ETS variant 4

Overview
NameETS variant 4
Smed IDSMED30032308
Length (bp)1337
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ETS variant 4 (SMED30032308) t-SNE clustered cells

Violin plots show distribution of expression levels for ETS variant 4 (SMED30032308) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ETS variant 4 (SMED30032308) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ETS variant 4 (SMED30032308) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032308

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30032308h1SMcG0014537 dd_Smed_v4_20282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032308h1SMcG0014537 dd_Smed_v4_20282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30032308h1SMcG0014537 dd_Smed_v4_20282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ETS variant 4 vs. Ensembl Human
Match: ETV4 (ETS variant transcription factor 4 [Source:HGNC Symbol;Acc:HGNC:3493])

HSP 1 Score: 131.724 bits (330), Expect = 2.338e-35
Identity = 71/112 (63.39%), Postives = 81/112 (72.32%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNLIHP 961
            RG  QLWQFL++LL D  ++  I WTGR  EFKLIEPEEVARLWG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ +  ++ P+N    L      P
Sbjct:   61 RGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CEPEALFSLAFPDNQRPALKAEFDRP 170          
BLAST of ETS variant 4 vs. Ensembl Human
Match: ETV4 (ETS variant transcription factor 4 [Source:HGNC Symbol;Acc:HGNC:3493])

HSP 1 Score: 132.109 bits (331), Expect = 1.566e-33
Identity = 71/112 (63.39%), Postives = 81/112 (72.32%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNLIHP 961
            RG  QLWQFL++LL D  ++  I WTGR  EFKLIEPEEVARLWG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ +  ++ P+N    L      P
Sbjct:  284 RGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CEPEALFSLAFPDNQRPALKAEFDRP 393          
BLAST of ETS variant 4 vs. Ensembl Human
Match: ETV4 (ETS variant transcription factor 4 [Source:HGNC Symbol;Acc:HGNC:3493])

HSP 1 Score: 132.494 bits (332), Expect = 1.599e-33
Identity = 71/112 (63.39%), Postives = 81/112 (72.32%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNLIHP 961
            RG  QLWQFL++LL D  ++  I WTGR  EFKLIEPEEVARLWG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ +  ++ P+N    L      P
Sbjct:  299 RGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CEPEALFSLAFPDNQRPALKAEFDRP 408          
BLAST of ETS variant 4 vs. Ensembl Human
Match: ETV4 (ETS variant transcription factor 4 [Source:HGNC Symbol;Acc:HGNC:3493])

HSP 1 Score: 132.494 bits (332), Expect = 1.599e-33
Identity = 71/112 (63.39%), Postives = 81/112 (72.32%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNLIHP 961
            RG  QLWQFL++LL D  ++  I WTGR  EFKLIEPEEVARLWG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ +  ++ P+N    L      P
Sbjct:  299 RGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CEPEALFSLAFPDNQRPALKAEFDRP 408          
BLAST of ETS variant 4 vs. Ensembl Human
Match: ETV4 (ETS variant transcription factor 4 [Source:HGNC Symbol;Acc:HGNC:3493])

HSP 1 Score: 132.494 bits (332), Expect = 2.725e-33
Identity = 71/112 (63.39%), Postives = 81/112 (72.32%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNLIHP 961
            RG  QLWQFL++LL D  ++  I WTGR  EFKLIEPEEVARLWG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ +  ++ P+N    L      P
Sbjct:  338 RGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CEPEALFSLAFPDNQRPALKAEFDRP 447          
BLAST of ETS variant 4 vs. Ensembl Celegans
Match: ast-1 (Axon STeering defect [Source:UniProtKB/TrEMBL;Acc:Q22355])

HSP 1 Score: 114.39 bits (285), Expect = 6.805e-28
Identity = 66/128 (51.56%), Postives = 83/128 (64.84%), Query Frame = 2
Query:  611 SKGLAERGN--PQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNI---LVSSPNNSGMDLSMNLIHPDMINYT 979
            SK LA  G+   QLWQFLL LL D R+S VI W G   EFKL++P+EVAR WG +K++P MNYDK+SR+LRYYYDKNIM KV G+RY YKF    +   +     S P +     +M  I PD  ++T
Sbjct:  203 SKNLAHSGSGQTQLWQFLLELLSDKRYSEVITWEGTQGEFKLVDPDEVARKWGERKSKPNMNYDKMSRALRYYYDKNIMAKVHGKRYAYKFDFQGIAQALQPPTASHPQDYFNSHAMGRIAPDFSSWT 330          
BLAST of ETS variant 4 vs. Ensembl Celegans
Match: ets-5 (ETS domain-containing transcription factor ets-5 [Source:UniProtKB/Swiss-Prot;Acc:Q18579])

HSP 1 Score: 109.768 bits (273), Expect = 1.080e-27
Identity = 53/82 (64.63%), Postives = 65/82 (79.27%), Query Frame = 2
Query:  632 GNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKF 877
            G  QLWQFLL LL D+ ++  I W G + EFKL++P+EVAR WG +K++P MNYDKLSR+LRYYYDKNIM KV G+RY YKF
Sbjct:   33 GQIQLWQFLLELLADAVNAHCIAWEGSNGEFKLVDPDEVARKWGERKSKPNMNYDKLSRALRYYYDKNIMTKVQGKRYAYKF 114          
BLAST of ETS variant 4 vs. Ensembl Celegans
Match: ets-5 (ETS domain-containing transcription factor ets-5 [Source:UniProtKB/Swiss-Prot;Acc:Q18579])

HSP 1 Score: 109.768 bits (273), Expect = 2.364e-27
Identity = 53/82 (64.63%), Postives = 65/82 (79.27%), Query Frame = 2
Query:  632 GNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKF 877
            G  QLWQFLL LL D+ ++  I W G + EFKL++P+EVAR WG +K++P MNYDKLSR+LRYYYDKNIM KV G+RY YKF
Sbjct:   71 GQIQLWQFLLELLADAVNAHCIAWEGSNGEFKLVDPDEVARKWGERKSKPNMNYDKLSRALRYYYDKNIMTKVQGKRYAYKF 152          
BLAST of ETS variant 4 vs. Ensembl Celegans
Match: lin-1 (LIN-1 [Source:UniProtKB/TrEMBL;Acc:G5EDL0])

HSP 1 Score: 97.0561 bits (240), Expect = 1.003e-21
Identity = 54/100 (54.00%), Postives = 69/100 (69.00%), Query Frame = 2
Query:  644 LWQFXXXXXXXXXXXXVICWT-GRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKF--TDNCLPDNILVSSPNNSGM 934
            LWQFLL LL   ++  +I WT G D EF+LI+ E VAR WG +K +P MNYDKLSR+LRYYY+KNI++KV G+++VY+F  TD   P     SS  N  M
Sbjct:   26 LWQFLLELLQQDQNGDIIEWTRGTDGEFRLIDAEAVARKWGQRKAKPHMNYDKLSRALRYYYEKNIIKKVIGKKFVYRFVTTDAHAPPTADFSSNMNMKM 125          
BLAST of ETS variant 4 vs. Ensembl Celegans
Match: lin-1 (LIN-1 [Source:UniProtKB/TrEMBL;Acc:G5EDL0])

HSP 1 Score: 97.0561 bits (240), Expect = 1.003e-21
Identity = 54/100 (54.00%), Postives = 69/100 (69.00%), Query Frame = 2
Query:  644 LWQFXXXXXXXXXXXXVICWT-GRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKF--TDNCLPDNILVSSPNNSGM 934
            LWQFLL LL   ++  +I WT G D EF+LI+ E VAR WG +K +P MNYDKLSR+LRYYY+KNI++KV G+++VY+F  TD   P     SS  N  M
Sbjct:   26 LWQFLLELLQQDQNGDIIEWTRGTDGEFRLIDAEAVARKWGQRKAKPHMNYDKLSRALRYYYEKNIIKKVIGKKFVYRFVTTDAHAPPTADFSSNMNMKM 125          
BLAST of ETS variant 4 vs. Ensembl Fly
Match: Ets96B (gene:FBgn0039225 transcript:FBtr0339254)

HSP 1 Score: 129.798 bits (325), Expect = 3.276e-32
Identity = 66/104 (63.46%), Postives = 81/104 (77.88%), Query Frame = 2
Query:  602 NNNSKGLAER-GNPQLWQFXXXXXXX-XXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL 907
            ++N + +++R G+ QLWQFL++LL + +  +  I WTGR  EFKLIEPEEVAR WG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVY+F   C PD + 
Sbjct:  476 SSNGQAISQRRGSLQLWQFLVALLDEPTTSASCIAWTGRGMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYYYEKGIMQKVNGERYVYRFV--CDPDALF 577          
BLAST of ETS variant 4 vs. Ensembl Fly
Match: Ets96B (gene:FBgn0039225 transcript:FBtr0084697)

HSP 1 Score: 129.798 bits (325), Expect = 4.210e-32
Identity = 66/104 (63.46%), Postives = 81/104 (77.88%), Query Frame = 2
Query:  602 NNNSKGLAER-GNPQLWQFXXXXXXX-XXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL 907
            ++N + +++R G+ QLWQFL++LL + +  +  I WTGR  EFKLIEPEEVAR WG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVY+F   C PD + 
Sbjct:  485 SSNGQAISQRRGSLQLWQFLVALLDEPTTSASCIAWTGRGMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYYYEKGIMQKVNGERYVYRFV--CDPDALF 586          
BLAST of ETS variant 4 vs. Ensembl Fly
Match: Ets65A (gene:FBgn0005658 transcript:FBtr0077055)

HSP 1 Score: 107.842 bits (268), Expect = 2.206e-26
Identity = 54/82 (65.85%), Postives = 64/82 (78.05%), Query Frame = 2
Query:  632 GNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKF 877
            G  QLWQFLL LL DS ++  I W G + EFKL +P+EVAR WG +K++P MNYDKLSR+LRYYYDKNIM KV G+RY YKF
Sbjct:   82 GQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 163          
BLAST of ETS variant 4 vs. Ensembl Fly
Match: Ets21C (gene:FBgn0005660 transcript:FBtr0112854)

HSP 1 Score: 107.842 bits (268), Expect = 5.289e-26
Identity = 55/87 (63.22%), Postives = 66/87 (75.86%), Query Frame = 2
Query:  632 GNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCL 892
            G  QLWQFLL LL DS ++  I W G+  EF+LI+P+EVAR WG +K +P MNYDKLSR+LRYYYDKNIM KV G+RY YKF  + L
Sbjct:   83 GQIQLWQFLLELLADSSNANAISWEGQSGEFRLIDPDEVARRWGERKAKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGL 169          
BLAST of ETS variant 4 vs. Ensembl Fly
Match: Ets65A (gene:FBgn0005658 transcript:FBtr0077054)

HSP 1 Score: 108.997 bits (271), Expect = 2.098e-25
Identity = 54/82 (65.85%), Postives = 64/82 (78.05%), Query Frame = 2
Query:  632 GNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKF 877
            G  QLWQFLL LL DS ++  I W G + EFKL +P+EVAR WG +K++P MNYDKLSR+LRYYYDKNIM KV G+RY YKF
Sbjct:  315 GQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 396          
BLAST of ETS variant 4 vs. Ensembl Zebrafish
Match: etv5b (ETS variant transcription factor 5b [Source:ZFIN;Acc:ZDB-GENE-991228-4])

HSP 1 Score: 132.88 bits (333), Expect = 1.278e-33
Identity = 70/104 (67.31%), Postives = 81/104 (77.88%), Query Frame = 2
Query:  617 GLAERGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNN 925
            G+ E+G+ QLWQFL++LL D  +   I WTGR  EFKLIEPEEVAR WG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C PD +  ++ P+N
Sbjct:  326 GMTEKGSLQLWQFLVTLLDDPSNGHFITWTGRGLEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CDPDALFSMAFPDN 427          
BLAST of ETS variant 4 vs. Ensembl Zebrafish
Match: etv4 (ETS variant transcription factor 4 [Source:NCBI gene;Acc:30700])

HSP 1 Score: 132.88 bits (333), Expect = 1.330e-33
Identity = 70/109 (64.22%), Postives = 82/109 (75.23%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNL 952
            RG+ QLWQFL++LL D  ++  I WTGR  EFKLIEPEEVARLWG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ ++ ++ P+N    L    
Sbjct:  347 RGSLQLWQFLVALLDDPSNAHFIAWTGRGMEFKLIEPEEVARLWGMQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CEPEALISLAFPDNQRPSLKAEF 453          
BLAST of ETS variant 4 vs. Ensembl Zebrafish
Match: etv4 (ETS variant transcription factor 4 [Source:NCBI gene;Acc:30700])

HSP 1 Score: 132.88 bits (333), Expect = 1.330e-33
Identity = 70/109 (64.22%), Postives = 82/109 (75.23%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNL 952
            RG+ QLWQFL++LL D  ++  I WTGR  EFKLIEPEEVARLWG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ ++ ++ P+N    L    
Sbjct:  347 RGSLQLWQFLVALLDDPSNAHFIAWTGRGMEFKLIEPEEVARLWGMQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CEPEALISLAFPDNQRPSLKAEF 453          
BLAST of ETS variant 4 vs. Ensembl Zebrafish
Match: etv1 (ETS variant transcription factor 1 [Source:ZFIN;Acc:ZDB-GENE-070104-1])

HSP 1 Score: 130.183 bits (326), Expect = 9.719e-33
Identity = 76/134 (56.72%), Postives = 92/134 (68.66%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNLIHPDMINYTICYPIQNSNEFHSSVQ 1027
            RG+ QLWQFL++LL D  +S  I WTGR  EFKLIEPEEVAR WG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ +  ++ P+N    L  +L     IN     P+ + +E  + +Q
Sbjct:  331 RGSLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CDPEALFSMAFPDNQRPVLKTDLER--QINEEDTVPLSHFDENMAYIQ 460          
BLAST of ETS variant 4 vs. Ensembl Zebrafish
Match: etv1 (ETS variant transcription factor 1 [Source:ZFIN;Acc:ZDB-GENE-070104-1])

HSP 1 Score: 130.183 bits (326), Expect = 9.719e-33
Identity = 76/134 (56.72%), Postives = 92/134 (68.66%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNLIHPDMINYTICYPIQNSNEFHSSVQ 1027
            RG+ QLWQFL++LL D  +S  I WTGR  EFKLIEPEEVAR WG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ +  ++ P+N    L  +L     IN     P+ + +E  + +Q
Sbjct:  331 RGSLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CDPEALFSMAFPDNQRPVLKTDLER--QINEEDTVPLSHFDENMAYIQ 460          
BLAST of ETS variant 4 vs. Ensembl Xenopus
Match: ENSXETT00000029479.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:10:23638928:23650532:1 gene:ENSXETG00000004517.1 transcript:ENSXETT00000029479.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.494 bits (332), Expect = 4.192e-35
Identity = 69/100 (69.00%), Postives = 79/100 (79.00%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNILVSSPNNS 928
            RG+ QLWQFL++LL +  +S  I WTGR  EFKLIEPEEVARLWG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ +   + N+S
Sbjct:  137 RGSLQLWQFLVALLDNPTNSHFIAWTGRGMEFKLIEPEEVARLWGMQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CDPEALFSLAFNDS 234          
BLAST of ETS variant 4 vs. Ensembl Xenopus
Match: ENSXETT00000029485.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:10:23638928:23650532:1 gene:ENSXETG00000004517.1 transcript:ENSXETT00000029485.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.109 bits (331), Expect = 9.684e-35
Identity = 69/100 (69.00%), Postives = 79/100 (79.00%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNILVSSPNNS 928
            RG+ QLWQFL++LL +  +S  I WTGR  EFKLIEPEEVARLWG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ +   + N+S
Sbjct:  168 RGSLQLWQFLVALLDNPTNSHFIAWTGRGMEFKLIEPEEVARLWGMQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CDPEALFSLAFNDS 265          
BLAST of ETS variant 4 vs. Ensembl Xenopus
Match: etv1 (ETS variant transcription factor 1 [Source:NCBI gene;Acc:394827])

HSP 1 Score: 127.872 bits (320), Expect = 5.230e-32
Identity = 70/109 (64.22%), Postives = 82/109 (75.23%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNL 952
            RG+ QLWQFL++LL D  +S  I WTGR  EFKLIEPEEVAR WG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ +  ++ P+N    L  ++
Sbjct:  292 RGSLQLWQFLVALLDDPANSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CDPEALFSMAFPDNQRPLLKTDI 398          
BLAST of ETS variant 4 vs. Ensembl Xenopus
Match: etv1 (ETS variant transcription factor 1 [Source:NCBI gene;Acc:394827])

HSP 1 Score: 127.872 bits (320), Expect = 6.860e-32
Identity = 70/109 (64.22%), Postives = 82/109 (75.23%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNL 952
            RG+ QLWQFL++LL D  +S  I WTGR  EFKLIEPEEVAR WG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ +  ++ P+N    L  ++
Sbjct:  314 RGSLQLWQFLVALLDDPANSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CDPEALFSMAFPDNQRPLLKTDI 420          
BLAST of ETS variant 4 vs. Ensembl Xenopus
Match: etv1 (ETS variant transcription factor 1 [Source:NCBI gene;Acc:394827])

HSP 1 Score: 128.257 bits (321), Expect = 7.104e-32
Identity = 70/109 (64.22%), Postives = 82/109 (75.23%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNL 952
            RG+ QLWQFL++LL D  +S  I WTGR  EFKLIEPEEVAR WG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ +  ++ P+N    L  ++
Sbjct:  324 RGSLQLWQFLVALLDDPANSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CDPEALFSMAFPDNQRPLLKTDI 430          
BLAST of ETS variant 4 vs. Ensembl Mouse
Match: Etv4 (ets variant 4 [Source:MGI Symbol;Acc:MGI:99423])

HSP 1 Score: 132.494 bits (332), Expect = 1.599e-33
Identity = 71/112 (63.39%), Postives = 81/112 (72.32%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNLIHP 961
            RG  QLWQFL++LL D  ++  I WTGR  EFKLIEPEEVARLWG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ +  ++ P+N    L      P
Sbjct:  334 RGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CEPEALFSLAFPDNQRPALKAEFDRP 443          
BLAST of ETS variant 4 vs. Ensembl Mouse
Match: Etv4 (ets variant 4 [Source:MGI Symbol;Acc:MGI:99423])

HSP 1 Score: 132.494 bits (332), Expect = 1.789e-33
Identity = 71/112 (63.39%), Postives = 81/112 (72.32%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNLIHP 961
            RG  QLWQFL++LL D  ++  I WTGR  EFKLIEPEEVARLWG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ +  ++ P+N    L      P
Sbjct:  340 RGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CEPEALFSLAFPDNQRPALKAEFDRP 449          
BLAST of ETS variant 4 vs. Ensembl Mouse
Match: Etv4 (ets variant 4 [Source:MGI Symbol;Acc:MGI:99423])

HSP 1 Score: 132.494 bits (332), Expect = 1.803e-33
Identity = 71/112 (63.39%), Postives = 81/112 (72.32%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNLIHP 961
            RG  QLWQFL++LL D  ++  I WTGR  EFKLIEPEEVARLWG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ +  ++ P+N    L      P
Sbjct:  339 RGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CEPEALFSLAFPDNQRPALKAEFDRP 448          
BLAST of ETS variant 4 vs. Ensembl Mouse
Match: Etv1 (ets variant 1 [Source:MGI Symbol;Acc:MGI:99254])

HSP 1 Score: 127.872 bits (320), Expect = 1.856e-32
Identity = 70/109 (64.22%), Postives = 82/109 (75.23%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNL 952
            RG+ QLWQFL++LL D  +S  I WTGR  EFKLIEPEEVAR WG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ +  ++ P+N    L  ++
Sbjct:  229 RGSLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CDPEALFSMAFPDNQRPLLKTDM 335          
BLAST of ETS variant 4 vs. Ensembl Mouse
Match: Etv5 (ets variant 5 [Source:MGI Symbol;Acc:MGI:1096867])

HSP 1 Score: 130.183 bits (326), Expect = 2.018e-32
Identity = 69/100 (69.00%), Postives = 79/100 (79.00%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNN 925
            RG+ QLWQFL++LL D  ++  I WTGR  EFKLIEPEEVAR WG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C PD +  ++ P+N
Sbjct:  383 RGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CDPDALFSMAFPDN 480          
BLAST of ETS variant 4 vs. UniProt/SwissProt
Match: sp|P28322|ETV4_MOUSE (ETS translocation variant 4 OS=Mus musculus OX=10090 GN=Etv4 PE=2 SV=2)

HSP 1 Score: 132.494 bits (332), Expect = 1.261e-32
Identity = 71/112 (63.39%), Postives = 81/112 (72.32%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNLIHP 961
            RG  QLWQFL++LL D  ++  I WTGR  EFKLIEPEEVARLWG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ +  ++ P+N    L      P
Sbjct:  339 RGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CEPEALFSLAFPDNQRPALKAEFDRP 448          
BLAST of ETS variant 4 vs. UniProt/SwissProt
Match: sp|P43268|ETV4_HUMAN (ETS translocation variant 4 OS=Homo sapiens OX=9606 GN=ETV4 PE=1 SV=3)

HSP 1 Score: 132.494 bits (332), Expect = 1.309e-32
Identity = 71/112 (63.39%), Postives = 81/112 (72.32%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNLIHP 961
            RG  QLWQFL++LL D  ++  I WTGR  EFKLIEPEEVARLWG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ +  ++ P+N    L      P
Sbjct:  338 RGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CEPEALFSLAFPDNQRPALKAEFDRP 447          
BLAST of ETS variant 4 vs. UniProt/SwissProt
Match: sp|Q9PUQ1|ETV4_DANRE (ETS translocation variant 4 OS=Danio rerio OX=7955 GN=etv4 PE=1 SV=2)

HSP 1 Score: 131.339 bits (329), Expect = 3.564e-32
Identity = 69/109 (63.30%), Postives = 82/109 (75.23%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNL 952
            RG+ QLWQFL++LL D  ++  I WTGR  EFKLIEPEEVARLWG +KNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ ++ ++ P+N    L    
Sbjct:  347 RGSLQLWQFLVALLDDPSNAHFIAWTGRGMEFKLIEPEEVARLWGIEKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CEPEALITLAFPDNQRPSLKAEF 453          
BLAST of ETS variant 4 vs. UniProt/SwissProt
Match: sp|Q9CXC9|ETV5_MOUSE (ETS translocation variant 5 OS=Mus musculus OX=10090 GN=Etv5 PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 1.438e-31
Identity = 69/100 (69.00%), Postives = 79/100 (79.00%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNN 925
            RG+ QLWQFL++LL D  ++  I WTGR  EFKLIEPEEVAR WG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C PD +  ++ P+N
Sbjct:  365 RGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CDPDALFSMAFPDN 462          
BLAST of ETS variant 4 vs. UniProt/SwissProt
Match: sp|P41161|ETV5_HUMAN (ETS translocation variant 5 OS=Homo sapiens OX=9606 GN=ETV5 PE=1 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 1.601e-31
Identity = 69/100 (69.00%), Postives = 79/100 (79.00%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNN 925
            RG+ QLWQFL++LL D  ++  I WTGR  EFKLIEPEEVAR WG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C PD +  ++ P+N
Sbjct:  365 RGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CDPDALFSMAFPDN 462          
BLAST of ETS variant 4 vs. TrEMBL
Match: M1ELA5 (Ets variant 4 (Fragment) OS=Mustela putorius furo OX=9669 PE=2 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 8.253e-33
Identity = 71/112 (63.39%), Postives = 81/112 (72.32%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNLIHP 961
            RG  QLWQFL++LL D  ++  I WTGR  EFKLIEPEEVARLWG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ +  ++ P+N    L      P
Sbjct:   10 RGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CEPEALFSLAFPDNQRPALKAEFDRP 119          
BLAST of ETS variant 4 vs. TrEMBL
Match: R7TDT0 (ETS domain-containing protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_46009 PE=3 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 1.073e-32
Identity = 70/100 (70.00%), Postives = 78/100 (78.00%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNILVSS-PNN 925
            RG+ QLWQFL++LL D  +S  I WTGR  EFKLIEPEEVAR WG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C PD +   + P+N
Sbjct:    6 RGSLQLWQFLVALLDDPCNSSFIAWTGRGLEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CDPDALFTMAFPDN 103          
BLAST of ETS variant 4 vs. TrEMBL
Match: A0A0P7W6W4 (ETS domain-containing protein OS=Scleropages formosus OX=113540 GN=Z043_123746 PE=3 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.176e-32
Identity = 69/100 (69.00%), Postives = 81/100 (81.00%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNN 925
            RG+ QLWQFL++LL D  ++  I WTGR  EFKLIEPEEVARLWG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ ++ ++ P+N
Sbjct:   67 RGSLQLWQFLVALLDDPGNAHFIAWTGRGMEFKLIEPEEVARLWGMQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CEPEALISLAFPDN 164          
BLAST of ETS variant 4 vs. TrEMBL
Match: A0A402EAU5 (ETS domain-containing protein (Fragment) OS=Paroedura picta OX=143630 GN=parPi_0027853 PE=3 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 2.287e-32
Identity = 70/100 (70.00%), Postives = 80/100 (80.00%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNN 925
            RG+ QLWQFL++LL D  +S  I WTGR  EFKLIEPEEVARLWG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ +  ++ P+N
Sbjct:   24 RGSLQLWQFLVALLDDPSNSHFISWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CEPEALFSLAFPDN 121          
BLAST of ETS variant 4 vs. TrEMBL
Match: A0A5N4D3C5 (ETS translocation variant 4 OS=Camelus dromedarius OX=9838 GN=Cadr_000019545 PE=4 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 2.733e-32
Identity = 71/112 (63.39%), Postives = 81/112 (72.32%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNLIHP 961
            RG  QLWQFL++LL D  ++  I WTGR  EFKLIEPEEVARLWG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ +  ++ P+N    L      P
Sbjct:   61 RGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CEPEALFSLAFPDNQRPALKAEFDRP 170          
BLAST of ETS variant 4 vs. Ensembl Cavefish
Match: etv4 (ETS variant transcription factor 4 [Source:NCBI gene;Acc:103042838])

HSP 1 Score: 132.109 bits (331), Expect = 2.291e-33
Identity = 70/109 (64.22%), Postives = 82/109 (75.23%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNL 952
            RG+ QLWQFL++LL D  ++  I WTGR  EFKLIEPEEVARLWG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ ++ ++ P+N    L    
Sbjct:  355 RGSLQLWQFLVALLDDPGNAHFIAWTGRGMEFKLIEPEEVARLWGMQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CEPEALISLAFPDNQRPSLKAEF 461          
BLAST of ETS variant 4 vs. Ensembl Cavefish
Match: etv4 (ETS variant transcription factor 4 [Source:NCBI gene;Acc:103042838])

HSP 1 Score: 132.109 bits (331), Expect = 2.774e-33
Identity = 70/109 (64.22%), Postives = 82/109 (75.23%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNL 952
            RG+ QLWQFL++LL D  ++  I WTGR  EFKLIEPEEVARLWG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ ++ ++ P+N    L    
Sbjct:  373 RGSLQLWQFLVALLDDPGNAHFIAWTGRGMEFKLIEPEEVARLWGMQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CEPEALISLAFPDNQRPSLKAEF 479          
BLAST of ETS variant 4 vs. Ensembl Cavefish
Match: etv1 (ETS variant transcription factor 1 [Source:NCBI gene;Acc:103024366])

HSP 1 Score: 130.183 bits (326), Expect = 5.480e-33
Identity = 76/134 (56.72%), Postives = 92/134 (68.66%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNLIHPDMINYTICYPIQNSNEFHSSVQ 1027
            RG+ QLWQFL++LL D  +S  I WTGR  EFKLIEPEEVAR WG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ +  ++ P+N    L  ++     IN     P+ + +E  + VQ
Sbjct:  287 RGSLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CDPEALFSMAFPDNQRPVLKTDMER--QINEEDTVPLSHFDESVAYVQ 416          
BLAST of ETS variant 4 vs. Ensembl Cavefish
Match: etv1 (ETS variant transcription factor 1 [Source:NCBI gene;Acc:103024366])

HSP 1 Score: 130.183 bits (326), Expect = 7.841e-33
Identity = 76/134 (56.72%), Postives = 92/134 (68.66%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNLIHPDMINYTICYPIQNSNEFHSSVQ 1027
            RG+ QLWQFL++LL D  +S  I WTGR  EFKLIEPEEVAR WG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ +  ++ P+N    L  ++     IN     P+ + +E  + VQ
Sbjct:  331 RGSLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CDPEALFSMAFPDNQRPVLKTDMER--QINEEDTVPLSHFDESVAYVQ 460          
BLAST of ETS variant 4 vs. Ensembl Cavefish
Match: etv1 (ETS variant transcription factor 1 [Source:NCBI gene;Acc:103024366])

HSP 1 Score: 129.413 bits (324), Expect = 8.415e-33
Identity = 76/134 (56.72%), Postives = 92/134 (68.66%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNLIHPDMINYTICYPIQNSNEFHSSVQ 1027
            RG+ QLWQFL++LL D  +S  I WTGR  EFKLIEPEEVAR WG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ +  ++ P+N    L  ++     IN     P+ + +E  + VQ
Sbjct:  292 RGSLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CDPEALFSMAFPDNQRPVLKTDMER--QINEEDTVPLSHFDESVAYVQ 421          
BLAST of ETS variant 4 vs. Ensembl Sea Lamprey
Match: etv1 (ETS variant transcription factor 1 [Source:ZFIN;Acc:ZDB-GENE-070104-1])

HSP 1 Score: 127.102 bits (318), Expect = 1.141e-33
Identity = 68/109 (62.39%), Postives = 82/109 (75.23%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNL 952
            RG+ QLWQFL++LL D  +  +I WTGR  EFKL+EPEEVAR WG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ +  ++ P+N    L  ++
Sbjct:  162 RGSLQLWQFLVALLDDPANGHLITWTGRGMEFKLLEPEEVARKWGVQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CDPEALFSLAFPDNQRPLLKADI 268          
BLAST of ETS variant 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002472.1 (pep scaffold:Pmarinus_7.0:GL476893:38150:62026:-1 gene:ENSPMAG00000002241.1 transcript:ENSPMAT00000002472.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 129.798 bits (325), Expect = 1.985e-33
Identity = 66/93 (70.97%), Postives = 75/93 (80.65%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL 907
            RG+ QLWQFL++LL D  H+  I WTGR  EFKL++PEEVARLWG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ + 
Sbjct:  374 RGSLQLWQFLVALLEDPAHAGTIVWTGRGMEFKLLDPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CHPEVVF 464          
BLAST of ETS variant 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006723.1 (pep scaffold:Pmarinus_7.0:GL483008:681:12314:1 gene:ENSPMAG00000006043.1 transcript:ENSPMAT00000006723.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.872 bits (320), Expect = 1.571e-32
Identity = 65/93 (69.89%), Postives = 75/93 (80.65%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL 907
            RG+ QLWQFL++LL D  H+  I WTGR  EFKL++PEEVARLWG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVY+F   C P+ + 
Sbjct:  368 RGSLQLWQFLVALLEDPVHAGTIVWTGRGMEFKLLDPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYRFV--CDPEVVF 458          
BLAST of ETS variant 4 vs. Ensembl Sea Lamprey
Match: fli1a (Fli-1 proto-oncogene, ETS transcription factor a [Source:ZFIN;Acc:ZDB-GENE-980526-426])

HSP 1 Score: 104.375 bits (259), Expect = 2.856e-26
Identity = 53/82 (64.63%), Postives = 64/82 (78.05%), Query Frame = 2
Query:  632 GNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKF 877
            G  QLWQFLL LL DS ++  I W G + EFK+ +P+EVAR WG +K++P MNYDKLSR+LRYYYDKNIM KV G+RY YKF
Sbjct:   32 GQIQLWQFLLELLSDSSNANCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 113          
BLAST of ETS variant 4 vs. Ensembl Sea Lamprey
Match: fev (FEV transcription factor, ETS family member [Source:NCBI gene;Acc:791175])

HSP 1 Score: 103.99 bits (258), Expect = 3.032e-26
Identity = 52/82 (63.41%), Postives = 62/82 (75.61%), Query Frame = 2
Query:  632 GNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKF 877
            G  QLWQFLL LL D+ ++  I W G   EFKL +P+EVAR WG +K +P MNYDKLSR+LRYYYDKNIM KV G+RY Y+F
Sbjct:    4 GQIQLWQFLLELLSDAANAHCIAWEGACGEFKLTDPDEVARQWGKRKAKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYRF 85          
BLAST of ETS variant 4 vs. Ensembl Nematostella
Match: EDO37550 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFF5])

HSP 1 Score: 125.946 bits (315), Expect = 3.316e-35
Identity = 65/93 (69.89%), Postives = 73/93 (78.49%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL 907
            RG+ QLWQFL++LL +   S  I WTGR  EFKLI+PEEVAR WG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ + 
Sbjct:    4 RGSLQLWQFLVALLDEPECSSFIAWTGRGLEFKLIDPEEVARRWGLQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CSPEALF 94          
BLAST of ETS variant 4 vs. Ensembl Nematostella
Match: EDO39973 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8F6])

HSP 1 Score: 104.76 bits (260), Expect = 2.435e-27
Identity = 52/82 (63.41%), Postives = 65/82 (79.27%), Query Frame = 2
Query:  632 GNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKF 877
            G  QLWQFLL LL D +++  I W G + EFKL++P+EVAR WG +KN+P MNYDKLSR+LRYYYDKNIM K+ G+RY YK+
Sbjct:   13 GQIQLWQFLLELLSDPKNANCIAWEGTNGEFKLVDPDEVARRWGERKNKPNMNYDKLSRALRYYYDKNIMTKIHGKRYAYKY 94          
BLAST of ETS variant 4 vs. Ensembl Nematostella
Match: EDO43493 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYB7])

HSP 1 Score: 103.219 bits (256), Expect = 1.116e-26
Identity = 49/82 (59.76%), Postives = 63/82 (76.83%), Query Frame = 2
Query:  641 QLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDN 886
            QLWQFLL LL D     +I W G + EFKL +PE+VA+ WG +KN+PAMNY+KLSR+LRYYYD +++ KV G+R+VYKF  N
Sbjct:    2 QLWQFLLELLTDKTCRHLIMWVGEEGEFKLNDPEQVAQQWGKRKNKPAMNYEKLSRALRYYYDGDMIHKVHGKRFVYKFVCN 83          
BLAST of ETS variant 4 vs. Ensembl Nematostella
Match: EDO44339 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW27])

HSP 1 Score: 93.2041 bits (230), Expect = 1.825e-23
Identity = 51/82 (62.20%), Postives = 62/82 (75.61%), Query Frame = 2
Query:  641 QLWQFXXXXXXXXXXXXVICWTGRDK-EFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTD 883
             LW+FLL LL D R+S +I WT R+  EFKL+  EEVAR WG  K+RP MNYDKLSR+LRYYY K I++KV G+R VYKF +
Sbjct:    4 HLWEFLLDLLADGRYSSIISWTNRESGEFKLLNQEEVARRWGHLKHRPGMNYDKLSRALRYYYQKGIIKKVHGQRLVYKFCN 85          
BLAST of ETS variant 4 vs. Ensembl Nematostella
Match: EDO45310 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSZ6])

HSP 1 Score: 92.0485 bits (227), Expect = 4.989e-23
Identity = 49/82 (59.76%), Postives = 60/82 (73.17%), Query Frame = 2
Query:  641 QLWQFXXXXXXXXXXXXVICWTGRDK-EFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTD 883
             LW+FLL LL D   + +I WT +++ EFKL   EEVAR WG  K RP MNYDKLSR+LRYYY KNI++KV G+R VYKF +
Sbjct:    4 HLWEFLLELLADESCASMISWTKKEEGEFKLRNQEEVARRWGDLKQRPGMNYDKLSRALRYYYQKNIIKKVNGQRLVYKFVE 85          
BLAST of ETS variant 4 vs. Ensembl Medaka
Match: etv4 (ETS variant transcription factor 4 [Source:NCBI gene;Acc:101173984])

HSP 1 Score: 132.109 bits (331), Expect = 2.524e-33
Identity = 70/109 (64.22%), Postives = 82/109 (75.23%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNL 952
            RG+ QLWQFL++LL D  ++  I WTGR  EFKLIEPEEVARLWG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ ++ ++ P+N    L    
Sbjct:  372 RGSLQLWQFLVALLDDPGNAHFIAWTGRGMEFKLIEPEEVARLWGMQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CEPEALISMAFPDNQRPSLKAEF 478          
BLAST of ETS variant 4 vs. Ensembl Medaka
Match: etv1 (ETS variant transcription factor 1 [Source:NCBI gene;Acc:101169639])

HSP 1 Score: 129.413 bits (324), Expect = 3.661e-33
Identity = 79/145 (54.48%), Postives = 95/145 (65.52%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNLIHPDMINYTICYPIQNSNEFHSSVQHDQISQYLCYS 1060
            RG+ QLWQFL++LL D  +S  I WTGR  EFKLIEPEEVAR WG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ +  ++ P+N    L  ++     IN     P+ + +E  + VQ     Q   YS
Sbjct:  229 RGSLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CDPEALFSMAFPDNQRPVLKTDVER--QINEEDTVPLSHFDENMAYVQEGPYCQPHPYS 369          
BLAST of ETS variant 4 vs. Ensembl Medaka
Match: etv1 (ETS variant transcription factor 1 [Source:NCBI gene;Acc:101169639])

HSP 1 Score: 129.798 bits (325), Expect = 7.096e-33
Identity = 79/145 (54.48%), Postives = 95/145 (65.52%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMNLIHPDMINYTICYPIQNSNEFHSSVQHDQISQYLCYS 1060
            RG+ QLWQFL++LL D  +S  I WTGR  EFKLIEPEEVAR WG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ +  ++ P+N    L  ++     IN     P+ + +E  + VQ     Q   YS
Sbjct:  293 RGSLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CDPEALFSMAFPDNQRPVLKTDVER--QINEEDTVPLSHFDENMAYVQEGPYCQPHPYS 433          
BLAST of ETS variant 4 vs. Ensembl Medaka
Match: etv5a (ETS translocation variant 5 [Source:NCBI gene;Acc:101165293])

HSP 1 Score: 129.413 bits (324), Expect = 2.206e-32
Identity = 69/108 (63.89%), Postives = 82/108 (75.93%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL-VSSPNNSGMDLSMN 949
            RG+ QLWQFL++LL D  ++  I WTGR  EFKLIEPEEVAR WG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ +  ++ P+N    L ++
Sbjct:  357 RGSLQLWQFLVTLLDDPANAYFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CDPEALFSMAFPDNQRPSLKVD 462          
BLAST of ETS variant 4 vs. Ensembl Medaka
Match: ENSORLT00000028958.1 (ETS translocation variant 5-like [Source:NCBI gene;Acc:101164024])

HSP 1 Score: 126.331 bits (316), Expect = 1.778e-31
Identity = 65/93 (69.89%), Postives = 76/93 (81.72%), Query Frame = 2
Query:  629 RGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL 907
            RG+ QLWQFLL+LL +  ++ +I WTGR+ EFKL +PEEVARLWG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERYVYKF   C P+ + 
Sbjct:  320 RGSLQLWQFLLTLLDNPGNAHLIVWTGRNMEFKLNDPEEVARLWGVQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFV--CNPEALF 410          
BLAST of ETS variant 4 vs. Planmine SMEST
Match: SMESG000008885.1 (SMESG000008885.1)

HSP 1 Score: 634.795 bits (1636), Expect = 0.000e+0
Identity = 392/392 (100.00%), Postives = 392/392 (100.00%), Query Frame = 2
Query:   83 MNLNTGGNLDSQLPDVPDLYLRQSLPYSGDVEGFCQSTINLCGIGGGDFHGQISGRPESLVRLDSRFNYGECNLTREIFPGTYENNNGLMTSVSQAXXXXXXXXXXXXYITSDNSGNEDLTYLXXXXXXXXXXXXXXXXXQFSCEESSPPYIPDSNYXXXXXXXXXXXXXXACNNNSKGLAERGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNILVSSPNNSGMDLSMNLIHPDMINYTICYPIQNSNEFHSSVQHDQISQYLCYSPEHIQSSFTGMQTYSHQSLKSPALTCDYINNRESIXXXXXXXXXXXXXXXXXXSENYLKIESTTSI 1258
            MNLNTGGNLDSQLPDVPDLYLRQSLPYSGDVEGFCQSTINLCGIGGGDFHGQISGRPESLVRLDSRFNYGECNLTREIFPGTYENNNGLMTSVSQAVSLSMVNSNNVSYITSDNSGNEDLTYLSNNIEYSSLINNSNNNIQFSCEESSPPYIPDSNYNPNSRNNLLGSNSRACNNNSKGLAERGNPQLWQFLLSLLHDSRHSRVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNILVSSPNNSGMDLSMNLIHPDMINYTICYPIQNSNEFHSSVQHDQISQYLCYSPEHIQSSFTGMQTYSHQSLKSPALTCDYINNRESILLPQFPPQLNRPPNPLNNSENYLKIESTTSI
Sbjct:    1 MNLNTGGNLDSQLPDVPDLYLRQSLPYSGDVEGFCQSTINLCGIGGGDFHGQISGRPESLVRLDSRFNYGECNLTREIFPGTYENNNGLMTSVSQAVSLSMVNSNNVSYITSDNSGNEDLTYLSNNIEYSSLINNSNNNIQFSCEESSPPYIPDSNYNPNSRNNLLGSNSRACNNNSKGLAERGNPQLWQFLLSLLHDSRHSRVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNILVSSPNNSGMDLSMNLIHPDMINYTICYPIQNSNEFHSSVQHDQISQYLCYSPEHIQSSFTGMQTYSHQSLKSPALTCDYINNRESILLPQFPPQLNRPPNPLNNSENYLKIESTTSI 392          
BLAST of ETS variant 4 vs. Planmine SMEST
Match: SMESG000033317.1 (SMESG000033317.1)

HSP 1 Score: 124.02 bits (310), Expect = 7.686e-31
Identity = 62/95 (65.26%), Postives = 76/95 (80.00%), Query Frame = 2
Query:  623 AERGNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNIL 907
            +++ + QLWQFL SLL + ++  +I WTG+  EFKLI+PEEVA+LWG QKNRPAMNYDKLSRSLRYYY+K IMQKV GERY+YKF   C P  +L
Sbjct:  144 SQKRSLQLWQFLKSLLDNHKNIHIITWTGKSLEFKLIDPEEVAKLWGLQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYMYKFI--CDPSVLL 236          
BLAST of ETS variant 4 vs. Planmine SMEST
Match: SMESG000078333.1 (SMESG000078333.1)

HSP 1 Score: 114.39 bits (285), Expect = 4.965e-28
Identity = 64/115 (55.65%), Postives = 77/115 (66.96%), Query Frame = 2
Query:  632 GNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNILVSSPNNSGMDLSMNLIHPDMINY 976
            G  QLWQFLL LL DSR++  I W G + EFKLI+P+EVAR WG +K++P MNYDKLSR+LRYYYDKNIM KV G+RY YKF    L   +  +SP  SG   S     P +  Y
Sbjct:   76 GQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKY 190          
BLAST of ETS variant 4 vs. Planmine SMEST
Match: SMESG000078333.1 (SMESG000078333.1)

HSP 1 Score: 114.39 bits (285), Expect = 5.256e-28
Identity = 64/115 (55.65%), Postives = 77/115 (66.96%), Query Frame = 2
Query:  632 GNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKFTDNCLPDNILVSSPNNSGMDLSMNLIHPDMINY 976
            G  QLWQFLL LL DSR++  I W G + EFKLI+P+EVAR WG +K++P MNYDKLSR+LRYYYDKNIM KV G+RY YKF    L   +  +SP  SG   S     P +  Y
Sbjct:   79 GQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKY 193          
BLAST of ETS variant 4 vs. Planmine SMEST
Match: SMESG000036336.1 (SMESG000036336.1)

HSP 1 Score: 108.612 bits (270), Expect = 1.463e-26
Identity = 57/82 (69.51%), Postives = 66/82 (80.49%), Query Frame = 2
Query:  632 GNPQLWQFXXXXXXXXXXXXVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKF 877
            G  QLWQFLL LL DSR+S  I W G + EFKLI+P+EVAR WG +K++P MNYDKLSR+LRYYYDKNIM KV G+RY YKF
Sbjct:   54 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 135          
The following BLAST results are available for this feature:
BLAST of ETS variant 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ETV42.338e-3563.39ETS variant transcription factor 4 [Source:HGNC Sy... [more]
ETV41.566e-3363.39ETS variant transcription factor 4 [Source:HGNC Sy... [more]
ETV41.599e-3363.39ETS variant transcription factor 4 [Source:HGNC Sy... [more]
ETV41.599e-3363.39ETS variant transcription factor 4 [Source:HGNC Sy... [more]
ETV42.725e-3363.39ETS variant transcription factor 4 [Source:HGNC Sy... [more]
back to top
BLAST of ETS variant 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ast-16.805e-2851.56Axon STeering defect [Source:UniProtKB/TrEMBL;Acc... [more]
ets-51.080e-2764.63ETS domain-containing transcription factor ets-5 ... [more]
ets-52.364e-2764.63ETS domain-containing transcription factor ets-5 ... [more]
lin-11.003e-2154.00LIN-1 [Source:UniProtKB/TrEMBL;Acc:G5EDL0][more]
lin-11.003e-2154.00LIN-1 [Source:UniProtKB/TrEMBL;Acc:G5EDL0][more]
back to top
BLAST of ETS variant 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ets96B3.276e-3263.46gene:FBgn0039225 transcript:FBtr0339254[more]
Ets96B4.210e-3263.46gene:FBgn0039225 transcript:FBtr0084697[more]
Ets65A2.206e-2665.85gene:FBgn0005658 transcript:FBtr0077055[more]
Ets21C5.289e-2663.22gene:FBgn0005660 transcript:FBtr0112854[more]
Ets65A2.098e-2565.85gene:FBgn0005658 transcript:FBtr0077054[more]
back to top
BLAST of ETS variant 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
etv5b1.278e-3367.31ETS variant transcription factor 5b [Source:ZFIN;A... [more]
etv41.330e-3364.22ETS variant transcription factor 4 [Source:NCBI ge... [more]
etv41.330e-3364.22ETS variant transcription factor 4 [Source:NCBI ge... [more]
etv19.719e-3356.72ETS variant transcription factor 1 [Source:ZFIN;Ac... [more]
etv19.719e-3356.72ETS variant transcription factor 1 [Source:ZFIN;Ac... [more]
back to top
BLAST of ETS variant 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000029479.14.192e-3569.00pep primary_assembly:Xenopus_tropicalis_v9.1:10:23... [more]
ENSXETT00000029485.19.684e-3569.00pep primary_assembly:Xenopus_tropicalis_v9.1:10:23... [more]
etv15.230e-3264.22ETS variant transcription factor 1 [Source:NCBI ge... [more]
etv16.860e-3264.22ETS variant transcription factor 1 [Source:NCBI ge... [more]
etv17.104e-3264.22ETS variant transcription factor 1 [Source:NCBI ge... [more]
back to top
BLAST of ETS variant 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Etv41.599e-3363.39ets variant 4 [Source:MGI Symbol;Acc:MGI:99423][more]
Etv41.789e-3363.39ets variant 4 [Source:MGI Symbol;Acc:MGI:99423][more]
Etv41.803e-3363.39ets variant 4 [Source:MGI Symbol;Acc:MGI:99423][more]
Etv11.856e-3264.22ets variant 1 [Source:MGI Symbol;Acc:MGI:99254][more]
Etv52.018e-3269.00ets variant 5 [Source:MGI Symbol;Acc:MGI:1096867][more]
back to top
BLAST of ETS variant 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P28322|ETV4_MOUSE1.261e-3263.39ETS translocation variant 4 OS=Mus musculus OX=100... [more]
sp|P43268|ETV4_HUMAN1.309e-3263.39ETS translocation variant 4 OS=Homo sapiens OX=960... [more]
sp|Q9PUQ1|ETV4_DANRE3.564e-3263.30ETS translocation variant 4 OS=Danio rerio OX=7955... [more]
sp|Q9CXC9|ETV5_MOUSE1.438e-3169.00ETS translocation variant 5 OS=Mus musculus OX=100... [more]
sp|P41161|ETV5_HUMAN1.601e-3169.00ETS translocation variant 5 OS=Homo sapiens OX=960... [more]
back to top
BLAST of ETS variant 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
M1ELA58.253e-3363.39Ets variant 4 (Fragment) OS=Mustela putorius furo ... [more]
R7TDT01.073e-3270.00ETS domain-containing protein (Fragment) OS=Capite... [more]
A0A0P7W6W41.176e-3269.00ETS domain-containing protein OS=Scleropages formo... [more]
A0A402EAU52.287e-3270.00ETS domain-containing protein (Fragment) OS=Paroed... [more]
A0A5N4D3C52.733e-3263.39ETS translocation variant 4 OS=Camelus dromedarius... [more]
back to top
BLAST of ETS variant 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
etv42.291e-3364.22ETS variant transcription factor 4 [Source:NCBI ge... [more]
etv42.774e-3364.22ETS variant transcription factor 4 [Source:NCBI ge... [more]
etv15.480e-3356.72ETS variant transcription factor 1 [Source:NCBI ge... [more]
etv17.841e-3356.72ETS variant transcription factor 1 [Source:NCBI ge... [more]
etv18.415e-3356.72ETS variant transcription factor 1 [Source:NCBI ge... [more]
back to top
BLAST of ETS variant 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
etv11.141e-3362.39ETS variant transcription factor 1 [Source:ZFIN;Ac... [more]
ENSPMAT00000002472.11.985e-3370.97pep scaffold:Pmarinus_7.0:GL476893:38150:62026:-1 ... [more]
ENSPMAT00000006723.11.571e-3269.89pep scaffold:Pmarinus_7.0:GL483008:681:12314:1 gen... [more]
fli1a2.856e-2664.63Fli-1 proto-oncogene, ETS transcription factor a [... [more]
fev3.032e-2663.41FEV transcription factor, ETS family member [Sourc... [more]
back to top
BLAST of ETS variant 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ETS variant 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO375503.316e-3569.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399732.435e-2763.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434931.116e-2659.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO443391.825e-2362.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453104.989e-2359.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ETS variant 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
etv42.524e-3364.22ETS variant transcription factor 4 [Source:NCBI ge... [more]
etv13.661e-3354.48ETS variant transcription factor 1 [Source:NCBI ge... [more]
etv17.096e-3354.48ETS variant transcription factor 1 [Source:NCBI ge... [more]
etv5a2.206e-3263.89ETS translocation variant 5 [Source:NCBI gene;Acc:... [more]
ENSORLT00000028958.11.778e-3169.89ETS translocation variant 5-like [Source:NCBI gene... [more]
back to top
BLAST of ETS variant 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008885.10.000e+0100.00SMESG000008885.1[more]
SMESG000033317.17.686e-3165.26SMESG000033317.1[more]
SMESG000078333.14.965e-2855.65SMESG000078333.1[more]
SMESG000078333.15.256e-2855.65SMESG000078333.1[more]
SMESG000036336.11.463e-2669.51SMESG000036336.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032308 ID=SMED30032308|Name=ETS variant 4|organism=Schmidtea mediterranea sexual|type=transcript|length=1337bp
CATGCGCAGCAATTGAAGATAGAATCGGGTTCACAATTGATTTATTATCC
TTACATACTAAAAATACAAATTGACTATATCAATGAATCTCAATACCGGA
GGTAACCTCGACTCTCAGCTTCCTGATGTGCCGGATCTATATTTACGACA
ATCGCTACCATATTCGGGTGACGTAGAGGGTTTTTGTCAATCAACCATCA
ATTTATGTGGAATCGGAGGTGGAGATTTTCACGGTCAGATTTCCGGCAGA
CCGGAATCTTTAGTCCGATTGGATTCAAGATTTAACTATGGCGAATGTAA
TTTAACAAGGGAAATTTTCCCCGGGACTTATGAAAATAATAATGGACTAA
TGACCAGTGTTTCGCAAGCTGTTAGTCTTTCAATGGTGAACAGCAATAAT
GTGTCCTATATAACGTCAGATAACTCTGGAAATGAAGACCTAACATATTT
GTCTAATAATATTGAATATTCAAGTTTAATTAATAACTCAAACAATAACA
TCCAGTTTTCTTGTGAGGAGTCCTCTCCTCCATACATTCCAGATTCAAAT
TATAATCCGAATTCACGAAATAATCTATTAGGATCGAATTCTCGAGCATG
CAACAATAATTCCAAAGGTCTTGCAGAAAGAGGAAATCCTCAGTTATGGC
AATTTTTGCTGTCTTTGCTGCATGATAGCAGACACTCTCGAGTCATTTGT
TGGACTGGAAGAGATAAGGAATTTAAGTTAATAGAACCGGAAGAGGTAGC
TAGGTTATGGGGCGCTCAAAAGAACCGCCCTGCTATGAACTACGATAAAT
TAAGCCGATCACTAAGATATTATTATGACAAAAATATTATGCAAAAAGTG
CCAGGAGAAAGATATGTATATAAATTTACAGATAATTGTCTACCAGACAA
CATACTGGTCAGTTCACCAAACAACAGTGGAATGGATCTTTCAATGAATT
TGATACATCCAGATATGATAAATTATACAATCTGTTATCCAATACAGAAT
TCCAATGAATTCCATTCATCAGTACAGCACGATCAAATTTCACAATATCT
TTGCTATTCTCCAGAACATATTCAATCATCCTTTACTGGAATGCAGACTT
ATTCCCACCAGTCCTTAAAATCTCCAGCACTTACTTGTGATTATATTAAT
AATAGAGAATCCATACTTCTTCCTCAGTTTCCTCCACAGTTAAATCGTCC
TCCTAATCCATTAAACAACTCAGAAAATTATTTGAAAATAGAATCAACTA
CCTCAATTTAGGCCATCAATCATCAATTTATTTCTTCATGTATCCCTTTT
CACGTGGTTTCGGTAAAATAAATCTCAGTTACTGTGC
back to top

protein sequence of SMED30032308-orf-1

>SMED30032308-orf-1 ID=SMED30032308-orf-1|Name=SMED30032308-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=393bp
MNLNTGGNLDSQLPDVPDLYLRQSLPYSGDVEGFCQSTINLCGIGGGDFH
GQISGRPESLVRLDSRFNYGECNLTREIFPGTYENNNGLMTSVSQAVSLS
MVNSNNVSYITSDNSGNEDLTYLSNNIEYSSLINNSNNNIQFSCEESSPP
YIPDSNYNPNSRNNLLGSNSRACNNNSKGLAERGNPQLWQFLLSLLHDSR
HSRVICWTGRDKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDK
NIMQKVPGERYVYKFTDNCLPDNILVSSPNNSGMDLSMNLIHPDMINYTI
CYPIQNSNEFHSSVQHDQISQYLCYSPEHIQSSFTGMQTYSHQSLKSPAL
TCDYINNRESILLPQFPPQLNRPPNPLNNSENYLKIESTTSI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000978RNA polymerase II core promoter proximal region sequence-specific DNA binding
GO:0001228transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0043565sequence-specific DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005730nucleolus
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0006355regulation of transcription, DNA-templated
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR000418Ets_dom
IPR011991WHTH_DNA-bd_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000418Ets domainPRINTSPR00454ETSDOMAINcoord: 210..228
score: 49.09
coord: 248..266
score: 52.17
coord: 186..199
score: 58.0
coord: 229..247
score: 68.72
IPR000418Ets domainSMARTSM00413etsneu2coord: 185..270
e-value: 7.3E-54
score: 194.9
IPR000418Ets domainPFAMPF00178Etscoord: 187..265
e-value: 2.4E-37
score: 127.2
IPR000418Ets domainPROSITEPS00345ETS_DOMAIN_1coord: 188..196
IPR000418Ets domainPROSITEPS00346ETS_DOMAIN_2coord: 232..247
IPR000418Ets domainPROSITEPS50061ETS_DOMAIN_3coord: 186..266
score: 39.438
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 153..281
e-value: 5.6E-45
score: 154.3
NoneNo IPR availablePANTHERPTHR11849ETScoord: 126..273
NoneNo IPR availablePANTHERPTHR11849:SF282ETV5-RELATED PROTEIN ETS96Bcoord: 126..273
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 184..329