Myosin heavy chain IB

Overview
NameMyosin heavy chain IB
Smed IDSMED30032305
Length (bp)2070
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Myosin heavy chain IB (SMED30032305) t-SNE clustered cells

Violin plots show distribution of expression levels for Myosin heavy chain IB (SMED30032305) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Myosin heavy chain IB (SMED30032305) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Myosin heavy chain IB (SMED30032305) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032305

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30032305SMESG000032406.1 SMESG000032404.1 dd_Smed_v4_4715_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30032305SMESG000032406.1 SMESG000032404.1 dd_Smed_v6_4715_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032305SMESG000032406.1 SMESG000032404.1 dd_Smed_v4_4715_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Myosin heavy chain IB vs. Ensembl Human
Match: NOSTRIN (nitric oxide synthase trafficking [Source:HGNC Symbol;Acc:HGNC:20203])

HSP 1 Score: 102.449 bits (254), Expect = 1.231e-22
Identity = 95/384 (24.74%), Postives = 162/384 (42.19%), Query Frame = 3
Query:  735 KIEKNTQKLKDLSIKAEKEYFESSLSAEESRHNWEQSYLYGLDQLQKFETDRLNNLKTVIESYEKYINETPALYSNITSKIKVDIQKANVYEDL---MENSMHYTNQSPAVYKSEQNMLTLYAESKEN-PMDLNRRIENLEKRISALYQDQKKQDNLRQGAIKMLSVYEETSKFSDDATRKKTIREFSKTQSLVNLLSANIYKLLLALHSWKSKPAPPDPLISLGMKIINIVDRNSMLTSILESKPGSTLSPCEPGLMIRSDSSNSEVFSGKGTLXXXXXXXXXXXXXMSVNKRLPARPQSQISVNSNKQSFKRPLPPLPNPSIVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
            K+ K+T+KL+    K ++ Y++ +++   +R  WE +       + + E +R+  L   +  Y ++I+      +   ++I   I K ++ +D+   ME +   + ++ + +     +LT Y E   N  MD  RR   L+ ++  L +D +K    ++G  +ML  Y  TS FSD  ++K T     +    ++LL AN YKL   L   + +P P  P              NS+     +    S +    P LM R ++  S+  SG  +                                        P    P P     +   CKAL+ F+AR  +EL+ ++GD++ I  K  + WW G LNGK G  P  YV EL
Sbjct:   58 KLTKSTEKLE----KEDENYYQKNMAGYSTRLKWENTLENCYQSILELEKERIQLLCNNLNQYSQHISLFGQTLTTCHTQIHCAISKIDIEKDIQAVMEETAILSTENKSEF-----LLTDYFEEDPNSAMDKERRKSLLKPKLLRLQRDIEKASKDKEGLERMLKTYSSTSSFSDAKSQKDTAALMDENNLKLDLLEANSYKLSSMLAELEQRPQPSHPC------------SNSIFRWREKEHTHSYVKISRPFLMKRLENIVSKASSGGQS---------------------------------------NPGSSTPAPGAAQLSSRLCKALYSFQARQDDELNLEKGDIVIIHEKKEEGWWFGSLNGKKGHFPAAYVEEL 381          
BLAST of Myosin heavy chain IB vs. Ensembl Human
Match: NOSTRIN (nitric oxide synthase trafficking [Source:HGNC Symbol;Acc:HGNC:20203])

HSP 1 Score: 102.449 bits (254), Expect = 1.231e-22
Identity = 95/384 (24.74%), Postives = 162/384 (42.19%), Query Frame = 3
Query:  735 KIEKNTQKLKDLSIKAEKEYFESSLSAEESRHNWEQSYLYGLDQLQKFETDRLNNLKTVIESYEKYINETPALYSNITSKIKVDIQKANVYEDL---MENSMHYTNQSPAVYKSEQNMLTLYAESKEN-PMDLNRRIENLEKRISALYQDQKKQDNLRQGAIKMLSVYEETSKFSDDATRKKTIREFSKTQSLVNLLSANIYKLLLALHSWKSKPAPPDPLISLGMKIINIVDRNSMLTSILESKPGSTLSPCEPGLMIRSDSSNSEVFSGKGTLXXXXXXXXXXXXXMSVNKRLPARPQSQISVNSNKQSFKRPLPPLPNPSIVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
            K+ K+T+KL+    K ++ Y++ +++   +R  WE +       + + E +R+  L   +  Y ++I+      +   ++I   I K ++ +D+   ME +   + ++ + +     +LT Y E   N  MD  RR   L+ ++  L +D +K    ++G  +ML  Y  TS FSD  ++K T     +    ++LL AN YKL   L   + +P P  P              NS+     +    S +    P LM R ++  S+  SG  +                                        P    P P     +   CKAL+ F+AR  +EL+ ++GD++ I  K  + WW G LNGK G  P  YV EL
Sbjct:   58 KLTKSTEKLE----KEDENYYQKNMAGYSTRLKWENTLENCYQSILELEKERIQLLCNNLNQYSQHISLFGQTLTTCHTQIHCAISKIDIEKDIQAVMEETAILSTENKSEF-----LLTDYFEEDPNSAMDKERRKSLLKPKLLRLQRDIEKASKDKEGLERMLKTYSSTSSFSDAKSQKDTAALMDENNLKLDLLEANSYKLSSMLAELEQRPQPSHPC------------SNSIFRWREKEHTHSYVKISRPFLMKRLENIVSKASSGGQS---------------------------------------NPGSSTPAPGAAQLSSRLCKALYSFQARQDDELNLEKGDIVIIHEKKEEGWWFGSLNGKKGHFPAAYVEEL 381          
BLAST of Myosin heavy chain IB vs. Ensembl Human
Match: NOSTRIN (nitric oxide synthase trafficking [Source:HGNC Symbol;Acc:HGNC:20203])

HSP 1 Score: 102.449 bits (254), Expect = 1.231e-22
Identity = 95/384 (24.74%), Postives = 162/384 (42.19%), Query Frame = 3
Query:  735 KIEKNTQKLKDLSIKAEKEYFESSLSAEESRHNWEQSYLYGLDQLQKFETDRLNNLKTVIESYEKYINETPALYSNITSKIKVDIQKANVYEDL---MENSMHYTNQSPAVYKSEQNMLTLYAESKEN-PMDLNRRIENLEKRISALYQDQKKQDNLRQGAIKMLSVYEETSKFSDDATRKKTIREFSKTQSLVNLLSANIYKLLLALHSWKSKPAPPDPLISLGMKIINIVDRNSMLTSILESKPGSTLSPCEPGLMIRSDSSNSEVFSGKGTLXXXXXXXXXXXXXMSVNKRLPARPQSQISVNSNKQSFKRPLPPLPNPSIVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
            K+ K+T+KL+    K ++ Y++ +++   +R  WE +       + + E +R+  L   +  Y ++I+      +   ++I   I K ++ +D+   ME +   + ++ + +     +LT Y E   N  MD  RR   L+ ++  L +D +K    ++G  +ML  Y  TS FSD  ++K T     +    ++LL AN YKL   L   + +P P  P              NS+     +    S +    P LM R ++  S+  SG  +                                        P    P P     +   CKAL+ F+AR  +EL+ ++GD++ I  K  + WW G LNGK G  P  YV EL
Sbjct:   58 KLTKSTEKLE----KEDENYYQKNMAGYSTRLKWENTLENCYQSILELEKERIQLLCNNLNQYSQHISLFGQTLTTCHTQIHCAISKIDIEKDIQAVMEETAILSTENKSEF-----LLTDYFEEDPNSAMDKERRKSLLKPKLLRLQRDIEKASKDKEGLERMLKTYSSTSSFSDAKSQKDTAALMDENNLKLDLLEANSYKLSSMLAELEQRPQPSHPC------------SNSIFRWREKEHTHSYVKISRPFLMKRLENIVSKASSGGQS---------------------------------------NPGSSTPAPGAAQLSSRLCKALYSFQARQDDELNLEKGDIVIIHEKKEEGWWFGSLNGKKGHFPAAYVEEL 381          
BLAST of Myosin heavy chain IB vs. Ensembl Human
Match: NOSTRIN (nitric oxide synthase trafficking [Source:HGNC Symbol;Acc:HGNC:20203])

HSP 1 Score: 102.449 bits (254), Expect = 1.231e-22
Identity = 95/384 (24.74%), Postives = 162/384 (42.19%), Query Frame = 3
Query:  735 KIEKNTQKLKDLSIKAEKEYFESSLSAEESRHNWEQSYLYGLDQLQKFETDRLNNLKTVIESYEKYINETPALYSNITSKIKVDIQKANVYEDL---MENSMHYTNQSPAVYKSEQNMLTLYAESKEN-PMDLNRRIENLEKRISALYQDQKKQDNLRQGAIKMLSVYEETSKFSDDATRKKTIREFSKTQSLVNLLSANIYKLLLALHSWKSKPAPPDPLISLGMKIINIVDRNSMLTSILESKPGSTLSPCEPGLMIRSDSSNSEVFSGKGTLXXXXXXXXXXXXXMSVNKRLPARPQSQISVNSNKQSFKRPLPPLPNPSIVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
            K+ K+T+KL+    K ++ Y++ +++   +R  WE +       + + E +R+  L   +  Y ++I+      +   ++I   I K ++ +D+   ME +   + ++ + +     +LT Y E   N  MD  RR   L+ ++  L +D +K    ++G  +ML  Y  TS FSD  ++K T     +    ++LL AN YKL   L   + +P P  P              NS+     +    S +    P LM R ++  S+  SG  +                                        P    P P     +   CKAL+ F+AR  +EL+ ++GD++ I  K  + WW G LNGK G  P  YV EL
Sbjct:   58 KLTKSTEKLE----KEDENYYQKNMAGYSTRLKWENTLENCYQSILELEKERIQLLCNNLNQYSQHISLFGQTLTTCHTQIHCAISKIDIEKDIQAVMEETAILSTENKSEF-----LLTDYFEEDPNSAMDKERRKSLLKPKLLRLQRDIEKASKDKEGLERMLKTYSSTSSFSDAKSQKDTAALMDENNLKLDLLEANSYKLSSMLAELEQRPQPSHPC------------SNSIFRWREKEHTHSYVKISRPFLMKRLENIVSKASSGGQS---------------------------------------NPGSSTPAPGAAQLSSRLCKALYSFQARQDDELNLEKGDIVIIHEKKEEGWWFGSLNGKKGHFPAAYVEEL 381          
BLAST of Myosin heavy chain IB vs. Ensembl Human
Match: NOSTRIN (nitric oxide synthase trafficking [Source:HGNC Symbol;Acc:HGNC:20203])

HSP 1 Score: 102.449 bits (254), Expect = 1.231e-22
Identity = 95/384 (24.74%), Postives = 162/384 (42.19%), Query Frame = 3
Query:  735 KIEKNTQKLKDLSIKAEKEYFESSLSAEESRHNWEQSYLYGLDQLQKFETDRLNNLKTVIESYEKYINETPALYSNITSKIKVDIQKANVYEDL---MENSMHYTNQSPAVYKSEQNMLTLYAESKEN-PMDLNRRIENLEKRISALYQDQKKQDNLRQGAIKMLSVYEETSKFSDDATRKKTIREFSKTQSLVNLLSANIYKLLLALHSWKSKPAPPDPLISLGMKIINIVDRNSMLTSILESKPGSTLSPCEPGLMIRSDSSNSEVFSGKGTLXXXXXXXXXXXXXMSVNKRLPARPQSQISVNSNKQSFKRPLPPLPNPSIVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
            K+ K+T+KL+    K ++ Y++ +++   +R  WE +       + + E +R+  L   +  Y ++I+      +   ++I   I K ++ +D+   ME +   + ++ + +     +LT Y E   N  MD  RR   L+ ++  L +D +K    ++G  +ML  Y  TS FSD  ++K T     +    ++LL AN YKL   L   + +P P  P              NS+     +    S +    P LM R ++  S+  SG  +                                        P    P P     +   CKAL+ F+AR  +EL+ ++GD++ I  K  + WW G LNGK G  P  YV EL
Sbjct:   58 KLTKSTEKLE----KEDENYYQKNMAGYSTRLKWENTLENCYQSILELEKERIQLLCNNLNQYSQHISLFGQTLTTCHTQIHCAISKIDIEKDIQAVMEETAILSTENKSEF-----LLTDYFEEDPNSAMDKERRKSLLKPKLLRLQRDIEKASKDKEGLERMLKTYSSTSSFSDAKSQKDTAALMDENNLKLDLLEANSYKLSSMLAELEQRPQPSHPC------------SNSIFRWREKEHTHSYVKISRPFLMKRLENIVSKASSGGQS---------------------------------------NPGSSTPAPGAAQLSSRLCKALYSFQARQDDELNLEKGDIVIIHEKKEEGWWFGSLNGKKGHFPAAYVEEL 381          
BLAST of Myosin heavy chain IB vs. Ensembl Celegans
Match: unc-57 (Endophilin-A homolog [Source:UniProtKB/Swiss-Prot;Acc:B1V8A0])

HSP 1 Score: 62.3882 bits (150), Expect = 4.209e-10
Identity = 25/54 (46.30%), Postives = 38/54 (70.37%), Query Frame = 3
Query: 1713 KCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
            +C+AL DF+A+ + EL F+EG +I +  +I++ W+EG +NGK GL P  YV  L
Sbjct:  324 QCRALFDFDAQSEGELDFKEGTLIELVSQIDENWYEGRVNGKTGLFPVTYVQVL 377          
BLAST of Myosin heavy chain IB vs. Ensembl Celegans
Match: unc-57 (Endophilin-A homolog [Source:UniProtKB/Swiss-Prot;Acc:B1V8A0])

HSP 1 Score: 62.3882 bits (150), Expect = 4.437e-10
Identity = 25/54 (46.30%), Postives = 38/54 (70.37%), Query Frame = 3
Query: 1713 KCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
            +C+AL DF+A+ + EL F+EG +I +  +I++ W+EG +NGK GL P  YV  L
Sbjct:  320 QCRALFDFDAQSEGELDFKEGTLIELVSQIDENWYEGRVNGKTGLFPVTYVQVL 373          
BLAST of Myosin heavy chain IB vs. Ensembl Celegans
Match: unc-57 (Endophilin-A homolog [Source:UniProtKB/Swiss-Prot;Acc:B1V8A0])

HSP 1 Score: 62.3882 bits (150), Expect = 4.478e-10
Identity = 25/54 (46.30%), Postives = 38/54 (70.37%), Query Frame = 3
Query: 1713 KCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
            +C+AL DF+A+ + EL F+EG +I +  +I++ W+EG +NGK GL P  YV  L
Sbjct:  322 QCRALFDFDAQSEGELDFKEGTLIELVSQIDENWYEGRVNGKTGLFPVTYVQVL 375          
BLAST of Myosin heavy chain IB vs. Ensembl Celegans
Match: unc-57 (Endophilin-A homolog [Source:UniProtKB/Swiss-Prot;Acc:B1V8A0])

HSP 1 Score: 57.3806 bits (137), Expect = 5.046e-10
Identity = 25/56 (44.64%), Postives = 39/56 (69.64%), Query Frame = 3
Query: 1707 REKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
            + +C+AL DF+A+ + EL F+EG +I +  +I++ W+EG +NGK GL P  YV  L
Sbjct:   43 KPQCRALFDFDAQSEGELDFKEGTLIELVSQIDENWYEGRVNGKTGLFPVTYVQVL 98          
BLAST of Myosin heavy chain IB vs. Ensembl Celegans
Match: sem-5 (Sex muscle abnormal protein 5 [Source:UniProtKB/Swiss-Prot;Acc:P29355])

HSP 1 Score: 54.299 bits (129), Expect = 6.305e-8
Identity = 23/49 (46.94%), Postives = 34/49 (69.39%), Query Frame = 3
Query: 1719 KALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYV 1865
            +AL DF  ++  EL+F+ GDVIT+  K +  WWEG+LN + G+ P +YV
Sbjct:  160 QALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYV 208          
BLAST of Myosin heavy chain IB vs. Ensembl Fly
Match: CAP (gene:FBgn0033504 transcript:FBtr0088346)

HSP 1 Score: 58.9214 bits (141), Expect = 4.957e-9
Identity = 24/50 (48.00%), Postives = 36/50 (72.00%), Query Frame = 3
Query: 1716 CKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYV 1865
             +AL +F+ +  +ELSF++GD I I+R+I+  W+EGE N  IGL+P  YV
Sbjct:   61 ARALFNFQGQTSKELSFRKGDTIYIRRQIDANWYEGEHNAMIGLLPASYV 110          
BLAST of Myosin heavy chain IB vs. Ensembl Fly
Match: CAP (gene:FBgn0033504 transcript:FBtr0299828)

HSP 1 Score: 58.9214 bits (141), Expect = 4.957e-9
Identity = 24/50 (48.00%), Postives = 36/50 (72.00%), Query Frame = 3
Query: 1716 CKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYV 1865
             +AL +F+ +  +ELSF++GD I I+R+I+  W+EGE N  IGL+P  YV
Sbjct:   61 ARALFNFQGQTSKELSFRKGDTIYIRRQIDANWYEGEHNAMIGLLPASYV 110          
BLAST of Myosin heavy chain IB vs. Ensembl Fly
Match: CAP (gene:FBgn0033504 transcript:FBtr0306688)

HSP 1 Score: 60.077 bits (144), Expect = 5.032e-9
Identity = 24/50 (48.00%), Postives = 36/50 (72.00%), Query Frame = 3
Query: 1716 CKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYV 1865
             +AL +F+ +  +ELSF++GD I I+R+I+  W+EGE N  IGL+P  YV
Sbjct:  302 ARALFNFQGQTSKELSFRKGDTIYIRRQIDANWYEGEHNAMIGLLPASYV 351          
BLAST of Myosin heavy chain IB vs. Ensembl Fly
Match: RtGEF (gene:FBgn0015803 transcript:FBtr0112885)

HSP 1 Score: 60.077 bits (144), Expect = 5.875e-9
Identity = 24/51 (47.06%), Postives = 34/51 (66.67%), Query Frame = 3
Query: 1719 KALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNE 1871
            +A + F   + +EL FQ+GDVIT+ ++ +  WWEG LN K G  P +YVNE
Sbjct:    8 QAEYSFMGSNNDELCFQKGDVITVTQREDGGWWEGTLNDKTGWFPSNYVNE 58          
BLAST of Myosin heavy chain IB vs. Ensembl Fly
Match: CAP (gene:FBgn0033504 transcript:FBtr0301965)

HSP 1 Score: 60.4622 bits (145), Expect = 5.899e-9
Identity = 24/50 (48.00%), Postives = 36/50 (72.00%), Query Frame = 3
Query: 1716 CKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYV 1865
             +AL +F+ +  +ELSF++GD I I+R+I+  W+EGE N  IGL+P  YV
Sbjct: 1491 ARALFNFQGQTSKELSFRKGDTIYIRRQIDANWYEGEHNAMIGLLPASYV 1540          
BLAST of Myosin heavy chain IB vs. Ensembl Zebrafish
Match: si:ch211-226m7.4 (si:ch211-226m7.4 [Source:ZFIN;Acc:ZDB-GENE-080919-1])

HSP 1 Score: 93.2041 bits (230), Expect = 5.149e-21
Identity = 58/158 (36.71%), Postives = 83/158 (52.53%), Query Frame = 3
Query:  123 PNWKVTSQYSPKTLIGNWYEDKLKYKKYVYNHKSTYETDYTPKLL--PSVDRERQMLEGKMKLNGIDSKYLFNDGKLYENN-LISSYDEHYNRRPHMP-PIMRKWNSSFLAWLPEQSDHPLMGEPTNWGLLQEVEAARLRREYQRNRPDFSTTYTDSY 584
            P WK+  +Y  K LIGNW E+KL++ +      S+   DY P +L  P V   R+ L    +  G+ S+ L +   +  ++ L+S YDE Y R+     P +R W+   LAW+PE+SDHP+ G PT +GL    E  R R E QR      + Y  SY
Sbjct:   14 PGWKIEQKYGNKVLIGNWVEEKLQFARECKTANSSNRLDYIPHMLHRPDVVMRRKALR---RSEGVPSRQLLSHHDVPSSHYLVSLYDESYGRQTSSSLPTLRSWHHDKLAWVPERSDHPVQGPPTKFGL---AECWRTRVEQQRAVVPTLSLYKASY 165          
BLAST of Myosin heavy chain IB vs. Ensembl Zebrafish
Match: sh3gl1a (SH3-domain GRB2-like 1a [Source:ZFIN;Acc:ZDB-GENE-030131-4524])

HSP 1 Score: 67.0106 bits (162), Expect = 2.073e-11
Identity = 28/62 (45.16%), Postives = 41/62 (66.13%), Query Frame = 3
Query: 1680 PNPSIVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYV 1865
            P+ S    ++  C+AL+DFE  ++ EL F EGDVIT+  +I+D W+EG   G+ GL P +YV
Sbjct:  283 PSYSSTAADQPCCRALYDFEPENEGELGFNEGDVITLTNQIDDNWYEGSFRGQTGLFPCNYV 344          
BLAST of Myosin heavy chain IB vs. Ensembl Zebrafish
Match: sh3gl2b (SH3 domain containing GRB2 like 2b, endophilin A1 [Source:ZFIN;Acc:ZDB-GENE-170303-2])

HSP 1 Score: 65.4698 bits (158), Expect = 2.138e-11
Identity = 32/81 (39.51%), Postives = 49/81 (60.49%), Query Frame = 3
Query: 1632 SVNSNKQSFKRPLPPLPNPSIVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
             +NS K   + P  PL  P         C+AL+DFE  ++ EL F+EGD+IT+  +I+D W+EG ++G+ G  P +YV+ L
Sbjct:  163 GINSAKSPARSP-APLDQPC--------CRALYDFEPENEGELGFKEGDIITLTNQIDDNWYEGMIHGQSGFFPINYVDIL 234          
BLAST of Myosin heavy chain IB vs. Ensembl Zebrafish
Match: sh3gl1a (SH3-domain GRB2-like 1a [Source:ZFIN;Acc:ZDB-GENE-030131-4524])

HSP 1 Score: 66.6254 bits (161), Expect = 2.941e-11
Identity = 26/50 (52.00%), Postives = 36/50 (72.00%), Query Frame = 3
Query: 1716 CKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYV 1865
            C+AL+DFE  ++ EL F EGDVIT+  +I+D W+EG   G+ GL P +YV
Sbjct:  309 CRALYDFEPENEGELGFNEGDVITLTNQIDDNWYEGSFRGQTGLFPCNYV 358          
BLAST of Myosin heavy chain IB vs. Ensembl Zebrafish
Match: sh3gl3b (SH3-domain GRB2-like 3b [Source:ZFIN;Acc:ZDB-GENE-040121-4])

HSP 1 Score: 63.1586 bits (152), Expect = 4.151e-11
Identity = 28/68 (41.18%), Postives = 42/68 (61.76%), Query Frame = 3
Query: 1671 PPLPNPSIVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
            PPL  P         C+AL+ F+A +Q EL F+EGD+I +  +I++ W+EG + G+ GL P +YV  L
Sbjct:  115 PPLDQPC--------CQALYSFQAENQGELGFKEGDIIILTSQIDENWYEGMIRGQSGLFPMNYVKVL 174          
BLAST of Myosin heavy chain IB vs. Ensembl Xenopus
Match: prag1 (PEAK1 related, kinase-activating pseudokinase 1 [Source:Xenbase;Acc:XB-GENE-5933625])

HSP 1 Score: 92.8189 bits (229), Expect = 3.674e-19
Identity = 92/389 (23.65%), Postives = 158/389 (40.62%), Query Frame = 3
Query:  765 DLSIKAEKEYFESSLSAEESRHNWEQSYLYGLDQLQKFETDRLNNLKTVIESYEKYINETPALYSNITSKIKVDIQKANVYEDL---MENSMHYTNQSPAVYKSEQNMLTLYAESKENPMDLNRRIENLEKRISALYQDQKKQDNLRQGAIKMLSVYEETSKFSDDATRKKTIREFSKTQSLVNLLSANIYKLLLALHSWKSKPAPPDPLISLGMKIINIVDRNSMLTSILESKPGSTLSPCEPGLMIRSDSSNSEVFSGKGTLXXXXXXXXXXXXXMSVNKRLPARPQSQISVNSNKQSFKRPLP-----------------PLPNPSIVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNE 1871
            D   K +++Y++ ++S +  R  WE         +Q  E +R+  L  ++  Y +++       +   S+I   I+  +V +D+   ME +  Y+ ++    KSE  ++  + E     MD  RRI ++  ++  L  D  K    + G  KML  Y +   FSD    + TI    +T   ++LL AN +KLL  L   + +   P P      +I    ++ S  +S+  S+  +T        + R +S                           ++ R   R    +S + +K+S     P                   PN       R  C  L+ ++ + Q+EL  Q+GD++ I  K +D WW G LNGK G  P  YV E
Sbjct:  179 DTLTKTDEDYYQDNISGQTVRLKWENVLENCYKSIQDLEKERIQLLSHILNRYNQHVLTFGQTLNTCQSQIDQAIKSIDVEKDIQTFMEETAIYSEEN----KSEFLLMDYFEEDSSVIMDKERRIASINMKLERLQGDIDKAQKDKDGLEKMLKAYVDNPAFSDVKNEENTIILLEETNLKIHLLEANHFKLLSTLAELEGRSLSPHPC---SERISKWKEKGSQHSSVYISRAINTRK------LKRLESQR-------------------------ISNRSRDRMSHSVSFDDSKESDTTDYPNKPPRGLSRRVKDLHEESTPNNETNEHRRISCTVLYPYKPQRQDELGLQKGDLLEIHHKDDDGWWYGSLNGKKGYFPSTYVQE 529          
BLAST of Myosin heavy chain IB vs. Ensembl Xenopus
Match: c11orf58 (chromosome 11 open reading frame 58 [Source:Xenbase;Acc:XB-GENE-5721736])

HSP 1 Score: 77.7962 bits (190), Expect = 1.345e-15
Identity = 49/135 (36.30%), Postives = 74/135 (54.81%), Query Frame = 3
Query:  126 NWKVTSQYSPKTLIGNWYEDKLKYK-KYVYNHKSTYETDYT--PKLLPSVDRERQMLEGKMKLNGIDSKYLF-NDGKLYENNLISSYDEHYNRRPHMP-PIMRKWNSSFLAWLPEQSDHPLMGEPTNWGLLQEVE 515
             WK+  +YS K LIGNW E++ K++ +Y     S Y  D+   P   P     R +++   KL G+   +L  + G+    +L+S YD+HY R      P +R ++ + LAW+PEQSD+P    PTN+GL Q  E
Sbjct:    6 GWKIEPKYSDKVLIGNWVEERRKFRTRYQPKQDSCYNIDFVSFPDSKPDRIFTRSIVK---KLEGLPKCHLLSHHGEPKHKHLVSLYDDHYLRSGKSKLPTLRSYDGNRLAWVPEQSDYPTADPPTNFGLFQAKE 137          
BLAST of Myosin heavy chain IB vs. Ensembl Xenopus
Match: prag1 (PEAK1 related, kinase-activating pseudokinase 1 [Source:Xenbase;Acc:XB-GENE-5933625])

HSP 1 Score: 77.0258 bits (188), Expect = 3.987e-14
Identity = 84/341 (24.63%), Postives = 135/341 (39.59%), Query Frame = 3
Query:  903 KTVIESYEKYINETPALYSNITSKIK-VDIQKANVYEDLMENSMHYTNQSPAVYKSEQNMLTLYAESKENPMDLNRRIENLEKRISALYQDQKKQDNLRQGAIKMLSVYEETSKFSDDATRKKTIREFSKTQSLVNLLSANIYKLLLALHSWKSKPAPPDPLISLGMKIINIVDRNSMLTSILESKPGSTLSPCEPGLMIRSDSSNSEVFSGKGTLXXXXXXXXXXXXXMSVNKRLPARPQSQISVNSNKQSFKRPLP-----------------PLPNPSIVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNE 1871
            +TV   +E  +       S I   IK +D++K    +  ME +  Y+ ++    KSE  ++  + E     MD  RRI ++  ++  L  D  K    + G  KML  Y +   FSD    + TI    +T   ++LL AN +KLL  L   + +   P P      +I    ++ S  +S+  S+  +T        + R +S                           ++ R   R    +S + +K+S     P                   PN       R  C  L+ ++ + Q+EL  Q+GD++ I  K +D WW G LNGK G  P  YV E
Sbjct:  196 QTVRLKWENVLENCYKCQSQIDQAIKSIDVEKD--IQTFMEETAIYSEEN----KSEFLLMDYFEEDSSVIMDKERRIASINMKLERLQGDIDKAQKDKDGLEKMLKAYVDNPAFSDVKNEENTIILLEETNLKIHLLEANHFKLLSTLAELEGRSLSPHPC---SERISKWKEKGSQHSSVYISRAINTRK------LKRLESQR-------------------------ISNRSRDRMSHSVSFDDSKESDTTDYPNKPPRGLSRRVKDLHEESTPNNETNEHRRISCTVLYPYKPQRQDELGLQKGDLLEIHHKDDDGWWYGSLNGKKGYFPSTYVQE 496          
BLAST of Myosin heavy chain IB vs. Ensembl Xenopus
Match: sorbs2 (sorbin and SH3 domain containing 2 [Source:NCBI gene;Acc:100196922])

HSP 1 Score: 66.6254 bits (161), Expect = 1.070e-10
Identity = 26/56 (46.43%), Postives = 41/56 (73.21%), Query Frame = 3
Query: 1707 REKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
            RE  +A++DF+A+  +ELSF +GD + I RKI+  W+EGE +G+IG+ P  YV ++
Sbjct:  632 REPARAVYDFKAQTPKELSFSKGDTVYILRKIDKNWYEGEHHGRIGIFPVSYVEKM 687          
BLAST of Myosin heavy chain IB vs. Ensembl Xenopus
Match: sh3gl2 (SH3-domain GRB2-like 2 [Source:NCBI gene;Acc:100037852])

HSP 1 Score: 64.6994 bits (156), Expect = 1.402e-10
Identity = 28/69 (40.58%), Postives = 46/69 (66.67%), Query Frame = 3
Query: 1668 LPPLPNPSIVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
            L   P PS    ++  C+AL+DF+  ++ EL F+EGD+IT+  +I++ W+EG L+G+ G  P +YV+ L
Sbjct:  260 LAGTPKPSGAPMDQPCCRALYDFDPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINYVDIL 328          
BLAST of Myosin heavy chain IB vs. Ensembl Mouse
Match: 1700012P22Rik (RIKEN cDNA 1700012P22 gene [Source:MGI Symbol;Acc:MGI:1916614])

HSP 1 Score: 91.2781 bits (225), Expect = 1.382e-20
Identity = 56/176 (31.82%), Postives = 92/176 (52.27%), Query Frame = 3
Query:   93 TTYMSYQLCLPNWKVTSQYSPKTLIGNWYEDKLKYKKYVYNHKSTYETDYTPKLLPSVDRERQMLE---GKMKLNGIDSKYLFNDGKLYENN-LISSYDEHYNRRPHMP--PIMRKWNSSFLAWLPEQSDHPLMGEPTNWGLLQEVEAARLRREYQRNRPDFSTTYTDSYVPFCKV 602
            T+ +      P W++  +YS K L+GNW E++ K+ K +     T +  Y  + +P  D     +     K K+ G+  K+L    +   +  LIS+YD+HYNR  + P  P +R WN   L WLPE+SD PL+  PTN+GLL++++   L  +       ++T+Y    +P C +
Sbjct:    6 TSVVPEAFSTPGWQIEKKYSTKVLLGNWVEERGKFTKAI---DHTPQCIYRKEYVPMPDHRPDFVSRWYSKSKMEGLPYKHLITHHQEPSHRYLISTYDDHYNRHNYNPGLPALRTWNGQKLLWLPEKSDFPLVAPPTNYGLLEQLQQKWLASKTSLKESIYTTSYPR--LPVCAM 176          
BLAST of Myosin heavy chain IB vs. Ensembl Mouse
Match: Sh3gl1 (SH3-domain GRB2-like 1 [Source:MGI Symbol;Acc:MGI:700010])

HSP 1 Score: 72.0182 bits (175), Expect = 6.130e-13
Identity = 38/100 (38.00%), Postives = 56/100 (56.00%), Query Frame = 3
Query: 1596 NKRLPARPQSQISVNSNKQSFKRP-------LPPLPNPSIVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
            N   P  P  +I+ +S+ +S  +P       +PPL  PS        CKAL+DFE  +  EL F+EGD+IT+  +I++ W+EG L+G+ G  P  YV  L
Sbjct:  272 NGGFPCAPAPKITASSSFRSSDKPIRMPSKSMPPLDQPS--------CKALYDFEPENDGELGFREGDLITLTNQIDENWYEGMLHGQSGFFPLSYVQVL 363          
BLAST of Myosin heavy chain IB vs. Ensembl Mouse
Match: Sh3gl2 (SH3-domain GRB2-like 2 [Source:MGI Symbol;Acc:MGI:700009])

HSP 1 Score: 65.0846 bits (157), Expect = 8.430e-11
Identity = 27/62 (43.55%), Postives = 43/62 (69.35%), Query Frame = 3
Query: 1680 PNPSIVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYV 1865
            P P  V  ++  C+AL+DFE  ++ EL F+EGD+IT+  +I++ W+EG L+G+ G  P +YV
Sbjct:  283 PKPPGVQMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINYV 344          
BLAST of Myosin heavy chain IB vs. Ensembl Mouse
Match: Sorbs2 (sorbin and SH3 domain containing 2 [Source:MGI Symbol;Acc:MGI:1924574])

HSP 1 Score: 64.3142 bits (155), Expect = 4.064e-10
Identity = 25/53 (47.17%), Postives = 40/53 (75.47%), Query Frame = 3
Query: 1716 CKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
             KA++DF+A+  +ELSF++GD + I RKI+  W+EGE +G++G+ P  YV +L
Sbjct:  420 AKAVYDFKAQTSKELSFKKGDTVYILRKIDQNWYEGEHHGRVGIFPISYVEKL 472          
BLAST of Myosin heavy chain IB vs. Ensembl Mouse
Match: Sorbs2 (sorbin and SH3 domain containing 2 [Source:MGI Symbol;Acc:MGI:1924574])

HSP 1 Score: 63.929 bits (154), Expect = 4.104e-10
Identity = 25/53 (47.17%), Postives = 40/53 (75.47%), Query Frame = 3
Query: 1716 CKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
             KA++DF+A+  +ELSF++GD + I RKI+  W+EGE +G++G+ P  YV +L
Sbjct:  405 AKAVYDFKAQTSKELSFKKGDTVYILRKIDQNWYEGEHHGRVGIFPISYVEKL 457          
BLAST of Myosin heavy chain IB vs. UniProt/SwissProt
Match: sp|Q8IVI9|NOSTN_HUMAN (Nostrin OS=Homo sapiens OX=9606 GN=NOSTRIN PE=1 SV=2)

HSP 1 Score: 101.679 bits (252), Expect = 2.440e-21
Identity = 95/384 (24.74%), Postives = 161/384 (41.93%), Query Frame = 3
Query:  735 KIEKNTQKLKDLSIKAEKEYFESSLSAEESRHNWEQSYLYGLDQLQKFETDRLNNLKTVIESYEKYINETPALYSNITSKIKVDIQKANVYEDL---MENSMHYTNQSPAVYKSEQNMLTLYAESKEN-PMDLNRRIENLEKRISALYQDQKKQDNLRQGAIKMLSVYEETSKFSDDATRKKTIREFSKTQSLVNLLSANIYKLLLALHSWKSKPAPPDPLISLGMKIINIVDRNSMLTSILESKPGSTLSPCEPGLMIRSDSSNSEVFSGKGTLXXXXXXXXXXXXXMSVNKRLPARPQSQISVNSNKQSFKRPLPPLPNPSIVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
            K+ K+T+KL+    K ++ Y++ +++   +R  WE +       + + E +R+  L   +  Y ++I+      +   ++I   I K ++ +D+   ME +   + ++ + +     +LT Y E   N  MD  RR   L+ ++  L +D +K    ++G  +ML  Y  TS FSD  ++K T     +    ++LL AN YKL   L   + +P P  P              NS+     +    S +    P LM R ++  S+  SG  +                                        P    P P     +   CKAL+ F+AR  +EL+ ++GD++ I  K    WW G LNGK G  P  YV EL
Sbjct:  172 KLTKSTEKLE----KEDENYYQKNMAGYSTRLKWENTLENCYQSILELEKERIQLLCNNLNQYSQHISLFGQTLTTCHTQIHCAISKIDIEKDIQAVMEETAILSTENKSEF-----LLTDYFEEDPNSAMDKERRKSLLKPKLLRLQRDIEKASKDKEGLERMLKTYSSTSSFSDAKSQKDTAALMDENNLKLDLLEANSYKLSSMLAELEQRPQPSHPC------------SNSIFRWREKEHTHSYVKISRPFLMKRLENIVSKASSGGQS---------------------------------------NPGSSTPAPGAAQLSSRLCKALYSFQARQDDELNLEKGDIVIIHEKKEGGWWFGSLNGKKGHFPAAYVEEL 495          
BLAST of Myosin heavy chain IB vs. UniProt/SwissProt
Match: sp|Q4KKZ1|CA158_MOUSE (Uncharacterized protein C1orf158 homolog OS=Mus musculus OX=10090 PE=2 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 9.664e-20
Identity = 56/176 (31.82%), Postives = 92/176 (52.27%), Query Frame = 3
Query:   93 TTYMSYQLCLPNWKVTSQYSPKTLIGNWYEDKLKYKKYVYNHKSTYETDYTPKLLPSVDRERQMLE---GKMKLNGIDSKYLFNDGKLYENN-LISSYDEHYNRRPHMP--PIMRKWNSSFLAWLPEQSDHPLMGEPTNWGLLQEVEAARLRREYQRNRPDFSTTYTDSYVPFCKV 602
            T+ +      P W++  +YS K L+GNW E++ K+ K +     T +  Y  + +P  D     +     K K+ G+  K+L    +   +  LIS+YD+HYNR  + P  P +R WN   L WLPE+SD PL+  PTN+GLL++++   L  +       ++T+Y    +P C +
Sbjct:    6 TSVVPEAFSTPGWQIEKKYSTKVLLGNWVEERGKFTKAI---DHTPQCIYRKEYVPMPDHRPDFVSRWYSKSKMEGLPYKHLITHHQEPSHRYLISTYDDHYNRHNYNPGLPALRTWNGQKLLWLPEKSDFPLVAPPTNYGLLEQLQQKWLASKTSLKESIYTTSYPR--LPVCAM 176          
BLAST of Myosin heavy chain IB vs. UniProt/SwissProt
Match: sp|Q8N1D5|CA158_HUMAN (Uncharacterized protein C1orf158 OS=Homo sapiens OX=9606 GN=C1orf158 PE=2 SV=2)

HSP 1 Score: 90.8929 bits (224), Expect = 1.116e-19
Identity = 59/172 (34.30%), Postives = 95/172 (55.23%), Query Frame = 3
Query:  114 LCLPNWKVTSQYSPKTLIGNWYEDKLKYKKYVYNHKSTYETDYTPKLLPSVDRERQMLE---GKMKLNGIDSKYLFNDGKLYENN-LISSYDEHYNRR---PHMPPIMRKWNSSFLAWLPEQSDHPLMGEPTNWGLLQEVEAARLRREYQRNRPDFSTTYTDSY--VPFCKV 602
            L  P+W++ ++YS K L GNW E++   +K+  +   T ++ Y  + +P  D     +    GK K+ G+  K+L    +   +  LIS+YD+HYNR    P +PP +R WN   L WLPE+SD PL+  PTN+GL ++++  +L  +    +    +TYT SY   P C +
Sbjct:   11 LSTPSWQIETKYSTKVLTGNWMEER---RKFTRDTDKTPQSIYRKEYIPFPDHRPDQISRWYGKRKVEGLPYKHLITHHQEPPHRYLISTYDDHYNRHGYNPGLPP-LRTWNGQKLLWLPEKSDFPLLAPPTNYGLYEQLKQRQLTPKAGLKQ----STYTSSYPRPPLCAM 174          
BLAST of Myosin heavy chain IB vs. UniProt/SwissProt
Match: sp|Q2TA11|CA158_BOVIN (Uncharacterized protein C1orf158 homolog OS=Bos taurus OX=9913 PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 7.817e-17
Identity = 48/137 (35.04%), Postives = 80/137 (58.39%), Query Frame = 3
Query:  123 PNWKVTSQYSPKTLIGNWYEDKLKYKKYVYNHKSTYETDYTPKLLPSVDRERQMLE---GKMKLNGIDSKYLF-NDGKLYENNLISSYDEHYNRRPHMP--PIMRKWNSSFLAWLPEQSDHPLMGEPTNWGLLQEVE 515
            P+WK+ ++YS + L GNW E++   +K++   + T +T Y  + +P        +     K  + G+  KYL  +  +  +  LIS+YD+HYNR  + P  P +R WN   L WLPE++D PL+G PTN+GL ++++
Sbjct:   15 PSWKIETKYSTRVLTGNWTEER---RKFIKATEKTPQTIYRKEYVPFPGHRPDQISRWYSKRTVEGLPYKYLITHHQEPSQRYLISTYDDHYNRHNYHPGLPELRTWNRHKLLWLPEKADFPLLGPPTNYGLYEQLK 148          
BLAST of Myosin heavy chain IB vs. UniProt/SwissProt
Match: sp|Q62419|SH3G1_MOUSE (Endophilin-A2 OS=Mus musculus OX=10090 GN=Sh3gl1 PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 4.288e-12
Identity = 38/100 (38.00%), Postives = 56/100 (56.00%), Query Frame = 3
Query: 1596 NKRLPARPQSQISVNSNKQSFKRP-------LPPLPNPSIVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
            N   P  P  +I+ +S+ +S  +P       +PPL  PS        CKAL+DFE  +  EL F+EGD+IT+  +I++ W+EG L+G+ G  P  YV  L
Sbjct:  272 NGGFPCAPAPKITASSSFRSSDKPIRMPSKSMPPLDQPS--------CKALYDFEPENDGELGFREGDLITLTNQIDENWYEGMLHGQSGFFPLSYVQVL 363          
BLAST of Myosin heavy chain IB vs. TrEMBL
Match: A0A1X7VMJ4 (Uncharacterized protein OS=Amphimedon queenslandica OX=400682 GN=100634007 PE=4 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 1.068e-27
Identity = 106/396 (26.77%), Postives = 179/396 (45.20%), Query Frame = 3
Query:  735 KIEKNTQKLKDLSIKAEKEYFESSLSAEESRHNWEQSYLYGLDQLQKFETDRLNNLKTVIESYEKYINETPALYSNITSKIKVDIQKANVYEDLMENSMHYTNQSPAVYKSEQNMLTLYAESKENPMDLNRRIENLEKRISALYQDQKKQDNLRQGAIKMLSVYEETSKFSDDATRKKTIREFSKTQSLVNLLSANIYKLLLALHSWKSKPAPPDPLISL----------GMKIINI-VDRNSMLTSILESKPGSTLSPCEPGLMIRSDSSNSEVFSGKGTLXXXXXXXXXXXXXMSVNKR--LPARPQSQISVNSNKQSFKRP-LPPLPN----PSIVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVN 1868
            K+EKN +K +D  +KA++EY +S++  EE+R NWE +       L+  E  RL  + +V+  Y + +    +       ++    Q+ +   D+ E         P +   EQ +L  + E   N M+ +RR  NL+K+I  L QD  ++   ++G + + + YE+T  F D+       R+  +  +L+N+L AN +KLL         PAP  P               M I+++ +D+     SILE +  ++ +P  P +        S  +S                   SV KR         Q    S  + F      P  N    P+ +     +C+A +D+E +  +ELS Q GD+I +  KI+D WW+G LNG +G+ P +YV+
Sbjct:  172 KVEKNARKAEDSLVKADREYKDSNVRTEEARLNWESAMYRCCRYLENLERVRLEEVSSVLSKYTQILLTVVSPLQESCDELSEMAQQISPDRDI-EGMCQNFGTGPNL--PEQLLLDTFEEEMGNHMNGDRRQSNLDKKIQELEQDIDRKSKEKKGVMSLSAAYEKTPDFVDEQGAADVNRQLIEANALINMLKANHFKLLTVRSELAGLPAPASPYTEYIQVRKDRQNQSMSILSVPIDQ----VSILEEQTIASWTPPSPSI--------SHTYS-------------------SVKKRDSFSPPQAQQQDQPSEYEEFDDGNNEPQQNEDEYPAYIC----RCEAQYDYEGQQADELSIQPGDIIYVTEKIDDDWWQGNLNGTVGIFPANYVD 529          
BLAST of Myosin heavy chain IB vs. TrEMBL
Match: A0A2C9LNJ2 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106054008 PE=4 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 1.434e-26
Identity = 65/164 (39.63%), Postives = 99/164 (60.37%), Query Frame = 3
Query:  111 QLCLPNWKVTSQYSPKTLIGNWYEDKLKYKKYVYNHKSTYETDYT--PKLLPSVDRERQMLEGKMKLNGIDSKYLF-NDGKLYENNLISSYDEHYN---RRPHMPPIMRKWNSSFLAWLPEQSDHPLMGEPTNWGLLQEVEAARLRREYQRNRPDFSTTYTDSY 584
            +  +P+W++  +Y+P  LIGNW ED+LK+    Y H +T+  D+    +  P V   R+ +   +   G+ +  +F +    Y+N LI+ YDEHYN   R   +PP +R++NS  L W+PE+SD+PL G PTN+GL Q  EA  L R+ + + PDF +TY DSY
Sbjct:   13 KFGIPSWRIEQRYAPGVLIGNWSEDRLKFPDTKYKHNTTHRIDFKNYGEFHPDVTVRRKAV---LNNEGLPADMIFRHHDDAYDNMLITMYDEHYNGRWRENCLPP-LRQFNSQTLGWMPERSDYPLRGPPTNFGLKQYKEALALARQKELDHPDFESTYMDSY 172          
BLAST of Myosin heavy chain IB vs. TrEMBL
Match: A0A2T7PA20 (SH3 domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_09525 PE=4 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 5.018e-26
Identity = 90/381 (23.62%), Postives = 171/381 (44.88%), Query Frame = 3
Query:  732 FKIEKNTQKLKDLSIKAEKEYFESSLSAEESRHNWEQSYLYGLDQLQKFETDRLNNLKTVIESYEKYINETPALYSNITSKIKVDIQKANVYEDLMENSMHYTNQSPAVYKSEQNMLTLYAESKENPMDLNRRIENLEKRISALYQDQKKQDNLRQGAIKMLSVYEETSKFSDDATRKKTIREFSKTQSLVNLLSANIYKLLLALHSWKSKPAPPDPLISLGMKIINIVDRNSMLTSILESKPGSTLSPCEPGLMIRSDSSNSEVFSGKGTLXXXXXXXXXXXXXMSVNKRLPARPQSQISVNSNKQSFKRPLPPLPNPSIVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
            FK+EK +++L  L  K +KEY E++  AE +R  W+ +      QLQ+ E +R+N+++  +  +  +I+  P     I  ++   +   ++ +D+  +S+     S     +EQ ++  YAE  +  M+++RR + L   +  L+Q  +K+   + G  K++ VY+    F+D   ++ T ++  +T  ++N L A+ +K+   L   + +  P     +    I    D+ + + S+L+                                             + VN  L     S  S+ ++      P+    +         KC AL+D++A   +ELSF+ GDVIT+  K +  WW+GE+NG+ G  P  YV E+
Sbjct:  173 FKLEKKSEQLYSLVKKVDKEYTENAYKAETARQEWDVTVAKASSQLQQLEEERMNSMQDYLNKFNSHISVLPPKMQQIHDRMNESVIAVDLRQDI--HSVVQQKGSQTARHTEQILIDCYAEDTQFTMNMDRRKDALRNFLIYLHQLIEKERKGKDGVQKLVEVYKAKPTFADPEAQEDTRQKLQQTIMMLNFLEASHFKINSCLCKLEGRTLPQH---AFEQHIECTRDKQNYVVSVLK---------------------------------------------LPVNMTLDCSDYSTYSLPNDYMELASPVDDEFDDFDDDFPIAKCTALYDYKAEQNDELSFKMGDVITVYGKTDGGWWQGEINGRKGAFPSTYVKEM 503          
BLAST of Myosin heavy chain IB vs. TrEMBL
Match: A0A0B7BTB7 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF208140 PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 2.008e-24
Identity = 69/164 (42.07%), Postives = 97/164 (59.15%), Query Frame = 3
Query:  120 LPNWKVTSQYSPKTLIGNWYEDKLKYKKYVYNHKSTYETDY--TPKLLPSVDRERQMLEGKMKLNGIDSKY----LFNDGKLYENNLISSYDEHYN---RRPHMPPIMRKWNSSFLAWLPEQSDHPLMGEPTNWGLLQEVEAARLRREYQRNRPDFSTTYTDSY 584
            +P W++  +YSP  LIGNW ED  K+    Y H STY  D+  T  + P V     M+  K KL G + K+    L + G  Y+N LIS YDE YN   R   +PP+ RK+++  L WLPE+SD+PL G+ TNWGL ++ +A  L+R+ +   P+F +TY  SY
Sbjct:   16 IPGWRIEQKYSPGVLIGNWSEDMNKFSDSKYKHNSTYRLDFQNTGGIHPDV-----MIRRKTKL-GDEGKHADMLLRHHGDAYDNMLISLYDESYNGRWRENCLPPL-RKFDNQTLKWLPERSDYPLKGDATNWGLKEQRQAKLLKRQQEMYFPEFESTYMGSY 172          
BLAST of Myosin heavy chain IB vs. TrEMBL
Match: A0A224YUS1 (Nostrin OS=Rhipicephalus zambeziensis OX=60191 PE=4 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 2.582e-24
Identity = 92/380 (24.21%), Postives = 155/380 (40.79%), Query Frame = 3
Query:  735 KIEKNTQKLKDLSIKAEKEYFESSLSAEESRHNWEQSYLYGLDQLQKFETDRLNNLKTVIESYEKYINETPALYSNITSKIKVDIQKANVYEDLMENSMHYTNQSPAVYKSEQNMLTLYAESKENPMDLNRRIENLEKRISALYQDQKKQDNLRQGAIKMLSVYEETSKFSDDATRKKTIREFSKTQSLVNLLSANIYKLLLALHSWKSKPAPPDPLISLGMKIINIVDRNSMLTSILESKPGSTLSPCEPGLMIRSDSSNSEVFSGKGTLXXXXXXXXXXXXXMSVNKRLPARPQSQISVNSNKQSFKRPLPPLPNPSIVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
            K+E   +K +    KAE EY+ + +SAE++R  WE         LQ  E +RL  L T +  Y +++             ++      +  +D+ E ++     +P V   EQ +   YAE   +PM   RR E LE+ +  L +D   +   +QG   +   + E+ +F D+  + +   +  + +  +  L A+ +K+   L     +P PP PL      +    DR  +  ++L+  P           + R  SS  E   G        +                  P+ Q   N            LP+         +C+AL+D++A   +ELS   GDV+T+  +  D WW GE +G  G+ P  YV EL
Sbjct:  174 KLESKRRKAESALSKAEGEYYAACMSAEQARQEWETLLFQTAGWLQALEEERLQALHTALSRYAQHLMHMAPQTVQCAECVQAQTANVDAKQDI-EEAVRLRGTAPNV--PEQFLPDFYAEDLSSPMQPQRRKEALERLLQLLQKDLDTERRGKQGVESLAQAFRESPRFGDEEAQLRVQEKLQQLRQSLAFLEASRHKVQCCLAGLDGQPRPPHPLAP---HLEQRRDRQGLAQTVLKIPP----------WLQRRSSSAEEWDRGAADGGAEVEE-----------------PEEQPYANV-----------LPS---------QCRALYDYQATMDDELSLCSGDVVTVHSRAEDGWWHGEKDGHWGVFPASYVQEL 500          
BLAST of Myosin heavy chain IB vs. Ensembl Cavefish
Match: aadacl4 (chromosome 22 C1orf158 homolog [Source:NCBI gene;Acc:103033413])

HSP 1 Score: 89.7373 bits (221), Expect = 5.827e-20
Identity = 50/134 (37.31%), Postives = 75/134 (55.97%), Query Frame = 3
Query:  123 PNWKVTSQYSPKTLIGNWYEDKLKYKKYVYNHKSTYETDYTPKL--LPSVDRERQMLEGKMKLNGIDSKYLFNDGKLYENNLISSYDEHYNRRPHMP--PIMRKWNSSFLAWLPEQSDHPLMGEPTNWGLLQEV 512
            P W++  +YS + LIGNW E+KL++ +      STY  D+ P+L   P V   R  L     L     + +++      + L+S YDE Y R+ H    P +R W+S  L W+PE+SDHP+ G PTN+GLL+ +
Sbjct:   14 PGWRIEPRYSNRVLIGNWVEEKLQFTRECNTATSTYRLDFRPQLGHRPDVIMRRHALRRSEGLP--PHQLMYHHSTPTAHYLVSLYDESYGRQ-HTSDLPTLRTWHSDKLGWIPERSDHPVQGPPTNYGLLESL 144          
BLAST of Myosin heavy chain IB vs. Ensembl Cavefish
Match: nostrin (nitric oxide synthase trafficking [Source:NCBI gene;Acc:103028777])

HSP 1 Score: 70.0922 bits (170), Expect = 3.798e-12
Identity = 91/392 (23.21%), Postives = 161/392 (41.07%), Query Frame = 3
Query:  756 KLKDLSIKAEKEYFESSLSAEESRHNWEQSYLYGLDQLQKFETDRLNNLKTVIESYEKYINETPALYSNITSKIKVDIQKANVYEDLMENSMHYTNQSPAVYKSEQNMLTLYAESKENPMDLNRRIENLEKRISAL----YQDQKKQDNLRQGAIKMLSV-------YEETSKFSDDATRKKTIREFSKTQSLVNLLSANIYKLLLALHSWKSKPAPPDPLISLGMKIINIVDRNSMLTSILESKPGSTLSPCEPGLMIRSDSSNSEVFSGKGTLXXXXXXXXXXXXXMSVNKRL-PARPQSQISVNSNKQSFKRPLPPLPNPS---IVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL*QLN 1886
            K  +L +K ++EYF  ++   + R  WE +       +Q+ E  R+  L + +  Y  +++           +I+  I + +V +DL +  +  T  +    ++E  M   + E     M   RR + L+ ++  L     + ++ +D L + A+   S         EET +  D  T K            ++LL A   KL  AL   + KP P   L      I    D++   +++  S+P   +   +  L  R     S ++ G             S    + + +L P  PQ        +      LP   + +       +  KCKAL+D+ +   +EL+ +EGD++ I +K +  WW GELNG+ G  P  Y+ EL  LN
Sbjct:  198 KSAELQVKVDEEYFNMNMDGHKMRLKWENTLKSCYQIIQELEKQRIETLCSTLNKYSLHMSSYSQTLLQSEKQIEEAIGRVDVEKDL-QTLVEDTCVTAEDTEAEFLMADYFEEDGRTIMGRERRRDALKIKLQRLEEWITRTKEDKDGLERTAMSSESTSDLGQRNTEETEQILDANTLK------------LDLLEATHCKLNQALMDLEGKPRP---LHRFSNSITKFKDKDCEHSTVKLSRP---VKIKKTPLRSRQSLRTSIMYKGPAKNGASRQDSAPSTGAGTASAQLSPTEPQ--------RAELNGALPHSEDEAGKGAEFCSIGKCKALYDYSSERTDELNIKEGDLLNILQKDDSGWWFGELNGERGHFPSTYIEELPILN 562          
BLAST of Myosin heavy chain IB vs. Ensembl Cavefish
Match: ENSAMXT00000053701.1 (endophilin-A1 [Source:NCBI gene;Acc:103033999])

HSP 1 Score: 65.4698 bits (158), Expect = 4.872e-11
Identity = 29/69 (42.03%), Postives = 44/69 (63.77%), Query Frame = 3
Query: 1662 RPLPPLPNPSIVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVN 1868
            R   PL  PS        C+AL+DFE  ++ EL F+EGD+IT+  +I+D W+EG ++G+ G  P +YV+
Sbjct:  282 RSPAPLDQPS--------CRALYDFEPENEGELGFKEGDIITLTNQIDDNWYEGMIHGQSGFFPINYVD 342          
BLAST of Myosin heavy chain IB vs. Ensembl Cavefish
Match: sh3gl2a (SH3 domain containing GRB2 like 2a, endophilin A1 [Source:ZFIN;Acc:ZDB-GENE-040121-3])

HSP 1 Score: 64.6994 bits (156), Expect = 7.338e-11
Identity = 27/68 (39.71%), Postives = 44/68 (64.71%), Query Frame = 3
Query: 1671 PPLPNPSIVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
            PP+  P         C+AL+DF+  ++ EL F+EGD+IT+  KI++ W+EG ++G+ G  P +YV+ L
Sbjct:  257 PPMDQPC--------CRALYDFDPENEGELGFKEGDIITLTNKIDENWYEGMIHGQSGFFPVNYVDIL 316          
BLAST of Myosin heavy chain IB vs. Ensembl Cavefish
Match: sh3gl1b (SH3 domain containing GRB2 like 1, endophilin A2 [Source:NCBI gene;Acc:103032391])

HSP 1 Score: 64.3142 bits (155), Expect = 1.332e-10
Identity = 25/50 (50.00%), Postives = 38/50 (76.00%), Query Frame = 3
Query: 1716 CKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYV 1865
            CKAL+DFE  ++ EL F+EGD+IT+  +I++ W+EG L+G+ G  P +YV
Sbjct:  295 CKALYDFEPENEGELGFREGDIITLTNQIDENWYEGMLHGQSGFFPLNYV 344          
BLAST of Myosin heavy chain IB vs. Ensembl Sea Lamprey
Match: ABI1 (abl interactor 1 [Source:HGNC Symbol;Acc:HGNC:11320])

HSP 1 Score: 61.6178 bits (148), Expect = 3.016e-10
Identity = 26/61 (42.62%), Postives = 42/61 (68.85%), Query Frame = 3
Query: 1710 EKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL*QLNFA 1892
            EK  A++D+    ++ELSFQEG +I + +K +D W+EG +NG+ GL P +YV  +  L++A
Sbjct:  395 EKVVAVYDYNKDKEDELSFQEGSIIYVIKKNDDGWYEGTMNGQTGLFPGNYVEPI--LHYA 453          
BLAST of Myosin heavy chain IB vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009021.1 (pep scaffold:Pmarinus_7.0:GL482604:596:7954:-1 gene:ENSPMAG00000008160.1 transcript:ENSPMAT00000009021.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 8.129e-10
Identity = 25/52 (48.08%), Postives = 35/52 (67.31%), Query Frame = 3
Query: 1719 KALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
            +A  DF+  +++ELSF +GDVIT+ R  +  WWEG L G+ G  P +YV EL
Sbjct:   13 RARFDFQRNNEDELSFSKGDVITVTRPEDGGWWEGTLGGRSGWFPSNYVREL 64          
BLAST of Myosin heavy chain IB vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008112.1 (pep scaffold:Pmarinus_7.0:GL482163:8897:24902:-1 gene:ENSPMAG00000007333.1 transcript:ENSPMAT00000008112.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 9.577e-10
Identity = 27/58 (46.55%), Postives = 40/58 (68.97%), Query Frame = 3
Query: 1707 REKCKALHDFEARDQEELSFQEGDVI-TIKRKINDI-WWEGELNGKIGLIPKDYVNEL 1874
            RE CKAL  +EA++ +ELS +EG+++  I +   D  WWEGE+NGK G+ P ++V  L
Sbjct:    2 REYCKALFSYEAQNNDELSLKEGELVEIIAKDCGDAGWWEGEVNGKRGVFPDNFVKLL 59          
BLAST of Myosin heavy chain IB vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003067.1 (pep scaffold:Pmarinus_7.0:GL477025:38822:89389:-1 gene:ENSPMAG00000002795.1 transcript:ENSPMAT00000003067.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 1.407e-9
Identity = 24/52 (46.15%), Postives = 34/52 (65.38%), Query Frame = 3
Query: 1719 KALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
            +A   F+  +++ELSF++GDVIT+ R  +  WWEG  NG  G  P +YV EL
Sbjct:  172 RAKFTFQRTNEDELSFEKGDVITVTRVEHGGWWEGAFNGHTGWFPSNYVREL 223          
BLAST of Myosin heavy chain IB vs. Ensembl Sea Lamprey
Match: grb2a (growth factor receptor-bound protein 2a [Source:ZFIN;Acc:ZDB-GENE-041121-1])

HSP 1 Score: 57.3806 bits (137), Expect = 1.449e-9
Identity = 27/78 (34.62%), Postives = 44/78 (56.41%), Query Frame = 3
Query: 1632 SVNSNKQSFKRPLPPLPNPSIVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYV 1865
            SV+  +Q F R +  LP  +       + +AL DFE ++  EL F+ GD IT+    +  WW+G  +G+ G+ P++YV
Sbjct:  139 SVSRTQQIFLRDMEQLPQQAAT-----RVQALFDFEPQEDGELGFRRGDFITVVDSSDPNWWKGSCHGRAGMFPRNYV 211          

HSP 2 Score: 47.7506 bits (112), Expect = 2.229e-6
Identity = 21/50 (42.00%), Postives = 34/50 (68.00%), Query Frame = 3
Query: 1722 ALHDFEARDQEELSFQEGDVITI-KRKINDIWWEGELNGKIGLIPKDYVN 1868
            A +DF A  ++ELSF+ GDV+ +     +  W++ ELNG+ G IPK+Y++
Sbjct:    5 AKYDFNATAEDELSFKRGDVLKVLNEDCDQNWYKAELNGRDGFIPKNYID 54          
BLAST of Myosin heavy chain IB vs. Ensembl Yeast
Match: LSB1 (Negative regulator of actin nucleation-promoting factor activity; interacts with Las17p, a homolog of human Wiskott-Aldrich Syndrome protein (WASP), via an N-terminal SH3 domain, and along with PIN3 cooperatively inhibits the nucleation of actin filaments; overexpression blocks receptor-mediated endocytosis; protein increases in abundance and forms nuclear foci in response to DNA replication stress; LSB1 has a paralog, PIN3, that arose from the whole genome duplication [Source:SGD;Acc:S000003368])

HSP 1 Score: 56.225 bits (134), Expect = 2.810e-9
Identity = 24/56 (42.86%), Postives = 35/56 (62.50%), Query Frame = 3
Query: 1698 VDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYV 1865
             D  E  +AL+DFEA+   +LS + GD I +  KI+  W+ G+ N KIG+ P +YV
Sbjct:   52 ADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYV 107          
BLAST of Myosin heavy chain IB vs. Ensembl Yeast
Match: HSE1 (Subunit of the endosomal Vps27p-Hse1p complex; complex is required for sorting of ubiquitinated membrane proteins into intralumenal vesicles prior to vacuolar degradation, as well as for recycling of Golgi proteins and formation of lumenal membranes [Source:SGD;Acc:S000000994])

HSP 1 Score: 56.9954 bits (136), Expect = 4.958e-9
Identity = 21/51 (41.18%), Postives = 35/51 (68.63%), Query Frame = 3
Query: 1713 KCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYV 1865
            + +AL+D    + +ELSF++GDVIT+  ++   WW+G L G +G+ P +YV
Sbjct:  221 RVRALYDLTTNEPDELSFRKGDVITVLEQVYRDWWKGALRGNMGIFPLNYV 271          
BLAST of Myosin heavy chain IB vs. Ensembl Yeast
Match: LSB3 (Protein containing a C-terminal SH3 domain; binds Las17p, which is a homolog of human Wiskott-Aldrich Syndrome protein involved in actin patch assembly and actin polymerization; protein abundance increases in response to DNA replication stress; LSB3 has a paralog, YSC84, that arose from the whole genome duplication [Source:SGD;Acc:S000002968])

HSP 1 Score: 52.373 bits (124), Expect = 1.642e-7
Identity = 24/54 (44.44%), Postives = 34/54 (62.96%), Query Frame = 3
Query: 1713 KCKALHDFEARDQEELSFQEGDVITIKRKI---NDIWWEGELNGKIGLIPKDYV 1865
            K  AL+ F   +  +L F++GDVITI +K    ND WW G +NG+ G+ P +YV
Sbjct:  404 KAVALYSFAGEESGDLPFRKGDVITILKKSDSQND-WWTGRVNGREGIFPANYV 456          
BLAST of Myosin heavy chain IB vs. Ensembl Yeast
Match: RVS167 (Calmodulin-binding actin-associated protein; roles in endocytic membrane tabulation and constriction, and exocytosis; N-BAR domain protein that interacts with Rvs161p to regulate actin cytoskeleton, endocytosis, and viability following starvation or osmotic stress; recruited to bud tips by Gyl1p and Gyp5p during polarized growth; homolog of mammalian amphiphysin [Source:SGD;Acc:S000002796])

HSP 1 Score: 51.2174 bits (121), Expect = 3.648e-7
Identity = 25/61 (40.98%), Postives = 36/61 (59.02%), Query Frame = 3
Query: 1710 EKCKALHDFEARDQEELSFQEGDVITIKRKINDI--WWEGELNGKIGLIPKDYVNEL*QLN 1886
            E   AL+D++A+   +LSF  G VI I ++  D+  WW G  NG+ G+ P +YV    QLN
Sbjct:  424 ETVTALYDYQAQAAGDLSFPAGAVIEIVQRTPDVNEWWTGRYNGQQGVFPGNYV----QLN 480          
BLAST of Myosin heavy chain IB vs. Ensembl Yeast
Match: YSC84 (Actin-binding protein; involved in bundling of actin filaments and endocytosis of actin cortical patches; activity stimulated by Las17p; contains SH3 domain similar to Rvs167p; YSC84 has a paralog, LSB3, that arose from the whole genome duplication [Source:SGD;Acc:S000001058])

HSP 1 Score: 50.0618 bits (118), Expect = 9.112e-7
Identity = 22/50 (44.00%), Postives = 33/50 (66.00%), Query Frame = 3
Query: 1722 ALHDFEARDQEELSFQEGDVITIKRKIN--DIWWEGELNGKIGLIPKDYV 1865
            AL++F      +L+F++GDVITI +K +  + WW G  NGK G+ P +YV
Sbjct:  416 ALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGIFPANYV 465          
BLAST of Myosin heavy chain IB vs. Ensembl Nematostella
Match: EDO31004 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ59])

HSP 1 Score: 107.842 bits (268), Expect = 1.453e-26
Identity = 66/167 (39.52%), Postives = 94/167 (56.29%), Query Frame = 3
Query:  120 LPNWKVTSQYSPKTLIGNWYEDKLKYKKYVYNHKSTYETDYT--PKLLPSVDRERQMLEGKMKLNGIDSKYLF-NDGKLYENNLISSYDEHYNRR----PHMPPIMRKWNSSFLAWLPEQSDHPLMGEPTNWGLLQEVEAARLRREYQRNRPDFSTTYTDSYVPFCK 599
            LP W++  +Y+   LIGNW E++  +++   +  ST +TD+    K LP V   RQ L   +K +G+   YLF + GK Y  + IS YD+ YN+R      +PP +R WNS  LAW PE+SD PL G PTN+GLL++ +    R     N   + TT   SYVP  +
Sbjct:   14 LPGWRIEQRYATDVLIGNWNEERRNFERGGSHFNSTQKTDFKNYGKQLPDVKTRRQAL---LKHDGLAKAYLFSHHGKTYSGHRISWYDQEYNKREVTESQLPP-LRSWNSQQLAWGPEKSDFPLEGRPTNYGLLEKKQEKWRREAEAENMSIYHTTKELSYVPHAR 176          
BLAST of Myosin heavy chain IB vs. Ensembl Nematostella
Match: EDO43872 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXM7])

HSP 1 Score: 103.99 bits (258), Expect = 1.534e-23
Identity = 85/391 (21.74%), Postives = 166/391 (42.46%), Query Frame = 3
Query:  735 KIEKNTQKLKDLSIKAEKEYFESSLSAEESRHNWEQSYLYGLDQLQKFETDRLNNLKTVIESYEKYINETPALYSNITSKIKVDIQKANVYEDLME-----------NSMHYTNQSPAVYKSEQNMLTLYAESKENPMDLNRRIENLEKRISALYQDQKKQDNLRQGAIKMLSVYEETSKFSDDATRKKTIREFSKTQSLVNLLSANIYKLLLALHSWKSKPAPPDPLISLGMKIINIVDRNSMLTSILESKPGSTLSPCEPGLMIRSDSSNSEVFSGKGTLXXXXXXXXXXXXXMSVNKRLPARPQSQISVNSNKQSFKRPLPPLPNPSIVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
            K+E   +K  + +IK++K+Y E  +  E +R  WE +        +K E +R+ +LK +            +LY N+ + +  ++Q+  VYE +             N++     SP    SEQ +   Y E  EN  +  RR E L  +I  L  + +K+   + G + ++  Y  T ++ +  T+     + +   ++++ L A+ YKL  +L        P  PL+     I +  D+   + S L           +P  +++S                                  P   +S   ++     F+      P+ +++     +CKA++D++A   +EL+   GD+IT+  ++++ WW+G+LN + G+ P  YV E+
Sbjct:  172 KLEAKIKKGMESAIKSDKDYREMYMKTERTRLEWEATMSKYCQTCEKLEEERVGHLKDMF-----------SLYGNMLAAVIPELQQ--VYESIQHEASQISPKEDVNTIADVKGSPRG-PSEQTLYDCYEEDLENNFNFERRKEALNAKIKILASELEKEKKAKTGVVNLMDTYSATPEYCNQETQNDVAMQITHVNAVIDSLQASSYKLQCSLAKLTGNSQPQHPLMDY---ITSTRDKQGTVQSTLR----------KPLDLVKS----------------------------------PGGYESDDQLDDEFDDFQ------PDGTVLC----QCKAIYDYQATQSDELTIHPGDIITVTARLDNGWWQGDLNNQQGIFPASYVEEI 491          
BLAST of Myosin heavy chain IB vs. Ensembl Nematostella
Match: EDO31161 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYP4])

HSP 1 Score: 65.855 bits (159), Expect = 1.674e-11
Identity = 26/57 (45.61%), Postives = 40/57 (70.18%), Query Frame = 3
Query: 1704 NREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
             +EK KAL+DFE  +  EL F EGD+ITI+  +++ W EG ++G+ GL P++YV  +
Sbjct:  292 GKEKVKALYDFEPENDGELGFSEGDIITIESTVDENWLEGSVHGRTGLFPRNYVESM 348          
BLAST of Myosin heavy chain IB vs. Ensembl Nematostella
Match: EDO47212 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMW0])

HSP 1 Score: 59.6918 bits (143), Expect = 1.644e-9
Identity = 36/106 (33.96%), Postives = 56/106 (52.83%), Query Frame = 3
Query: 1593 VNKRL--PARPQSQISVNSNKQSFKRP---------LPPLPNPSIVVDNREK----CKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYV 1865
            +NKR+    R Q++   ++ KQ+ + P          P   NP     + +K    CKA  D++A+ + ELSF EG +IT+  K +D W+EG L+GK G+ P   V
Sbjct:  238 LNKRIVNARRNQAEAEASAPKQAPEEPENVPEQHEKAPESTNPLAKSSDSDKLKPSCKAKFDYKAKKEGELSFTEGQIITLSGKRDDEWYEGTLDGKFGIFPSALV 343          
BLAST of Myosin heavy chain IB vs. Ensembl Nematostella
Match: EDO25870 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1F0])

HSP 1 Score: 53.1434 bits (126), Expect = 3.024e-9
Identity = 21/37 (56.76%), Postives = 30/37 (81.08%), Query Frame = 3
Query: 1755 ELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYV 1865
            ELSF++GD I +KR+I+  W EGE+NG+IG+ P +YV
Sbjct:    6 ELSFKKGDYIIVKRQIDRNWIEGEVNGRIGIFPTNYV 42          
BLAST of Myosin heavy chain IB vs. Ensembl Medaka
Match: sh3gl2a (endophilin-A1 [Source:NCBI gene;Acc:101155008])

HSP 1 Score: 71.633 bits (174), Expect = 4.897e-13
Identity = 34/87 (39.08%), Postives = 48/87 (55.17%), Query Frame = 3
Query: 1614 RPQSQISVNSNKQSFKRPLPPLPNPSIVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
            RP    S+           PPL  PS        C+AL+DF+  ++ EL F+EGD+IT+  KI+D W+EG L+G  G  P +YV+ L
Sbjct:  270 RPSLDFSITETHNGGMHGAPPLDQPS--------CRALYDFDPENEGELGFKEGDIITLTNKIDDNWYEGMLHGNSGFFPINYVDIL 348          
BLAST of Myosin heavy chain IB vs. Ensembl Medaka
Match: sh3gl1b (endophilin-A2 [Source:NCBI gene;Acc:101164792])

HSP 1 Score: 67.0106 bits (162), Expect = 1.838e-11
Identity = 28/53 (52.83%), Postives = 38/53 (71.70%), Query Frame = 3
Query: 1716 CKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
            CKAL+DFE  ++ EL F EGDVIT+  +I++ W+EG LNG+ G  P +YV  L
Sbjct:  295 CKALYDFEPENEGELGFHEGDVITLTNQIDENWYEGMLNGQSGFFPLNYVEVL 347          
BLAST of Myosin heavy chain IB vs. Ensembl Medaka
Match: sh3gl2a (endophilin-A1 [Source:NCBI gene;Acc:101155008])

HSP 1 Score: 67.0106 bits (162), Expect = 1.871e-11
Identity = 34/86 (39.53%), Postives = 50/86 (58.14%), Query Frame = 3
Query: 1617 PQSQISVNSNKQSFKRPLPPLPNPSIVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
            P ++    S  +S  R   PL  PS        C+AL+DF+  ++ EL F+EGD+IT+  KI+D W+EG L+G  G  P +YV+ L
Sbjct:  281 PGARSPARSPARSPARSPAPLDQPS--------CRALYDFDPENEGELGFKEGDIITLTNKIDDNWYEGMLHGNSGFFPINYVDIL 358          
BLAST of Myosin heavy chain IB vs. Ensembl Medaka
Match: sh3gl1b (endophilin-A2 [Source:NCBI gene;Acc:101164792])

HSP 1 Score: 67.0106 bits (162), Expect = 2.048e-11
Identity = 28/53 (52.83%), Postives = 38/53 (71.70%), Query Frame = 3
Query: 1716 CKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
            CKAL+DFE  ++ EL F EGDVIT+  +I++ W+EG LNG+ G  P +YV  L
Sbjct:  295 CKALYDFEPENEGELGFHEGDVITLTNQIDENWYEGMLNGQSGFFPLNYVEVL 347          
BLAST of Myosin heavy chain IB vs. Ensembl Medaka
Match: sh3gl2a (endophilin-A1 [Source:NCBI gene;Acc:101155008])

HSP 1 Score: 67.0106 bits (162), Expect = 2.145e-11
Identity = 34/86 (39.53%), Postives = 50/86 (58.14%), Query Frame = 3
Query: 1617 PQSQISVNSNKQSFKRPLPPLPNPSIVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
            P ++    S  +S  R   PL  PS        C+AL+DF+  ++ EL F+EGD+IT+  KI+D W+EG L+G  G  P +YV+ L
Sbjct:  292 PGARSPARSPARSPARSPAPLDQPS--------CRALYDFDPENEGELGFKEGDIITLTNKIDDNWYEGMLHGNSGFFPINYVDIL 369          
BLAST of Myosin heavy chain IB vs. Planmine SMEST
Match: SMESG000032406.1 (SMESG000032406.1)

HSP 1 Score: 420.624 bits (1080), Expect = 1.435e-144
Identity = 220/221 (99.55%), Postives = 221/221 (100.00%), Query Frame = 3
Query: 1212 MLSVYEETSKFSDDATRKKTIREFSKTQSLVNLLSANIYKLLLALHSWKSKPAPPDPLISLGMKIINIVDRNSMLTSILESKPGSTLSPCEPGLMIRSDSSNSEVFSGKGTLXXXXXXXXXXXXXMSVNKRLPARPQSQISVNSNKQSFKRPLPPLPNPSIVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
            MLSVYEETSKFSDDATRKKTIREFSKTQSLVNLLSANIYKLLLALHSWKSKPAPPDPLISLGMKIINIVDRNSMLTSILESKPGSTLSPCEPGLMIRS+SSNSEVFSGKGTLDDFDDFETDSEEEMSVNKRLPARPQSQISVNSNKQSFKRPLPPLPNPSIVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL
Sbjct:    1 MLSVYEETSKFSDDATRKKTIREFSKTQSLVNLLSANIYKLLLALHSWKSKPAPPDPLISLGMKIINIVDRNSMLTSILESKPGSTLSPCEPGLMIRSNSSNSEVFSGKGTLDDFDDFETDSEEEMSVNKRLPARPQSQISVNSNKQSFKRPLPPLPNPSIVVDNREKCKALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 221          
BLAST of Myosin heavy chain IB vs. Planmine SMEST
Match: SMESG000032404.1 (SMESG000032404.1)

HSP 1 Score: 211.846 bits (538), Expect = 4.692e-63
Identity = 104/105 (99.05%), Postives = 104/105 (99.05%), Query Frame = 3
Query:  729 RFKIEKNTQKLKDLSIKAEKEYFESSLSAEESRHNWEQSYLYGLDQLQKFETDRLNNLKTVIESYEKYINETPALYSNITSKIKVDIQKANVYEDLMENSMHYTN 1043
            R KIEKNTQKLKDLSIKAEKEYFESSLSAEESRHNWEQSYLYGLDQLQKFETDRLNNLKTVIESYEKYINETPALYSNITSKIKVDIQKANVYEDLMENSMHYTN
Sbjct:  173 RSKIEKNTQKLKDLSIKAEKEYFESSLSAEESRHNWEQSYLYGLDQLQKFETDRLNNLKTVIESYEKYINETPALYSNITSKIKVDIQKANVYEDLMENSMHYTN 277          
BLAST of Myosin heavy chain IB vs. Planmine SMEST
Match: SMESG000026202.1 (SMESG000026202.1)

HSP 1 Score: 144.436 bits (363), Expect = 4.549e-41
Identity = 69/71 (97.18%), Postives = 70/71 (98.59%), Query Frame = 3
Query:  102 MSYQLCLPNWKVTSQYSPKTLIGNWYEDKLKYKKYVYNHKSTYETDYTPKLLPSVDRERQMLEGKMKLNGI 314
            MSYQLCLPNWKVTSQYSPKTLIGNWYEDKLKYKKYVYNHKSTYETDYTPKLLPSVDRERQMLEGKMKLN +
Sbjct:    1 MSYQLCLPNWKVTSQYSPKTLIGNWYEDKLKYKKYVYNHKSTYETDYTPKLLPSVDRERQMLEGKMKLNDV 71          
BLAST of Myosin heavy chain IB vs. Planmine SMEST
Match: SMESG000030362.1 (SMESG000030362.1)

HSP 1 Score: 110.538 bits (275), Expect = 1.042e-27
Identity = 60/160 (37.50%), Postives = 94/160 (58.75%), Query Frame = 3
Query:  129 WKVTSQYSPKTLIGNWYEDKLKYKKYVYNHKSTYETDYTPKLLPSVD---RERQMLEGKMKLNGIDSKYLF-NDGKLYENNLISSYDEHYNRRP----HMPPIMRKWNSSFLAWLPEQSDHPLMGEPTNWGLLQEVEAARLRREYQRNRPDFSTTYTDSY 584
            W +T  Y P  L+ NW+E++L Y K    H +TY T+Y+   LP  D   R +  L G    +GI + ++  + G +Y+++LI+ YD+  N R     ++ P +RKW+S+ ++W+PE+SD P+  EPTNWGLL E +     +     +PD  TTYTDS+
Sbjct:    8 WNITKDYKPGVLVNNWFEERLNYNKENIKHNTTYRTNYSATSLPFPDVILRRKNWLRG----DGIGTHFMLRHHGHVYDDSLITLYDQEINHRERKGRNVLPPLRKWDSTTISWIPEKSDFPIYDEPTNWGLLNEKKLRWNNQMKDMAKPDLLTTYTDSF 163          
BLAST of Myosin heavy chain IB vs. Planmine SMEST
Match: SMESG000055438.1 (SMESG000055438.1)

HSP 1 Score: 63.5438 bits (153), Expect = 3.197e-10
Identity = 26/59 (44.07%), Postives = 40/59 (67.80%), Query Frame = 3
Query: 1704 NREKCK--ALHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 1874
            N+  CK   L++++    +ELSFQEG++I + +K ND WWEG +NG+ GL P +YV  +
Sbjct:  447 NQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNM 505          
The following BLAST results are available for this feature:
BLAST of Myosin heavy chain IB vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NOSTRIN1.231e-2224.74nitric oxide synthase trafficking [Source:HGNC Sym... [more]
NOSTRIN1.231e-2224.74nitric oxide synthase trafficking [Source:HGNC Sym... [more]
NOSTRIN1.231e-2224.74nitric oxide synthase trafficking [Source:HGNC Sym... [more]
NOSTRIN1.231e-2224.74nitric oxide synthase trafficking [Source:HGNC Sym... [more]
NOSTRIN1.231e-2224.74nitric oxide synthase trafficking [Source:HGNC Sym... [more]
back to top
BLAST of Myosin heavy chain IB vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-574.209e-1046.30Endophilin-A homolog [Source:UniProtKB/Swiss-Prot... [more]
unc-574.437e-1046.30Endophilin-A homolog [Source:UniProtKB/Swiss-Prot... [more]
unc-574.478e-1046.30Endophilin-A homolog [Source:UniProtKB/Swiss-Prot... [more]
unc-575.046e-1044.64Endophilin-A homolog [Source:UniProtKB/Swiss-Prot... [more]
sem-56.305e-846.94Sex muscle abnormal protein 5 [Source:UniProtKB/S... [more]
back to top
BLAST of Myosin heavy chain IB vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAP4.957e-948.00gene:FBgn0033504 transcript:FBtr0088346[more]
CAP4.957e-948.00gene:FBgn0033504 transcript:FBtr0299828[more]
CAP5.032e-948.00gene:FBgn0033504 transcript:FBtr0306688[more]
RtGEF5.875e-947.06gene:FBgn0015803 transcript:FBtr0112885[more]
CAP5.899e-948.00gene:FBgn0033504 transcript:FBtr0301965[more]
back to top
BLAST of Myosin heavy chain IB vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-226m7.45.149e-2136.71si:ch211-226m7.4 [Source:ZFIN;Acc:ZDB-GENE-080919-... [more]
sh3gl1a2.073e-1145.16SH3-domain GRB2-like 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
sh3gl2b2.138e-1139.51SH3 domain containing GRB2 like 2b, endophilin A1 ... [more]
sh3gl1a2.941e-1152.00SH3-domain GRB2-like 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
sh3gl3b4.151e-1141.18SH3-domain GRB2-like 3b [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Myosin heavy chain IB vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prag13.674e-1923.65PEAK1 related, kinase-activating pseudokinase 1 [S... [more]
c11orf581.345e-1536.30chromosome 11 open reading frame 58 [Source:Xenbas... [more]
prag13.987e-1424.63PEAK1 related, kinase-activating pseudokinase 1 [S... [more]
sorbs21.070e-1046.43sorbin and SH3 domain containing 2 [Source:NCBI ge... [more]
sh3gl21.402e-1040.58SH3-domain GRB2-like 2 [Source:NCBI gene;Acc:10003... [more]
back to top
BLAST of Myosin heavy chain IB vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
1700012P22Rik1.382e-2031.82RIKEN cDNA 1700012P22 gene [Source:MGI Symbol;Acc:... [more]
Sh3gl16.130e-1338.00SH3-domain GRB2-like 1 [Source:MGI Symbol;Acc:MGI:... [more]
Sh3gl28.430e-1143.55SH3-domain GRB2-like 2 [Source:MGI Symbol;Acc:MGI:... [more]
Sorbs24.064e-1047.17sorbin and SH3 domain containing 2 [Source:MGI Sym... [more]
Sorbs24.104e-1047.17sorbin and SH3 domain containing 2 [Source:MGI Sym... [more]
back to top
BLAST of Myosin heavy chain IB vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IVI9|NOSTN_HUMAN2.440e-2124.74Nostrin OS=Homo sapiens OX=9606 GN=NOSTRIN PE=1 SV... [more]
sp|Q4KKZ1|CA158_MOUSE9.664e-2031.82Uncharacterized protein C1orf158 homolog OS=Mus mu... [more]
sp|Q8N1D5|CA158_HUMAN1.116e-1934.30Uncharacterized protein C1orf158 OS=Homo sapiens O... [more]
sp|Q2TA11|CA158_BOVIN7.817e-1735.04Uncharacterized protein C1orf158 homolog OS=Bos ta... [more]
sp|Q62419|SH3G1_MOUSE4.288e-1238.00Endophilin-A2 OS=Mus musculus OX=10090 GN=Sh3gl1 P... [more]
back to top
BLAST of Myosin heavy chain IB vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1X7VMJ41.068e-2726.77Uncharacterized protein OS=Amphimedon queenslandic... [more]
A0A2C9LNJ21.434e-2639.63Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2T7PA205.018e-2623.62SH3 domain-containing protein OS=Pomacea canalicul... [more]
A0A0B7BTB72.008e-2442.07Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A224YUS12.582e-2424.21Nostrin OS=Rhipicephalus zambeziensis OX=60191 PE=... [more]
back to top
BLAST of Myosin heavy chain IB vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aadacl45.827e-2037.31chromosome 22 C1orf158 homolog [Source:NCBI gene;A... [more]
nostrin3.798e-1223.21nitric oxide synthase trafficking [Source:NCBI gen... [more]
ENSAMXT00000053701.14.872e-1142.03endophilin-A1 [Source:NCBI gene;Acc:103033999][more]
sh3gl2a7.338e-1139.71SH3 domain containing GRB2 like 2a, endophilin A1 ... [more]
sh3gl1b1.332e-1050.00SH3 domain containing GRB2 like 1, endophilin A2 [... [more]
back to top
BLAST of Myosin heavy chain IB vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABI13.016e-1042.62abl interactor 1 [Source:HGNC Symbol;Acc:HGNC:1132... [more]
ENSPMAT00000009021.18.129e-1048.08pep scaffold:Pmarinus_7.0:GL482604:596:7954:-1 gen... [more]
ENSPMAT00000008112.19.577e-1046.55pep scaffold:Pmarinus_7.0:GL482163:8897:24902:-1 g... [more]
ENSPMAT00000003067.11.407e-946.15pep scaffold:Pmarinus_7.0:GL477025:38822:89389:-1 ... [more]
grb2a1.449e-934.62growth factor receptor-bound protein 2a [Source:ZF... [more]
back to top
BLAST of Myosin heavy chain IB vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
LSB12.810e-942.86Negative regulator of actin nucleation-promoting f... [more]
HSE14.958e-941.18Subunit of the endosomal Vps27p-Hse1p complex; com... [more]
LSB31.642e-744.44Protein containing a C-terminal SH3 domain; binds ... [more]
RVS1673.648e-740.98Calmodulin-binding actin-associated protein; roles... [more]
YSC849.112e-744.00Actin-binding protein; involved in bundling of act... [more]
back to top
BLAST of Myosin heavy chain IB vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO310041.453e-2639.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438721.534e-2321.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO311611.674e-1145.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO472121.644e-933.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO258703.024e-956.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Myosin heavy chain IB vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sh3gl2a4.897e-1339.08endophilin-A1 [Source:NCBI gene;Acc:101155008][more]
sh3gl1b1.838e-1152.83endophilin-A2 [Source:NCBI gene;Acc:101164792][more]
sh3gl2a1.871e-1139.53endophilin-A1 [Source:NCBI gene;Acc:101155008][more]
sh3gl1b2.048e-1152.83endophilin-A2 [Source:NCBI gene;Acc:101164792][more]
sh3gl2a2.145e-1139.53endophilin-A1 [Source:NCBI gene;Acc:101155008][more]
back to top
BLAST of Myosin heavy chain IB vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032406.11.435e-14499.55SMESG000032406.1[more]
SMESG000032404.14.692e-6399.05SMESG000032404.1[more]
SMESG000026202.14.549e-4197.18SMESG000026202.1[more]
SMESG000030362.11.042e-2737.50SMESG000030362.1[more]
SMESG000055438.13.197e-1044.07SMESG000055438.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032305 ID=SMED30032305|Name=Myosin heavy chain IB|organism=Schmidtea mediterranea sexual|type=transcript|length=2070bp
AATTAAGTTTTGAATAGAGTACGGTTGATTACTCCCGAATTGCTTTTATG
TCCCAGTCCTCTAACACAATTCCAAGCTCTAATTGACAGAAAACTACATA
TATGTCCTACCAGCTCTGCCTACCCAATTGGAAAGTGACCTCCCAATACA
GTCCCAAAACTTTAATTGGCAATTGGTATGAAGACAAGTTGAAGTACAAA
AAGTATGTATACAATCACAAATCAACTTATGAAACAGATTATACTCCAAA
GCTATTACCGTCCGTAGACAGAGAAAGACAAATGCTCGAAGGAAAAATGA
AGCTTAATGGTATCGACAGTAAATACCTTTTTAATGATGGGAAATTATAT
GAAAATAATTTGATATCATCCTATGACGAGCATTATAATAGACGTCCACA
TATGCCACCAATTATGAGAAAATGGAACAGCTCTTTCCTTGCTTGGTTGC
CAGAACAATCAGATCATCCTTTAATGGGAGAACCAACTAACTGGGGATTG
CTACAAGAAGTCGAAGCTGCTCGATTAAGAAGAGAATATCAAAGAAATAG
ACCCGATTTCTCAACAACATATACTGACAGTTATGTTCCATTTTGCAAAG
TTAAAGTCTTGTAAAATATTTAAAAATATCTAAAAGTAAATTCTCAATGA
AAATACTTTTTATTATTTAATGAAATAAAAATTATATTTTTTATTTAATT
AAAATTTTAGTATTTTTACATTTAGCTGCGTTTCAAGATCGAAAAGAATA
CACAGAAATTGAAAGATTTGAGTATCAAGGCAGAAAAAGAGTATTTTGAA
TCCTCTTTATCTGCTGAAGAAAGTCGGCATAATTGGGAGCAAAGTTATTT
ATATGGCTTAGATCAGTTACAGAAATTCGAAACCGATCGCTTGAACAATT
TAAAAACTGTCATTGAATCATATGAAAAATATATTAATGAAACTCCTGCT
TTATACAGTAATATAACATCAAAAATTAAAGTTGATATACAAAAAGCAAA
TGTTTACGAAGACTTGATGGAAAATTCAATGCATTATACCAACCAATCGC
CAGCTGTGTATAAAAGTGAACAAAACATGTTAACTTTATACGCAGAAAGT
AAGGAAAATCCCATGGATTTGAATCGACGCATTGAAAATCTTGAAAAGCG
GATCTCTGCTCTATACCAAGATCAGAAGAAACAAGATAATCTCAGACAAG
GTGCCATTAAAATGCTCAGTGTATACGAAGAAACATCGAAATTTTCAGAT
GATGCTACAAGAAAAAAGACAATAAGAGAATTTAGCAAAACCCAGTCTCT
CGTGAATCTTCTTAGTGCAAATATCTATAAATTACTATTGGCTCTTCATA
GTTGGAAATCGAAACCAGCTCCCCCTGATCCATTAATATCATTAGGAATG
AAAATTATTAACATTGTTGATCGTAATTCTATGTTAACATCAATATTGGA
AAGTAAACCAGGATCTACCCTTTCACCTTGTGAGCCTGGTTTAATGATCA
GATCAGATTCTAGCAATAGTGAAGTTTTTTCTGGAAAAGGCACTCTTGAT
GATTTCGATGATTTTGAAACAGATTCTGAAGAAGAAATGTCAGTTAATAA
AAGACTTCCAGCTAGACCTCAGTCTCAAATTAGTGTTAACAGTAACAAAC
AATCATTTAAACGGCCACTCCCGCCATTGCCCAATCCATCTATTGTTGTT
GATAACAGAGAAAAGTGTAAAGCCTTGCATGATTTTGAGGCCCGAGATCA
AGAAGAATTATCATTTCAAGAAGGAGATGTGATTACAATTAAGAGAAAAA
TAAATGATATATGGTGGGAAGGAGAATTAAATGGGAAAATTGGCTTGATT
CCTAAAGACTATGTTAATGAATTATAACAATTAAACTTCGCTCTTCTATG
TTTTGACTTTTATAAAACCGAAGTTTGAAGTATTTGATGTTAAAGCATTA
CTATATTGGATATTTTCCTATAATTTAACGAGAGACTTGTGCACCAGCTT
TATTTTCATCTAATGAAATTTAATTTTAGTCTTGTTGATGAGGAATTAAT
GCTTATTATTGGGATTTTTA
back to top

protein sequence of SMED30032305-orf-1

>SMED30032305-orf-1 ID=SMED30032305-orf-1|Name=SMED30032305-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=171bp
MSYQLCLPNWKVTSQYSPKTLIGNWYEDKLKYKKYVYNHKSTYETDYTPK
LLPSVDRERQMLEGKMKLNGIDSKYLFNDGKLYENNLISSYDEHYNRRPH
MPPIMRKWNSSFLAWLPEQSDHPLMGEPTNWGLLQEVEAARLRREYQRNR
PDFSTTYTDSYVPFCKVKVL*
back to top

protein sequence of SMED30032305-orf-2

>SMED30032305-orf-2 ID=SMED30032305-orf-2|Name=SMED30032305-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=287bp
MENSMHYTNQSPAVYKSEQNMLTLYAESKENPMDLNRRIENLEKRISALY
QDQKKQDNLRQGAIKMLSVYEETSKFSDDATRKKTIREFSKTQSLVNLLS
ANIYKLLLALHSWKSKPAPPDPLISLGMKIINIVDRNSMLTSILESKPGS
TLSPCEPGLMIRSDSSNSEVFSGKGTLDDFDDFETDSEEEMSVNKRLPAR
PQSQISVNSNKQSFKRPLPPLPNPSIVVDNREKCKALHDFEARDQEELSF
QEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0003774motor activity
GO:0003779actin binding
GO:0005524ATP binding
GO:0005515protein binding
GO:0003674molecular_function
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0016459myosin complex
GO:0005575cellular_component
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0016020membrane
GO:0031410cytoplasmic vesicle
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR028535Nostrin
IPR036028SH3-like_dom_sf
IPR001452SH3_domain
Vocabulary: biological process
TermDefinition
GO:0006897endocytosis
GO:0008150biological_process
GO:0045892negative regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 19..39
NoneNo IPR availablePRINTSPR00499P67PHOXcoord: 234..250
score: 45.59
coord: 214..234
score: 41.67
coord: 250..263
score: 46.43
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 202..266
e-value: 8.7E-23
score: 81.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 177..193
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 165..193
NoneNo IPR availablePANTHERPTHR14167SH3 DOMAIN-CONTAININGcoord: 5..266
IPR001452SH3 domainPRINTSPR00452SH3DOMAINcoord: 226..241
score: 37.72
coord: 254..266
score: 35.68
coord: 212..222
score: 39.55
coord: 243..252
score: 33.5
IPR001452SH3 domainSMARTSM00326SH3_2coord: 212..265
e-value: 1.5E-17
score: 74.3
IPR001452SH3 domainPFAMPF00018SH3_1coord: 215..260
e-value: 7.9E-15
score: 54.2
IPR001452SH3 domainPROSITEPS50002SH3coord: 209..266
score: 26.989
IPR028535NostrinPANTHERPTHR14167:SF31NOSTRINcoord: 5..266
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 199..265