-monooxyge... [more]
back to top
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pam9.811e-5338.36peptidylglycine alpha-amidating monooxygenase [Sou... [more]
pam1.310e-5238.36peptidylglycine alpha-amidating monooxygenase [Sou... [more]
pam1.378e-5238.36peptidylglycine alpha-amidating monooxygenase [Sou... [more]
pam2.657e-4937.46peptidylglycine alpha-amidating monooxygenase [Sou... [more]
pam1.062e-4737.46peptidylglycine alpha-amidating monooxygenase [Sou... [more]
back to top
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pam2.238e-5239.41peptidylglycine alpha-amidating monooxygenase [Sou... [more]
Pam2.628e-5239.41peptidylglycine alpha-amidating monooxygenase [Sou... [more]
Pam3.115e-5239.41peptidylglycine alpha-amidating monooxygenase [Sou... [more]
Dbh2.699e-1126.34dopamine beta hydroxylase [Source:MGI Symbol;Acc:M... [more]
Moxd18.070e-822.54monooxygenase, DBH-like 1 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q95XM2|PHM_CAEEL9.338e-6940.32Probable peptidylglycine alpha-hydroxylating monoo... [more]
sp|O01404|PHM_DROME8.795e-6840.86Peptidylglycine alpha-hydroxylating monooxygenase ... [more]
sp|P08478|AMDA_XENLA3.629e-5238.01Peptidyl-glycine alpha-amidating monooxygenase A O... [more]
sp|P10731|AMD_BOVIN5.056e-5239.78Peptidyl-glycine alpha-amidating monooxygenase OS=... [more]
sp|P97467|AMD_MOUSE1.838e-5139.41Peptidyl-glycine alpha-amidating monooxygenase OS=... [more]
back to top
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q4W7B50.000e+073.51Peptidylglycine a-hydroxylating monooxygenase OS=D... [more]
A0A1I8JKY86.775e-8541.86Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8H4G91.294e-8441.81Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GEQ73.018e-8441.57Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A0B7AQ081.460e-8041.44Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
back to top
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pam1.247e-5138.83peptidylglycine alpha-amidating monooxygenase [Sou... [more]
pam1.359e-5138.83peptidylglycine alpha-amidating monooxygenase [Sou... [more]
pam1.837e-5138.83peptidylglycine alpha-amidating monooxygenase [Sou... [more]
moxd12.506e-1024.12monooxygenase DBH like 1 [Source:NCBI gene;Acc:103... [more]
dbh2.212e-725.25dopamine beta-hydroxylase (dopamine beta-monooxyge... [more]
back to top
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
moxd1l7.496e-924.12monooxygenase, DBH-like 1, like [Source:NCBI gene;... [more]
ENSPMAT00000010103.11.697e-723.77pep scaffold:Pmarinus_7.0:GL481541:935:16119:1 gen... [more]
back to top
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO346013.884e-6741.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343951.850e-6140.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421394.842e-5038.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pam1.308e-5139.85peptidylglycine alpha-amidating monooxygenase [Sou... [more]
pam1.471e-5139.85peptidylglycine alpha-amidating monooxygenase [Sou... [more]
pam1.012e-5039.56peptidylglycine alpha-amidating monooxygenase [Sou... [more]
pam1.060e-5039.56peptidylglycine alpha-amidating monooxygenase [Sou... [more]
pam1.184e-5039.56peptidylglycine alpha-amidating monooxygenase [Sou... [more]
back to top
BLAST of Peptidylglycine alpha-hydroxylating monooxygenase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000073851.10.000e+0100.00SMESG000073851.1[more]
SMESG000073851.10.000e+0100.00SMESG000073851.1[more]
SMESG000057300.13.030e-3736.19SMESG000057300.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032314 ID=SMED30032314|Name=Peptidylglycine alpha-hydroxylating monooxygenase|organism=Schmidtea mediterranea sexual|type=transcript|length=1411bp
ATAAGGAAAAAATTCAGCGAATAGAATTTGAATATTATTTATGAATTAGT
ATTTGAAGTGTGTTTGGGAATTTCTAATCATTAGTTTACTGTTGATAATG
ATTTTTCTGTGTCTCTATTTATTGTTTCTTTCAATAGAATCCCATGAAAT
ATTATTGAAAATGCCTAAAGTGAGGCCGACCAAAGAGGATCAATATATCT
GTCACGCTTTAGACTTAAAAAATGACACTTTGTTCATCACTGGTTTTAAC
CCAAAAGCTAGTGCATCACATGCACATCATATCTTAATCCACAGCTGTAC
GGAACCTGGATCTGTAAAACCATATTGGAACTGTGAAGAGATGAATGCAA
AGGATTCAAAACCGATCTGTAAATCTGGATTGAAAATACTTTTTTCTTGG
GCAATGGCTGCATCAGGATTTCGACTTCCAAAAGACGTTTCAGTTATGAT
TGGAAAAGCTGTCGGAAAACAATATTTGGTTATTCAAAGTCACTATAAAA
ATGTTGATTATTTTCGAAAACCAAATTCTGAACCGGATGAATCAGGTATA
GAAATAACTGTACAAAGGAAACCAACAAGCAAGTTAGCTGGTATCTATTT
ATTAGCCACAGATGGCTCAATTCCTGGTCATTCTACAGTATTCATGGAGG
CTGCGTGTTCGTATACTGGTAAAACAGTTTTGCATCCATTTGCATACAGA
GTACATACTCACAGTTTAGGAAAGTTAGTATCGGGCTATGTCATACACAG
AAAAAATTGGACAGAAATTGGAAAGAAATCTCCACAAGTCGAACAAATGT
TTTATCCAGTTAAAGGAACTGTGAAAATATATCCAGGAGACACTTTGGCT
GCAAGATGTATTATGGAAAACAAGGGAGATAAGCTAGTCAAAATCGGAAA
TACTAGAAAAGATGAAATGTGTAATTTCTATATTTACTACTGGGTTGATC
GAGAAGATAGTTCACAAATTTACGATGATCAAAATCAAATTTGTTTTTCT
GCTGGATGGCCAAAATTCAAATGGGATTCTTTCTTTGATTCCTTAAAAAT
TCCATCAGCTGCTGCAATGTTGCCTGGTGCAAACAACATAATAAATGAAA
TAGTAAATGACATGGAAAAACAAGAAAGAAACATGGATAAACTAATATCA
AACATGTGGGACGATAATCCAAAAGAAAATTCAGATGATATTTTGGACGA
TACTTTATTTGATCACAAAAAGTTTGAGAATTTCGATGAATTGTTTTAAA
CAAAATCCGTCATATTTTGTGAGTTGGTGAATCATTTGTCCTGGTGTCGT
ATAGGATTTATTTACTAGTTGTTGGTGACTTGGTAAATCTCATTGTCAAT
AAAATTTTTAGTTATTTACAAGATTTATTTTTAACACTAATTGAAATCTT
TAATAAGTGAC
back to top

protein sequence of SMED30032314-orf-1

>SMED30032314-orf-1 ID=SMED30032314-orf-1|Name=SMED30032314-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=384bp
MIFLCLYLLFLSIESHEILLKMPKVRPTKEDQYICHALDLKNDTLFITGF
NPKASASHAHHILIHSCTEPGSVKPYWNCEEMNAKDSKPICKSGLKILFS
WAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESG
IEITVQRKPTSKLAGIYLLATDGSIPGHSTVFMEAACSYTGKTVLHPFAY
RVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVKGTVKIYPGDTL
AARCIMENKGDKLVKIGNTRKDEMCNFYIYYWVDREDSSQIYDDQNQICF
SAGWPKFKWDSFFDSLKIPSAAAMLPGANNIINEIVNDMEKQERNMDKLI
SNMWDDNPKENSDDILDDTLFDHKKFENFDELF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000419prepharyngeal region
PLANA:0000463cholinergic neuron
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036939Cu2_ascorb_mOase_N_sf
IPR000720PHM/PAL
IPR014784Cu2_ascorb_mOase-like_C
IPR000323Cu2_ascorb_mOase_N
IPR024548Cu2_monoox_C
IPR014783Cu2_ascorb_mOase_CS-2
IPR008977PHM/PNGase_F_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006518peptide metabolic process
GO:0055114oxidation-reduction process
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0016715oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced ascorbate as one donor, and incorporation of one atom of oxygen
GO:0005507copper ion binding
GO:0004497monooxygenase activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 332..352
NoneNo IPR availablePANTHERPTHR10680:SF27PEPTIDYLGLYCINE ALPHA-HYDROXYLATING MONOOXYGENASEcoord: 14..312
NoneNo IPR availablePANTHERPTHR10680PEPTIDYL-GLYCINE ALPHA-AMIDATING MONOOXYGENASEcoord: 14..312
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..15
score: 0.742
IPR000720Peptidylglycine alpha-hydroxylating monooxygenase/peptidyl-hydroxyglycine alpha-amidating lyasePRINTSPR00790PAMONOXGNASEcoord: 266..285
score: 57.14
coord: 221..240
score: 58.57
coord: 49..70
score: 40.26
IPR036939Copper type II, ascorbate-dependent monooxygenase, N-terminal domain superfamilyGENE3DG3DSA:2.60.120.310coord: 8..164
e-value: 1.7E-39
score: 137.0
IPR024548Copper type II ascorbate-dependent monooxygenase, C-terminalPFAMPF03712Cu2_monoox_Ccoord: 163..311
e-value: 3.5E-38
score: 130.6
IPR000323Copper type II, ascorbate-dependent monooxygenase, N-terminalPFAMPF01082Cu2_monooxygencoord: 20..138
e-value: 4.5E-21
score: 75.5
IPR014784Copper type II, ascorbate-dependent monooxygenase-like, C-terminalGENE3DG3DSA:2.60.120.230coord: 165..310
e-value: 6.4E-46
score: 157.3
IPR014783Copper type II, ascorbate-dependent monooxygenase, histidine-cluster-2 conserved sitePROSITEPS00085CU2_MONOOXYGENASE_2coord: 196..208
IPR008977PHM/PNGase F domain superfamilySUPERFAMILYSSF49742PHM/PNGase Fcoord: 162..291
IPR008977PHM/PNGase F domain superfamilySUPERFAMILYSSF49742PHM/PNGase Fcoord: 14..158