Serine/threonine-protein phosphatase

Overview
NameSerine/threonine-protein phosphatase
Smed IDSMED30032302
Length (bp)1170
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein phosphatase (SMED30032302) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase (SMED30032302) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine-protein phosphatase (SMED30032302) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase (SMED30032302) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032302

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30032302 PL03018B1G02_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP1CA (protein phosphatase 1 catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:9281])

HSP 1 Score: 380.563 bits (976), Expect = 8.718e-133
Identity = 174/235 (74.04%), Postives = 206/235 (87.66%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M+ +E +N+D+II +LLEV+G +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D+ GW EN+RGVS TFG++VV KF
Sbjct:    1 MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKF 235          

HSP 2 Score: 114.39 bits (285), Expect = 8.718e-133
Identity = 56/72 (77.78%), Postives = 60/72 (83.33%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVK-KNKFFDVLKKHASARP 1020
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA K K K+      +   RP
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRP 318          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP1CC (protein phosphatase 1 catalytic subunit gamma [Source:HGNC Symbol;Acc:HGNC:9283])

HSP 1 Score: 380.178 bits (975), Expect = 9.163e-133
Identity = 175/235 (74.47%), Postives = 205/235 (87.23%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M   + +NID+II +LLEVRG +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D++GW EN+RGVS TFG++VV KF
Sbjct:    1 MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKF 235          

HSP 2 Score: 114.39 bits (285), Expect = 9.163e-133
Identity = 53/56 (94.64%), Postives = 55/56 (98.21%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKK 975
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA KK
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKK 302          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP1CC (protein phosphatase 1 catalytic subunit gamma [Source:HGNC Symbol;Acc:HGNC:9283])

HSP 1 Score: 380.178 bits (975), Expect = 1.186e-132
Identity = 175/235 (74.47%), Postives = 205/235 (87.23%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M   + +NID+II +LLEVRG +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D++GW EN+RGVS TFG++VV KF
Sbjct:    1 MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKF 235          

HSP 2 Score: 114.39 bits (285), Expect = 1.186e-132
Identity = 53/56 (94.64%), Postives = 55/56 (98.21%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKK 975
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA KK
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKK 302          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP1CC (protein phosphatase 1 catalytic subunit gamma [Source:HGNC Symbol;Acc:HGNC:9283])

HSP 1 Score: 379.022 bits (972), Expect = 2.016e-131
Identity = 175/235 (74.47%), Postives = 205/235 (87.23%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M   + +NID+II +LLEVRG +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D++GW EN+RGVS TFG++VV KF
Sbjct:    1 MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKF 235          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP1CC (protein phosphatase 1 catalytic subunit gamma [Source:HGNC Symbol;Acc:HGNC:9283])

HSP 1 Score: 380.178 bits (975), Expect = 2.428e-131
Identity = 175/235 (74.47%), Postives = 205/235 (87.23%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M   + +NID+II +LLEVRG +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D++GW EN+RGVS TFG++VV KF
Sbjct:    1 MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKF 235          

HSP 2 Score: 102.449 bits (254), Expect = 4.658e-24
Identity = 46/49 (93.88%), Postives = 49/49 (100.00%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQI 954
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQ+
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQV 295          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: gsp-2 (Serine/threonine-protein phosphatase PP1-beta [Source:UniProtKB/Swiss-Prot;Acc:P48727])

HSP 1 Score: 380.178 bits (975), Expect = 2.419e-132
Identity = 175/231 (75.76%), Postives = 202/231 (87.45%), Query Frame = 2
Query:   86 ESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            E +N+D II++LLEVRG +PG++V L E EIK LC K+R+IFL QP  LELEAP+KICGD+HGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA+IDEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D+ GW EN+RGVS TFG +VV KF
Sbjct:    4 EKLNLDNIISRLLEVRGSKPGKNVQLTESEIKGLCQKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVTGWGENDRGVSFTFGPEVVAKF 234          

HSP 2 Score: 112.079 bits (279), Expect = 2.419e-132
Identity = 51/56 (91.07%), Postives = 55/56 (98.21%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKK 975
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAG+MM+VDETLMCSFQILKPA KK
Sbjct:  246 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGSMMTVDETLMCSFQILKPADKK 301          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: gsp-1 (Serine/threonine-protein phosphatase PP1-alpha [Source:UniProtKB/Swiss-Prot;Acc:Q27497])

HSP 1 Score: 374.4 bits (960), Expect = 3.161e-131
Identity = 170/235 (72.34%), Postives = 203/235 (86.38%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M+ +  +NID +I +LLEVRG +PG+ V + E EI+ALC+K+R+IFL QP  LELEAP+KICGDIHGQY DLLRLFEYGGFPP +NYLFLGDYVDRG+QS+E I LLLAYK+KYPENFFLLRGNHE A+INRIYGFYDECKRR++I+LWK FTDCFN LP AALIDEKI C HGGLSP+L++++QI+ + RP +VPD GL+CDLLWSDPD+D+ GW EN+RGVS TFG DVV KF
Sbjct:    1 MSNDGDLNIDNLITRLLEVRGCRPGKPVTMSEAEIRALCHKSREIFLSQPILLELEAPLKICGDIHGQYNDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFLLRGNHECASINRIYGFYDECKRRFSIKLWKTFTDCFNCLPIAALIDEKIFCCHGGLSPDLQNMEQIRRVMRPTDVPDTGLLCDLLWSDPDKDVTGWGENDRGVSFTFGPDVVAKF 235          

HSP 2 Score: 114.005 bits (284), Expect = 3.161e-131
Identity = 52/59 (88.14%), Postives = 56/59 (94.92%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKKNKF 984
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAG MMSVDETLMCSFQILKP+ KK K+
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKY 305          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: pph-1 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:G5EC18])

HSP 1 Score: 310.842 bits (795), Expect = 5.467e-108
Identity = 148/241 (61.41%), Postives = 183/241 (75.93%), Query Frame = 2
Query:   65 LEKMNTNES---INIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            + + N++ S   +NID +I+ L+ V+     +++ + E EI+ +C  AR IF+ QP  LELE P+KI GDIHGQ+ DLLRLF   G+PP SNYLFLGDYVDRG +SIE I LLL YKIKYP NFFLLRGNHE A +NRIYGFYDECKRRY+++LWK F D FN +P AALID KI C HGGLSP LRSL Q+K +SRP +V + GL+CD+LWSDPD  +VGWA NERGVS+ FG DV+ +F
Sbjct:    2 MRRKNSSSSFGELNIDQLISTLVSVKPWH--KTLDVTENEIRMVCVLARQIFMHQPMLLELEPPLKIGGDIHGQFADLLRLFNLAGYPPESNYLFLGDYVDRGPKSIETIVLLLCYKIKYPNNFFLLRGNHEVANLNRIYGFYDECKRRYSVKLWKCFQDVFNCMPVAALIDNKIFCCHGGLSPNLRSLDQLKRLSRPCDVQETGLLCDVLWSDPDATVVGWAPNERGVSYVFGVDVLAQF 240          

HSP 2 Score: 99.7525 bits (247), Expect = 5.467e-108
Identity = 43/52 (82.69%), Postives = 48/52 (92.31%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKP 963
             HQVVEDGYEFF +R LVT+FSAPNYCGEFDNAGA+M+VDE L+CSFQILKP
Sbjct:  252 GHQVVEDGYEFFGRRGLVTVFSAPNYCGEFDNAGAVMNVDENLLCSFQILKP 303          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: F52H3.6 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:Q27501])

HSP 1 Score: 266.929 bits (681), Expect = 4.040e-92
Identity = 124/230 (53.91%), Postives = 159/230 (69.13%), Query Frame = 2
Query:   92 INIDTIIAKLLEVR-GGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            +NI + I +LL V     P  +  + E +I  +  K   I L Q   +E++API +CGDIHGQY DLLR+F    FPP  NYLFLGDYVDRGRQ +E I LL+AYKI+YP  FF+LRGNHE A+INR YGFYDECKRRY++ L+  F + FN LP  A+I  +I C HGGLS +L S  Q+ EI+RP + P++ L  DLLW+DP+ ++ GWAE+ RGVS  FG+DVV  F
Sbjct:    2 VNIPSFIDRLLSVNDTSNPSLTRCINEADIDVVIEKCTKILLAQATMVEVQAPIAVCGDIHGQYTDLLRIFNRCSFPPDQNYLFLGDYVDRGRQQLEVICLLMAYKIRYPNRFFILRGNHECASINRTYGFYDECKRRYSLALYNDFQNLFNHLPLCAMISGRIFCMHGGLSQKLVSWTQLAEITRPFDPPNNSLAMDLLWADPENNMTGWAESSRGVSQIFGADVVKDF 231          

HSP 2 Score: 90.8929 bits (224), Expect = 4.040e-92
Identity = 40/59 (67.80%), Postives = 49/59 (83.05%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKKNKF 984
             HQVV+DGYEFFA ++LVTIFSAP YCGEFDN  A+M VDE L+ SF+ILKPA+++ K 
Sbjct:  243 GHQVVQDGYEFFADKRLVTIFSAPKYCGEFDNNAAVMIVDERLIVSFEILKPAIREVKI 301          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: gsp-3 (Serine/threonine-protein phosphatase PP1-gamma [Source:UniProtKB/Swiss-Prot;Acc:O02658])

HSP 1 Score: 271.937 bits (694), Expect = 6.383e-92
Identity = 125/228 (54.82%), Postives = 167/228 (73.25%), Query Frame = 2
Query:   92 INIDTIIAKLLEVRGGQPGR-SVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRY-NIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVV 769
            +++D ++++LL V G   GR +  + E E++  C  A+ +F  Q   LE+E PI +CGDIHGQY DLLR+F+  GFPP  N+LFLGDYVDRGRQ+IE I L+L +KIKYPENFF+LRGNHE  AINR+YGFY+EC RRY + RLW IF D FN +P   LI  +I+C HGGLSP L++L Q++++ RP++ P+  +  DLLW+DPD+ + GW  N RGVS+ FG DVV
Sbjct:    5 MDVDNLMSRLLNV-GMSGGRLTTSVNEQELQTCCAVAKSVFASQASLLEVEPPIIVCGDIHGQYSDLLRIFDKNGFPPDVNFLFLGDYVDRGRQNIETICLMLCFKIKYPENFFMLRGNHECPAINRVYGFYEECNRRYKSTRLWSIFQDTFNWMPLCGLIGSRILCMHGGLSPHLQTLDQLRQLPRPQDPPNPSIGIDLLWADPDQWVKGWQANTRGVSYVFGQDVV 231          

HSP 2 Score: 85.5001 bits (210), Expect = 6.383e-92
Identity = 36/58 (62.07%), Postives = 47/58 (81.03%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKKNK 981
            AHQVV+DGYEFFA +K+VTIFSAP+YCG+FDN+ A M VDE ++C+F + KP  K  +
Sbjct:  246 AHQVVQDGYEFFASKKMVTIFSAPHYCGQFDNSAATMKVDENMVCTFVMYKPTPKSMR 303          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: Pp1-87B (gene:FBgn0004103 transcript:FBtr0082595)

HSP 1 Score: 376.326 bits (965), Expect = 2.643e-131
Identity = 173/229 (75.55%), Postives = 202/229 (88.21%), Query Frame = 2
Query:   92 INIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            +NID+II++LLEVRG +PG++V L EGEI+ LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKY ENFFLLRGNHE A+INRIYGFYDECKRRY+I+LWK FTDCFN LP AA++DEKI C HGGLSP+L S++QI+ I RP +VPD GL+CDLLWSDPD+D +GW EN+RGVS TFG++VV KF
Sbjct:    5 MNIDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKF 233          

HSP 2 Score: 112.849 bits (281), Expect = 2.643e-131
Identity = 52/58 (89.66%), Postives = 55/58 (94.83%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKKNK 981
            AHQVVEDGYEFFAKR LVT+FSAPNYCGEFDNAGAMMSVD+TLMCSFQILKPA K+ K
Sbjct:  245 AHQVVEDGYEFFAKRMLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKRKK 302          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: Pp1alpha-96A (gene:FBgn0003134 transcript:FBtr0334334)

HSP 1 Score: 374.4 bits (960), Expect = 1.566e-130
Identity = 172/229 (75.11%), Postives = 201/229 (87.77%), Query Frame = 2
Query:   92 INIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            +NID+II++LLEVRG +PG++V L E EI++LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKY ENFFLLRGNHE A+INRIYGFYDECKRRY I+LWK FTDCFN LP AA++DEKI C HGGLSP+L S++QI+ I RP +VPD GL+CDLLWSDPD+D +GW EN+RGVS TFG++VV KF
Sbjct:    5 MNIDSIISRLLEVRGARPGKNVQLSESEIRSLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYAENFFLLRGNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLSSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVGKF 233          

HSP 2 Score: 112.079 bits (279), Expect = 1.566e-130
Identity = 51/56 (91.07%), Postives = 55/56 (98.21%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKK 975
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVD+TLMCSFQILKPA K+
Sbjct:  245 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKR 300          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: Pp1alpha-96A (gene:FBgn0003134 transcript:FBtr0084642)

HSP 1 Score: 374.4 bits (960), Expect = 1.566e-130
Identity = 172/229 (75.11%), Postives = 201/229 (87.77%), Query Frame = 2
Query:   92 INIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            +NID+II++LLEVRG +PG++V L E EI++LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKY ENFFLLRGNHE A+INRIYGFYDECKRRY I+LWK FTDCFN LP AA++DEKI C HGGLSP+L S++QI+ I RP +VPD GL+CDLLWSDPD+D +GW EN+RGVS TFG++VV KF
Sbjct:    5 MNIDSIISRLLEVRGARPGKNVQLSESEIRSLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYAENFFLLRGNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLSSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVGKF 233          

HSP 2 Score: 112.079 bits (279), Expect = 1.566e-130
Identity = 51/56 (91.07%), Postives = 55/56 (98.21%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKK 975
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVD+TLMCSFQILKPA K+
Sbjct:  245 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKR 300          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: Pp1-13C (gene:FBgn0003132 transcript:FBtr0074017)

HSP 1 Score: 369.007 bits (946), Expect = 6.615e-129
Identity = 168/231 (72.73%), Postives = 200/231 (86.58%), Query Frame = 2
Query:   86 ESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            E +N+++II++LLEVRG +PG++V L EGEI+ LC K+R+I L QP  LELEAP+KICGDIHGQYYDLLRLFEYGG+PP +NYLFLGDYVDRG+QS+E I LLLAYKIKY ENFFLLRGNHE A+INRIYGFYDECKRRY I+LWK FTDCFN LP  A++DEKI C HGGLSP+L S++QI+ I RP +VPD GL+CDLLWSDPD+D +GW EN+RGVS TFG++VV KF
Sbjct:    3 EVLNLESIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREILLAQPILLELEAPLKICGDIHGQYYDLLRLFEYGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTIGWGENDRGVSFTFGAEVVVKF 233          

HSP 2 Score: 111.694 bits (278), Expect = 6.615e-129
Identity = 51/58 (87.93%), Postives = 54/58 (93.10%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKKNK 981
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVD TLMCSFQILKP  K+ K
Sbjct:  245 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDNTLMCSFQILKPVEKRKK 302          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: flw (gene:FBgn0000711 transcript:FBtr0071447)

HSP 1 Score: 363.614 bits (932), Expect = 2.590e-127
Identity = 164/229 (71.62%), Postives = 196/229 (85.59%), Query Frame = 2
Query:   92 INIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            +N+D++I +LLE+R  + G+ V + E E++ LC K+R+IFLQQP  LELEAP+ ICGDIHGQY DLLRLFEYGGFPP +NYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYN++LWK FTDCFN LP AA+IDEKI C HGGLSP+L+ ++QI+ + RP +VPD GL+CDLLWSDPD+D+ GW EN+RGVS TFG DVV KF
Sbjct:    6 LNVDSLIQRLLEMRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGVDVVSKF 234          

HSP 2 Score: 112.079 bits (279), Expect = 2.590e-127
Identity = 52/71 (73.24%), Postives = 61/71 (85.92%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKKNKFFDVLKKHASARP 1020
            AHQVVEDGYEFFA+R+LVT+FSAPNYCGEFDNAG MM+VD+TLMCSFQILKP+ KK K+  +     S+RP
Sbjct:  246 AHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVDDTLMCSFQILKPSEKKAKY--LYSGMNSSRP 314          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp1cab (protein phosphatase 1, catalytic subunit, alpha isozyme b [Source:ZFIN;Acc:ZDB-GENE-030131-5512])

HSP 1 Score: 381.333 bits (978), Expect = 2.486e-133
Identity = 173/235 (73.62%), Postives = 206/235 (87.66%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M  ++ INID+II +LLEV+G +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGD+HGQYYDLLRLFEYGG+PP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ + RP +VPD GL+CDLLW+DPD+D++GW EN+RGVS TFGSDVV KF
Sbjct:    1 MAESDKINIDSIIQRLLEVKGSRPGKNVQLTEQEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGYPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQIRRVMRPTDVPDQGLLCDLLWADPDKDVMGWGENDRGVSFTFGSDVVAKF 235          

HSP 2 Score: 114.775 bits (286), Expect = 2.486e-133
Identity = 55/71 (77.46%), Postives = 60/71 (84.51%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKKNKFFDVLKKHASARP 1020
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA KK   +       ++RP
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKVLSYGGAGGFGNSRP 317          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp1caa (protein phosphatase 1, catalytic subunit, alpha isozyme a [Source:ZFIN;Acc:ZDB-GENE-040516-3])

HSP 1 Score: 378.252 bits (970), Expect = 3.560e-132
Identity = 170/235 (72.34%), Postives = 205/235 (87.23%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M   + +NID+II +LLEV+G +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGD+HGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYK+KYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++Q++ + RP +VPD GL+CDLLW+DPD+D++GW EN+RGVS TFG+DVV KF
Sbjct:    1 MAEPDKLNIDSIIQRLLEVKGSRPGKNVQLTESEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQVRRVMRPTDVPDQGLLCDLLWADPDKDVLGWGENDRGVSFTFGADVVAKF 235          

HSP 2 Score: 114.005 bits (284), Expect = 3.560e-132
Identity = 53/56 (94.64%), Postives = 55/56 (98.21%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKK 975
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA KK
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK 302          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: CABZ01076667.1 (protein phosphatase 1, catalytic subunit, gamma isozyme [Source:NCBI gene;Acc:571753])

HSP 1 Score: 377.867 bits (969), Expect = 3.743e-132
Identity = 173/235 (73.62%), Postives = 205/235 (87.23%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M   + +NID+II +LLEVRG +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGG+PP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDEC+RRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D++GW EN+RGVS TFG++VV KF
Sbjct:    1 MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGYPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECRRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKF 235          

HSP 2 Score: 114.39 bits (285), Expect = 3.743e-132
Identity = 53/56 (94.64%), Postives = 55/56 (98.21%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKK 975
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA KK
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKK 302          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-030616-609])

HSP 1 Score: 371.703 bits (953), Expect = 8.409e-130
Identity = 169/229 (73.80%), Postives = 201/229 (87.77%), Query Frame = 2
Query:   92 INIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            +N+D++I++LLEVRG +PG+ V + E E++ LC K+R+IFL QP  LELEAP+KICGDIHGQY DLLRLFEYGGFPP +NYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRR+NI+LWK FTDCFN LP AA+IDEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D+ GW EN+RGVS TFG+DVV KF
Sbjct:    6 LNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKF 234          

HSP 2 Score: 112.849 bits (281), Expect = 8.409e-130
Identity = 51/59 (86.44%), Postives = 56/59 (94.92%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKKNKF 984
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAG MMSVDE+LMCSFQILKP+ KK K+
Sbjct:  246 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDESLMCSFQILKPSEKKAKY 304          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp1caa (protein phosphatase 1, catalytic subunit, alpha isozyme a [Source:ZFIN;Acc:ZDB-GENE-040516-3])

HSP 1 Score: 359.762 bits (922), Expect = 1.227e-126
Identity = 161/223 (72.20%), Postives = 194/223 (87.00%), Query Frame = 2
Query:  110 IAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            +  L  ++G +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGD+HGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYK+KYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++Q++ + RP +VPD GL+CDLLW+DPD+D++GW EN+RGVS TFG+DVV KF
Sbjct:    9 LKSLHNLKGSRPGKNVQLTESEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQVRRVMRPTDVPDQGLLCDLLWADPDKDVLGWGENDRGVSFTFGADVVAKF 231          

HSP 2 Score: 114.005 bits (284), Expect = 1.227e-126
Identity = 53/56 (94.64%), Postives = 55/56 (98.21%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKK 975
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA KK
Sbjct:  243 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK 298          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp1cc (protein phosphatase 1, catalytic subunit, gamma isozyme [Source:NCBI gene;Acc:407879])

HSP 1 Score: 380.563 bits (976), Expect = 8.705e-133
Identity = 175/235 (74.47%), Postives = 205/235 (87.23%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M   + +NID+II +LLEVRG +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D++GW EN+RGVS TFG++VV KF
Sbjct:    1 MADVDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKF 235          

HSP 2 Score: 114.39 bits (285), Expect = 8.705e-133
Identity = 53/56 (94.64%), Postives = 55/56 (98.21%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKK 975
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA KK
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKK 302          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:NCBI gene;Acc:496958])

HSP 1 Score: 370.163 bits (949), Expect = 1.440e-129
Identity = 168/229 (73.36%), Postives = 201/229 (87.77%), Query Frame = 2
Query:   92 INIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            +N+D++I++LLEVRG +PG+ V + E E++ LC K+R+IFL QP  LELEAP+KICGDIHGQY DLLRLFEYGGFPP +NYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRR+NI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D+ GW EN+RGVS TFG+DVV KF
Sbjct:    6 LNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKF 234          

HSP 2 Score: 114.005 bits (284), Expect = 1.440e-129
Identity = 52/59 (88.14%), Postives = 56/59 (94.92%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKKNKF 984
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAG MMSVDETLMCSFQILKP+ KK K+
Sbjct:  246 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKY 304          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp1cc (protein phosphatase 1, catalytic subunit, gamma isozyme [Source:NCBI gene;Acc:407879])

HSP 1 Score: 361.303 bits (926), Expect = 5.839e-127
Identity = 165/218 (75.69%), Postives = 193/218 (88.53%), Query Frame = 2
Query:  125 EVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            ++RG +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D++GW EN+RGVS TFG++VV KF
Sbjct:    6 QLRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKF 223          

HSP 2 Score: 114.005 bits (284), Expect = 5.839e-127
Identity = 53/56 (94.64%), Postives = 55/56 (98.21%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKK 975
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA KK
Sbjct:  235 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKK 290          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp1cc (protein phosphatase 1, catalytic subunit, gamma isozyme [Source:NCBI gene;Acc:407879])

HSP 1 Score: 360.918 bits (925), Expect = 8.488e-127
Identity = 166/223 (74.44%), Postives = 194/223 (87.00%), Query Frame = 2
Query:  110 IAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            I  L ++ G +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D++GW EN+RGVS TFG++VV KF
Sbjct:   11 ICDLKKLSGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKF 233          

HSP 2 Score: 114.005 bits (284), Expect = 8.488e-127
Identity = 53/56 (94.64%), Postives = 55/56 (98.21%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKK 975
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA KK
Sbjct:  245 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKK 300          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp1cc (protein phosphatase 1, catalytic subunit, gamma isozyme [Source:NCBI gene;Acc:407879])

HSP 1 Score: 359.377 bits (921), Expect = 2.227e-126
Identity = 165/216 (76.39%), Postives = 191/216 (88.43%), Query Frame = 2
Query:  131 RGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            RG +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D++GW EN+RGVS TFG++VV KF
Sbjct:   26 RGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKF 241          

HSP 2 Score: 114.39 bits (285), Expect = 2.227e-126
Identity = 53/56 (94.64%), Postives = 55/56 (98.21%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKK 975
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA KK
Sbjct:  253 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKK 308          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp1cc (protein phosphatase 1 catalytic subunit gamma [Source:MGI Symbol;Acc:MGI:104872])

HSP 1 Score: 380.178 bits (975), Expect = 6.867e-133
Identity = 175/235 (74.47%), Postives = 205/235 (87.23%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M   + +NID+II +LLEVRG +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D++GW EN+RGVS TFG++VV KF
Sbjct:    1 MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKF 235          

HSP 2 Score: 114.39 bits (285), Expect = 6.867e-133
Identity = 53/56 (94.64%), Postives = 55/56 (98.21%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKK 975
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA KK
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKK 302          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp1cc (protein phosphatase 1 catalytic subunit gamma [Source:MGI Symbol;Acc:MGI:104872])

HSP 1 Score: 379.793 bits (974), Expect = 9.500e-133
Identity = 175/235 (74.47%), Postives = 205/235 (87.23%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M   + +NID+II +LLEVRG +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D++GW EN+RGVS TFG++VV KF
Sbjct:    1 MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKF 235          

HSP 2 Score: 114.39 bits (285), Expect = 9.500e-133
Identity = 53/56 (94.64%), Postives = 55/56 (98.21%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKK 975
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA KK
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKK 302          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp1ca (protein phosphatase 1 catalytic subunit alpha [Source:MGI Symbol;Acc:MGI:103016])

HSP 1 Score: 379.022 bits (972), Expect = 1.743e-132
Identity = 173/235 (73.62%), Postives = 206/235 (87.66%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M+ +E +N+D+II +LLEV+G +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKI+YPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D+ GW EN+RGVS TFG++VV KF
Sbjct:    1 MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIRYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKF 235          

HSP 2 Score: 114.39 bits (285), Expect = 1.743e-132
Identity = 56/72 (77.78%), Postives = 60/72 (83.33%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVK-KNKFFDVLKKHASARP 1020
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA K K K+      +   RP
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRP 318          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp1ca (protein phosphatase 1 catalytic subunit alpha [Source:MGI Symbol;Acc:MGI:103016])

HSP 1 Score: 379.022 bits (972), Expect = 1.743e-132
Identity = 173/235 (73.62%), Postives = 206/235 (87.66%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M+ +E +N+D+II +LLEV+G +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKI+YPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D+ GW EN+RGVS TFG++VV KF
Sbjct:    1 MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIRYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKF 235          

HSP 2 Score: 114.39 bits (285), Expect = 1.743e-132
Identity = 56/72 (77.78%), Postives = 60/72 (83.33%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVK-KNKFFDVLKKHASARP 1020
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA K K K+      +   RP
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRP 318          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp1cc (protein phosphatase 1 catalytic subunit gamma [Source:MGI Symbol;Acc:MGI:104872])

HSP 1 Score: 378.252 bits (970), Expect = 3.849e-131
Identity = 175/235 (74.47%), Postives = 205/235 (87.23%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M   + +NID+II +LLEVRG +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D++GW EN+RGVS TFG++VV KF
Sbjct:    1 MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKF 235          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|Q6NVU2|PPIG_XENTR (Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Xenopus tropicalis OX=8364 GN=ppp1cc PE=2 SV=1)

HSP 1 Score: 380.563 bits (976), Expect = 3.521e-132
Identity = 175/235 (74.47%), Postives = 205/235 (87.23%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M   + +NID+II +LLEVRG +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D++GW EN+RGVS TFG++VV KF
Sbjct:    1 MADVDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKF 235          

HSP 2 Score: 114.39 bits (285), Expect = 3.521e-132
Identity = 53/56 (94.64%), Postives = 55/56 (98.21%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKK 975
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA KK
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKK 302          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|P36874|PP1GA_XENLA (Serine/threonine-protein phosphatase PP1-gamma catalytic subunit A OS=Xenopus laevis OX=8355 GN=ppp1cc-a PE=1 SV=2)

HSP 1 Score: 380.563 bits (976), Expect = 3.521e-132
Identity = 175/235 (74.47%), Postives = 205/235 (87.23%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M   + +NID+II +LLEVRG +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D++GW EN+RGVS TFG++VV KF
Sbjct:    1 MADVDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKF 235          

HSP 2 Score: 114.39 bits (285), Expect = 3.521e-132
Identity = 53/56 (94.64%), Postives = 55/56 (98.21%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKK 975
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA KK
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKK 302          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|P62138|PP1A_RAT (Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Rattus norvegicus OX=10116 GN=Ppp1ca PE=1 SV=1)

HSP 1 Score: 380.563 bits (976), Expect = 3.763e-132
Identity = 174/235 (74.04%), Postives = 206/235 (87.66%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M+ +E +N+D+II +LLEV+G +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D+ GW EN+RGVS TFG++VV KF
Sbjct:    1 MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKF 235          

HSP 2 Score: 114.39 bits (285), Expect = 3.763e-132
Identity = 56/72 (77.78%), Postives = 60/72 (83.33%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVK-KNKFFDVLKKHASARP 1020
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA K K K+      +   RP
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRP 318          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|P62139|PP1A_RABIT (Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Oryctolagus cuniculus OX=9986 GN=PPP1CA PE=1 SV=1)

HSP 1 Score: 380.563 bits (976), Expect = 3.763e-132
Identity = 174/235 (74.04%), Postives = 206/235 (87.66%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M+ +E +N+D+II +LLEV+G +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D+ GW EN+RGVS TFG++VV KF
Sbjct:    1 MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKF 235          

HSP 2 Score: 114.39 bits (285), Expect = 3.763e-132
Identity = 56/72 (77.78%), Postives = 60/72 (83.33%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVK-KNKFFDVLKKHASARP 1020
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA K K K+      +   RP
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRP 318          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|P62136|PP1A_HUMAN (Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CA PE=1 SV=1)

HSP 1 Score: 380.563 bits (976), Expect = 3.763e-132
Identity = 174/235 (74.04%), Postives = 206/235 (87.66%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M+ +E +N+D+II +LLEV+G +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D+ GW EN+RGVS TFG++VV KF
Sbjct:    1 MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKF 235          

HSP 2 Score: 114.39 bits (285), Expect = 3.763e-132
Identity = 56/72 (77.78%), Postives = 60/72 (83.33%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVK-KNKFFDVLKKHASARP 1020
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA K K K+      +   RP
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRP 318          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A1J8R1U3 (Serine/threonine-protein phosphatase OS=Rhizopogon vesiculosus OX=180088 GN=AZE42_05907 PE=3 SV=1)

HSP 1 Score: 393.66 bits (1010), Expect = 2.113e-135
Identity = 172/234 (73.50%), Postives = 202/234 (86.32%), Query Frame = 2
Query:   77 NTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            ++   I++D++I +LLEVRG +PG+ V L E EIK LC KAR+IF+ QP  LELEAPIKICGDIHGQYYDLLRLFEYGGFPP +NYLFLGDYVDRG+QS+E I LLLAYKIKYPENFF+LRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA+IDEKI   HGGLSP+L+S++QI+ + RP +VPD GL+CDLLWSDPD+DI GW+EN+RGVS TFG DVV +F
Sbjct:  873 DSQTEIDLDSVIDRLLEVRGNRPGKPVQLQEYEIKYLCTKAREIFINQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDLQSMEQIRRVMRPTDVPDTGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRF 1106          

HSP 2 Score: 119.783 bits (299), Expect = 2.113e-135
Identity = 53/59 (89.83%), Postives = 56/59 (94.92%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKKNKF 984
            AHQVVEDGYEFFAKR LVT+FSAPNYCGEFDNAGAMMSVDETL+CSFQILKPA KK K+
Sbjct: 1118 AHQVVEDGYEFFAKRHLVTLFSAPNYCGEFDNAGAMMSVDETLLCSFQILKPAEKKAKY 1176          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: T1KMY8 (Serine/threonine-protein phosphatase OS=Tetranychus urticae OX=32264 GN=107365638 PE=3 SV=1)

HSP 1 Score: 390.963 bits (1003), Expect = 2.452e-134
Identity = 179/233 (76.82%), Postives = 206/233 (88.41%), Query Frame = 2
Query:   80 TNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
             NE +NID+IIA+LLEVRG +PG++V L E EIK LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L S++QI+ I RP +VPD GL+CDLLWSDPD+D++GW EN+RGVS+TFG+DVV KF
Sbjct:    5 ANEQLNIDSIIARLLEVRGSKPGKNVQLSEAEIKGLCIKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLHSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVMGWGENDRGVSYTFGADVVAKF 237          

HSP 2 Score: 118.627 bits (296), Expect = 2.452e-134
Identity = 56/70 (80.00%), Postives = 61/70 (87.14%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKKNKFFDVLKKHASAR 1017
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA KK   +  + K  S+R
Sbjct:  249 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFTYTAMNKSRSSR 318          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: C5LJH8 (Serine/threonine-protein phosphatase OS=Perkinsus marinus (strain ATCC 50983 / TXsc) OX=423536 GN=Pmar_PMAR023219 PE=3 SV=1)

HSP 1 Score: 389.037 bits (998), Expect = 2.942e-133
Identity = 178/231 (77.06%), Postives = 204/231 (88.31%), Query Frame = 2
Query:   77 NTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVV 769
            +T ESI++D II KLLEVRG +PG+ V L +GEI+ALC K+R IFL+QP  LELEAPIKICGD+HGQYYDLLRLFEYGGFPP +NYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWKIFTDCFN LP AA++DEKI+C HGGLSPEL S+ QIK I RP +VPD GL+CDLLWSDP++DI GW EN+RGVS TFG+D+V
Sbjct:    7 STVESIDVDAIIEKLLEVRGCRPGKGVQLSDGEIRALCNKSRQIFLEQPNLLELEAPIKICGDVHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKIFTDCFNCLPVAAIVDEKILCMHGGLSPELNSMDQIKRILRPTDVPDTGLLCDLLWSDPEQDISGWGENDRGVSFTFGADIV 237          

HSP 2 Score: 117.087 bits (292), Expect = 2.942e-133
Identity = 53/59 (89.83%), Postives = 56/59 (94.92%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKKNKF 984
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQ+LKP  KK KF
Sbjct:  252 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQVLKPVEKKKKF 310          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A1B0YZ16 (Serine/threonine-protein phosphatase OS=Limulus polyphemus OX=6850 PE=2 SV=1)

HSP 1 Score: 386.341 bits (991), Expect = 4.939e-133
Identity = 175/235 (74.47%), Postives = 207/235 (88.09%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M  ++ +NID+IIA+LLEVRG +PG++V L E E++ LC K+R+IFL QP  LELEAP+KICGD+HGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D++GW EN+RGVS TFG+DVV KF
Sbjct:    1 MADSDKLNIDSIIARLLEVRGCRPGKTVQLSEAEVRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVMGWGENDRGVSFTFGADVVSKF 235          

HSP 2 Score: 119.013 bits (297), Expect = 4.939e-133
Identity = 58/71 (81.69%), Postives = 63/71 (88.73%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKKNKFFDVLKKHASARP 1020
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA KKN  +   K  +S+RP
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKNSPYG--KMASSSRP 315          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A087TYI9 (Serine/threonine-protein phosphatase (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_05012 PE=3 SV=1)

HSP 1 Score: 389.037 bits (998), Expect = 5.421e-132
Identity = 178/235 (75.74%), Postives = 208/235 (88.51%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M   E +NID+IIA+LLEVRG +PG++V L E EI+ALC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D++GW EN+RGVS+TFG+D+V KF
Sbjct:    1 MADTEKLNIDSIIARLLEVRGSRPGKNVQLSEAEIRALCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSYTFGADIVGKF 235          

HSP 2 Score: 112.849 bits (281), Expect = 5.421e-132
Identity = 52/56 (92.86%), Postives = 55/56 (98.21%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKK 975
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVD+TLMCSFQILKPA KK
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKK 302          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp1cab (serine/threonine-protein phosphatase alpha-2 isoform [Source:NCBI gene;Acc:103034518])

HSP 1 Score: 383.645 bits (984), Expect = 1.257e-134
Identity = 173/235 (73.62%), Postives = 207/235 (88.09%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M  ++ +NID+II +LLEV+G +PG++V L EGEI+ LC K+R+IFL QP  LELEAP+KICGD+HGQYYDLLRLFEYGG+PP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ + RP +VPD GL+CDLLW+DPD+D++GW EN+RGVS TFGSDVV KF
Sbjct:    1 MTESDKLNIDSIIQRLLEVKGSRPGKNVQLTEGEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGYPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQIRRVMRPTDVPDQGLLCDLLWADPDKDVMGWGENDRGVSFTFGSDVVAKF 235          

HSP 2 Score: 116.701 bits (291), Expect = 1.257e-134
Identity = 56/71 (78.87%), Postives = 59/71 (83.10%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKKNKFFDVLKKHASARP 1020
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA KK   +       S RP
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKLLSYSGAGGFGSGRP 317          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp1cab (serine/threonine-protein phosphatase alpha-2 isoform [Source:NCBI gene;Acc:103034518])

HSP 1 Score: 382.104 bits (980), Expect = 9.309e-133
Identity = 173/235 (73.62%), Postives = 207/235 (88.09%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M  ++ +NID+II +LLEV+G +PG++V L EGEI+ LC K+R+IFL QP  LELEAP+KICGD+HGQYYDLLRLFEYGG+PP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ + RP +VPD GL+CDLLW+DPD+D++GW EN+RGVS TFGSDVV KF
Sbjct:    1 MTESDKLNIDSIIQRLLEVKGSRPGKNVQLTEGEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGYPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQIRRVMRPTDVPDQGLLCDLLWADPDKDVMGWGENDRGVSFTFGSDVVAKF 235          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp1caa (serine/threonine-protein phosphatase alpha-2 isoform-like [Source:NCBI gene;Acc:103034594])

HSP 1 Score: 378.252 bits (970), Expect = 3.394e-132
Identity = 170/235 (72.34%), Postives = 205/235 (87.23%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M   + +NID+II +LLEV+G +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGD+HGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYK+KYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++Q++ + RP +VPD GL+CDLLW+DPD+D++GW EN+RGVS TFG+DVV KF
Sbjct:    1 MAEPDKLNIDSIIQRLLEVKGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQVRRVMRPTDVPDQGLLCDLLWADPDKDVLGWGENDRGVSFTFGADVVAKF 235          

HSP 2 Score: 114.005 bits (284), Expect = 3.394e-132
Identity = 53/56 (94.64%), Postives = 55/56 (98.21%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKK 975
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA KK
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK 302          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ENSAMXT00000007129.2 (protein phosphatase 1 catalytic subunit gamma [Source:NCBI gene;Acc:103037187])

HSP 1 Score: 375.17 bits (962), Expect = 1.172e-131
Identity = 172/235 (73.19%), Postives = 204/235 (86.81%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M   + +NID+II +LLEVRG +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGG+PP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDEC+RRYNI+LWK FTDCFN LP AA++D KI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D++GW EN+RGVS TFG++VV KF
Sbjct:    1 MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGYPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECRRRYNIKLWKTFTDCFNCLPIAAIVDGKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKF 235          

HSP 2 Score: 115.161 bits (287), Expect = 1.172e-131
Identity = 57/71 (80.28%), Postives = 60/71 (84.51%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKKNKFFDVLKKHASARP 1020
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA K        KK  S+RP
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEK--------KKPNSSRP 309          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp1cb (serine/threonine-protein phosphatase PP1-beta catalytic subunit-like [Source:NCBI gene;Acc:103030509])

HSP 1 Score: 371.703 bits (953), Expect = 6.565e-130
Identity = 169/233 (72.53%), Postives = 201/233 (86.27%), Query Frame = 2
Query:   80 TNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
                +N+D++I++LLEVRG +PG+ V + E E++ LC K+R+IFL QP  LELEAP+KICGDIHGQY DLLRLFEYGGFPP +NYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRR+NI+LWK FTDCFN LP AA+IDEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D+ GW EN+RGVS TFG+DVV KF
Sbjct:    2 AESELNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKF 234          

HSP 2 Score: 112.849 bits (281), Expect = 6.565e-130
Identity = 51/59 (86.44%), Postives = 56/59 (94.92%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKKNKF 984
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAG MMSVDE+LMCSFQILKP+ KK K+
Sbjct:  246 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDESLMCSFQILKPSEKKAKY 304          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp1cab (protein phosphatase 1, catalytic subunit, alpha isozyme b [Source:ZFIN;Acc:ZDB-GENE-030131-5512])

HSP 1 Score: 357.451 bits (916), Expect = 1.118e-126
Identity = 167/217 (76.96%), Postives = 192/217 (88.48%), Query Frame = 2
Query:  128 VRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            VRG +PG++V L EGEI+ LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D +GW EN+RGVS TFG++VV KF
Sbjct:    1 VRGSRPGKNVQLTEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHE-ASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKF 216          

HSP 2 Score: 113.62 bits (283), Expect = 1.118e-126
Identity = 53/56 (94.64%), Postives = 55/56 (98.21%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKK 975
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA KK
Sbjct:  228 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK 283          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-030616-609])

HSP 1 Score: 355.14 bits (910), Expect = 1.066e-123
Identity = 164/221 (74.21%), Postives = 192/221 (86.88%), Query Frame = 2
Query:  116 KLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            +L  VRG +PG++V + E E++ LC K+R+IFL QP  LELEAP+KICGDIHGQY DLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRR+NI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D+ GW EN+RGVS TFG+DVV KF
Sbjct:    1 RLPTVRGCRPGKTVHMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKF 221          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010086.1 (pep scaffold:Pmarinus_7.0:GL479411:90249:92178:-1 gene:ENSPMAG00000009123.1 transcript:ENSPMAT00000010086.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 292.352 bits (747), Expect = 5.170e-107
Identity = 136/176 (77.27%), Postives = 154/176 (87.50%), Query Frame = 2
Query:  260 GDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDD---GLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            GDIHGQY DLLRLFEYGGFPP +NYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRR+NI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ I RP +VPD    GL+CDLLWSDPD+D+ GW EN+RGVS TFG DVV KF
Sbjct:    1 GDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGDAGLLCDLLWSDPDKDVQGWGENDRGVSFTFGGDVVSKF 176          

HSP 2 Score: 113.62 bits (283), Expect = 5.170e-107
Identity = 52/59 (88.14%), Postives = 56/59 (94.92%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKKNKF 984
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAG MMSVDETLMCSFQILKP+ KK K+
Sbjct:  188 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKY 246          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005085.1 (pep scaffold:Pmarinus_7.0:GL481040:2845:3652:-1 gene:ENSPMAG00000004627.1 transcript:ENSPMAT00000005085.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 205.297 bits (521), Expect = 4.044e-66
Identity = 96/124 (77.42%), Postives = 109/124 (87.90%), Query Frame = 2
Query:  116 KLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYD 487
             +  VRG +PG++V + E E++ALC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYD
Sbjct:   11 SMYAVRGSRPGKTVHMSEAEVRALCIKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYD 134          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005238.1 (pep scaffold:Pmarinus_7.0:GL487052:8065:11513:-1 gene:ENSPMAG00000004764.1 transcript:ENSPMAT00000005238.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 180.644 bits (457), Expect = 5.647e-56
Identity = 79/157 (50.32%), Postives = 112/157 (71.34%), Query Frame = 2
Query:  194 KARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRY-NIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVP 661
            +A++I  ++    E+  P+ +CGD+HGQ++DL+ LF  GG  P +NYLF+GDYVDRG  S+E ++LL+A K++Y E   +LRGNHES  I ++YGFYDEC R+Y N  +WK FTD F+ LP  AL+D +I C HGGLSP + +L  I+ + R +EVP
Sbjct:   14 QAKEILTKESNVQEVRCPVTVCGDVHGQFHDLIELFNIGGKSPDTNYLFMGDYVDRGYYSVETVSLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDFLPLTALVDRQIFCLHGGLSPSIDTLDHIRALDRLQEVP 170          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: GLC7 (Type 1 S/T protein phosphatase (PP1) catalytic subunit; involved in glycogen metabolism, sporulation and mitotic progression; interacts with multiple regulatory subunits; regulates actomyosin ring formation; subunit of CPF; recruited to mating projections by Afr1p interaction; regulates nucleocytoplasmic shuttling of Hxk2p; import into the nucleus is inhibited during spindle assembly checkpoint arrest; involved in dephosphorylating Rps6a/b and Bnr1p [Source:SGD;Acc:S000000935])

HSP 1 Score: 376.326 bits (965), Expect = 4.551e-131
Identity = 173/232 (74.57%), Postives = 203/232 (87.50%), Query Frame = 2
Query:   83 NESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            ++ +++D II +LLEVRG +PG+ V L E EI+ LC KAR IF++QP  LELEAPIKICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFF+LRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA+IDEKI C HGGLSP+L S++QI+ + RP ++PD GL+CDLLWSDPD+DIVGW+EN+RGVS TFG DVV++F
Sbjct:    3 SQPVDVDNIIDRLLEVRGSKPGQQVDLEENEIRYLCSKARSIFIKQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPDLNSMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSENDRGVSFTFGPDVVNRF 234          

HSP 2 Score: 109.383 bits (272), Expect = 4.551e-131
Identity = 52/70 (74.29%), Postives = 58/70 (82.86%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKKNKFFDVLKKHASAR 1017
            AHQVVEDGYEFF+KR+LVT+FSAPNYCGEFDNAGAMMSVDE+L+CSFQILKPA K       L + A  R
Sbjct:  246 AHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAQKS------LPRQAGGR 309          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPZ1 (Serine/threonine protein phosphatase Z, isoform of Ppz2p; involved in regulation of potassium transport, which affects osmotic stability, cell cycle progression, and halotolerance [Source:SGD;Acc:S000004478])

HSP 1 Score: 293.123 bits (749), Expect = 1.997e-100
Identity = 138/230 (60.00%), Postives = 166/230 (72.17%), Query Frame = 2
Query:   92 INIDTIIAKLLEV-RGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            I+ID  I KLL+     +  ++V L   EI  +C KAR+IFL QP  LEL  P+KI GD+HGQY DLLRLF   GFPP+SNYLFLGDYVDRG+QS+E I LL  YKIKYPENFFLLRGNHE A + R+YGFYDECKRR NI++WK F D FN LP AA++  KI C HGGLSP L S+ +I+ + RP +VPD GLI DLLWSDP      W +NERGVS+ +    ++KF
Sbjct:  361 IDIDETIQKLLDAGYAAKRTKNVCLKNNEILQICIKAREIFLSQPSLLELSPPVKIVGDVHGQYGDLLRLFTKCGFPPSSNYLFLGDYVDRGKQSLETILLLFCYKIKYPENFFLLRGNHECANVTRVYGFYDECKRRCNIKIWKTFIDTFNTLPLAAIVAGKIFCVHGGLSPVLNSMDEIRHVVRPTDVPDFGLINDLLWSDPTDSPNEWEDNERGVSYCYNKVAINKF 590          

HSP 2 Score: 90.1225 bits (222), Expect = 1.997e-100
Identity = 39/52 (75.00%), Postives = 44/52 (84.62%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKP 963
            AH VVEDGYEFF  R LVT+FSAPNYCGEFDN GA+MSV E L+CSF++L P
Sbjct:  602 AHMVVEDGYEFFNDRSLVTVFSAPNYCGEFDNWGAVMSVSEGLLCSFELLDP 653          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPZ2 (Serine/threonine protein phosphatase Z, isoform of Ppz1p; involved in regulation of potassium transport, which affects osmotic stability, cell cycle progression, and halotolerance [Source:SGD;Acc:S000002844])

HSP 1 Score: 290.812 bits (743), Expect = 6.552e-100
Identity = 136/230 (59.13%), Postives = 167/230 (72.61%), Query Frame = 2
Query:   92 INIDTIIAKLLEVR-GGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            ++ID II +LL+     +  ++V L   EI  +C+KAR++FL QP  LEL   +KI GD+HGQY DLLRLF   GFPP +NYLFLGDYVDRG+QS+E I LLL YKIKYPENFFLLRGNHE A + R+YGFYDECKRR NI++WK F D FN LP AA++  KI C HGGLSP L S+ +I+ +SRP +VPD GLI DLLWSDP      W +NERGVS  +    ++KF
Sbjct:  396 VDIDEIIQRLLDAGYAAKRTKNVCLKNSEIIQICHKARELFLAQPALLELSPSVKIVGDVHGQYADLLRLFTKCGFPPMANYLFLGDYVDRGKQSLETILLLLCYKIKYPENFFLLRGNHECANVTRVYGFYDECKRRCNIKIWKTFVDTFNTLPLAAIVTGKIFCVHGGLSPVLNSMDEIRHVSRPTDVPDFGLINDLLWSDPTDSSNEWEDNERGVSFCYNKVAINKF 625          

HSP 2 Score: 90.8929 bits (224), Expect = 6.552e-100
Identity = 42/70 (60.00%), Postives = 50/70 (71.43%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKKNKFFDVLKKHASAR 1017
            AH VVEDGYEFF  R LVT+FSAPNYCGEFDN GA+M+V E L+CSF++L P +       V+KK    R
Sbjct:  637 AHMVVEDGYEFFNDRSLVTVFSAPNYCGEFDNWGAVMTVSEGLLCSFELLDP-LDSTALKQVMKKGRQER 705          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPQ1 (Protein phosphatase that regulates the mating response; negatively regulates the MAP kinase signaling cascade during mating; member of the serine/threonine phosphatase PP1 family [Source:SGD;Acc:S000006100])

HSP 1 Score: 286.574 bits (732), Expect = 4.395e-98
Identity = 128/240 (53.33%), Postives = 173/240 (72.08%), Query Frame = 2
Query:   77 NTNESINIDTIIAKLL------EVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            ++NE ++ID  I KLL      E+      ++      EI+ +CY AR+IFL QP  L L+APIK+ GD+HGQ+ DLLR+ +  G P  +NYLFLGDYVDRG+ S+E I LLL YKIKY +NFF+LRGNHESA + ++YGFYDECKRR + ++WK+F D FN LP AA+I +KI C HGG+SP+L  +KQI++++RP ++P+ GL+ DLLWSDPD  +  W+EN+RGVS+TF    V  F
Sbjct:  233 SSNEGLDIDVAIEKLLQVGESREITKTSKKKNFPFHSWEIQLICYHAREIFLNQPTLLRLQAPIKVVGDVHGQFNDLLRILKLSGVPSDTNYLFLGDYVDRGKNSLETILLLLCYKIKYKDNFFMLRGNHESANVTKMYGFYDECKRRLSSKVWKMFVDVFNTLPLAAIIQDKIFCVHGGISPDLHDMKQIEKVARPTDIPESGLVTDLLWSDPDPQVTDWSENDRGVSYTFSKRNVLDF 472          

HSP 2 Score: 88.9669 bits (219), Expect = 4.395e-98
Identity = 38/52 (73.08%), Postives = 44/52 (84.62%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKP 963
             H VVEDGYEFFA++K VTIFSAPNYCGEF N GA+MSV   +MCSF++LKP
Sbjct:  484 GHMVVEDGYEFFARKKFVTIFSAPNYCGEFHNWGAVMSVTTGMMCSFELLKP 535          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPH21 (Catalytic subunit of protein phosphatase 2A (PP2A); functionally redundant with Pph22p; methylated at C terminus; forms alternate complexes with several regulatory subunits; involved in signal transduction and regulation of mitosis; forms nuclear foci upon DNA replication stress; PPH21 has a paralog, PPH22, that arose from the whole genome duplication [Source:SGD;Acc:S000002292])

HSP 1 Score: 226.098 bits (575), Expect = 2.923e-71
Identity = 103/207 (49.76%), Postives = 143/207 (69.08%), Query Frame = 2
Query:  161 LGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRY-NIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            L E ++  LC  A D+   +     +  P+ ICGD+HGQ++DLL LF+ GG  P +NYLF+GDYVDRG  S+E ++ L+A K++YP    +LRGNHES  I ++YGFYDEC R+Y +  +WK+FTD F+  P  AL+D KI C HGGLSP + ++ Q++E++R +EVP +G +CDLLWSDPD D  GW  + RG   TFG DV ++F
Sbjct:   83 LSEDDVARLCKMAVDVLQFEENVKPINVPVTICGDVHGQFHDLLELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPITALVDNKIFCLHGGLSPMIETIDQVRELNRIQEVPHEGPMCDLLWSDPD-DRGGWGISPRGAGFTFGQDVSEQF 288          

HSP 2 Score: 52.373 bits (124), Expect = 5.354e-8
Identity = 25/55 (45.45%), Postives = 34/55 (61.82%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVK 972
            AHQ+V +GY +  ++ +VTIFSAPNYC    N  A+M VDE     F    P+V+
Sbjct:  300 AHQLVMEGYAWSHQQNVVTIFSAPNYCYRCGNQAAIMEVDENHNRQFLQYDPSVR 354          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO44648 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RVJ0])

HSP 1 Score: 380.178 bits (975), Expect = 2.704e-133
Identity = 175/235 (74.47%), Postives = 204/235 (86.81%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M   E +N+D+II++LLEVRG +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D+ GW EN+RGVS TFG D+V KF
Sbjct:    1 MAEPEKLNVDSIISRLLEVRGSRPGKNVQLTEAEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAILDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGPDIVAKF 235          

HSP 2 Score: 114.005 bits (284), Expect = 2.704e-133
Identity = 53/56 (94.64%), Postives = 55/56 (98.21%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKK 975
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA KK
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK 302          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO29759 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7T2Q5])

HSP 1 Score: 237.654 bits (605), Expect = 4.530e-76
Identity = 111/227 (48.90%), Postives = 152/227 (66.96%), Query Frame = 2
Query:  101 DTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRY-NIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            D   AK LEV   Q      L E ++K LC KA++I  ++    E++ P+ +CGD+HGQ++DL+ LF  GG  P +NYLF+GDYVDRG  S+E +TLL+  K+++P    +LRGNHES  I ++YGFYDEC R+Y N  +WK FTD F+ LP  AL+D +I C HGGLSP + +L  I+ + R +EVP +G +CDLLWSDPD D  GW  + RG  +TFG D+ + F
Sbjct:    4 DKTTAKDLEVWIEQLMECKQLTEAQVKTLCEKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVTLKVRFPHRICILRGNHESRQITQVYGFYDECLRKYGNASVWKYFTDLFDYLPLTALVDNQIFCLHGGLSPSIDTLDHIRALDRIQEVPHEGPMCDLLWSDPD-DRGGWGISPRGAGYTFGQDISETF 229          

HSP 2 Score: 56.225 bits (134), Expect = 5.778e-9
Identity = 26/58 (44.83%), Postives = 36/58 (62.07%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKKNK 981
            AHQ+V +GY +   R +VTIFSAPNYC    N  A+M +D+ L  SF    PA ++ +
Sbjct:  241 AHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDALKYSFLQFDPAPRRGE 298          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO49936 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RFC7])

HSP 1 Score: 230.335 bits (586), Expect = 3.554e-73
Identity = 105/208 (50.48%), Postives = 149/208 (71.63%), Query Frame = 2
Query:  158 LLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRY-NIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            L+ E E+K LC KAR+I +++     +++P+ +CGDIHGQ+YDL  LF+ GG  P +NYLF+GD+VDRG  S+E   LLLA K++YP+   L+RGNHES  I ++YGFYDEC ++Y +I +W+   + F+ L  +A+ID ++ C HGGLSP + +L QI+ I R +EVP DG +CDLLWSDP+ DI GW  + RG  + FGSDVV ++
Sbjct:   19 LITEKEVKQLCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFKVGGDVPDTNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLKKYGSITVWRYCAEIFDYLSLSAIIDNRVFCVHGGLSPSISTLDQIRSIDRKQEVPHDGPMCDLLWSDPE-DIQGWGVSPRGAGYLFGSDVVAQY 225          

HSP 2 Score: 48.521 bits (114), Expect = 1.815e-6
Identity = 24/69 (34.78%), Postives = 39/69 (56.52%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKKNKFFDVLKKHASA 1014
            AHQ+V +GY++     ++T++SAPNYC    N  A++ +DE L   F I + A +  +    + K  SA
Sbjct:  237 AHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLKREFTIFEAAPQDVRGTPSIAKKPSA 305          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO40084 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8D8])

HSP 1 Score: 146.362 bits (368), Expect = 1.949e-57
Identity = 62/95 (65.26%), Postives = 78/95 (82.11%), Query Frame = 2
Query:  494 KRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            KRRYNI+LWKIFTDCFN LP AA++++ I C HGGLSP+L+ L +I+ + RP +VPD GL+CDLLWSDPD DI GW +N+RGVS TFG DVV ++
Sbjct:    2 KRRYNIKLWKIFTDCFNCLPIAAIVEQTIFCMHGGLSPDLQGLDEIRNLERPMDVPDKGLVCDLLWSDPDEDITGWGDNDRGVSWTFGGDVVREY 96          

HSP 2 Score: 94.7449 bits (234), Expect = 1.949e-57
Identity = 43/54 (79.63%), Postives = 47/54 (87.04%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAV 969
            AHQVVEDGY FF KRKLVT+FSAPNYCGEFDNAG +MSV E LMCSF ILK ++
Sbjct:  108 AHQVVEDGYRFFEKRKLVTLFSAPNYCGEFDNAGGVMSVGENLMCSFSILKVSL 161          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO36272 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7SJ38])

HSP 1 Score: 179.489 bits (454), Expect = 5.137e-52
Identity = 88/188 (46.81%), Postives = 120/188 (63.83%), Query Frame = 2
Query:  206 IFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVV 769
            I  ++   LE++API +CGDIHGQ+YDL++LFE GG P T+ YLFLGDYVDRG  SIEC+  L   K  Y    FLLRGNHE   +   + F  ECK +Y+  ++    + F+ LP AAL++++ +C HGGLSPE+ +L  +K++ R +E P  G +CDLLWSDP  D      NE+   H F  + V
Sbjct:   49 ILRKEKTMLEVDAPITVCGDIHGQFYDLVKLFEVGGSPATTRYLFLGDYVDRGYFSIECVLYLWTLKCLYTNTLFLLRGNHECRHLTEYFTFKTECKIKYSEAVYDACMESFDCLPLAALMNQQFLCVHGGLSPEIHTLDDVKKLDRFKEPPAFGPMCDLLWSDPLEDY----GNEKTSEH-FSHNTV 231          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ENSORLT00000019964.2 (protein phosphatase 1 catalytic subunit gamma [Source:NCBI gene;Acc:101161814])

HSP 1 Score: 381.719 bits (979), Expect = 2.223e-133
Identity = 176/235 (74.89%), Postives = 205/235 (87.23%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M   + +NID+II +LLEVRG +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D++GW EN+RGVS TFGS+VV KF
Sbjct:    1 MADVDKLNIDSIIQRLLEVRGAKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGSEVVAKF 235          

HSP 2 Score: 114.39 bits (285), Expect = 2.223e-133
Identity = 53/56 (94.64%), Postives = 55/56 (98.21%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKK 975
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA KK
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKK 302          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ppp1cab (serine/threonine-protein phosphatase alpha-2 isoform [Source:NCBI gene;Acc:101171445])

HSP 1 Score: 379.793 bits (974), Expect = 1.126e-132
Identity = 172/235 (73.19%), Postives = 205/235 (87.23%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M   + +NID+II +LLEV+G +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGD+HGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ + RP +VPD GL+CDLLW+DPD+D++GW EN+RGVS TFG+DVV KF
Sbjct:    1 MAEADKLNIDSIIQRLLEVKGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQIRRVMRPTDVPDQGLLCDLLWADPDKDVLGWGENDRGVSFTFGADVVTKF 235          

HSP 2 Score: 114.005 bits (284), Expect = 1.126e-132
Identity = 57/71 (80.28%), Postives = 60/71 (84.51%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKKNKFFDVLKKHASARP 1020
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA KK  F+       S RP
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK-LFYGGGGGMGSGRP 316          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ppp1caa (serine/threonine-protein phosphatase alpha-2 isoform-like [Source:NCBI gene;Acc:101169945])

HSP 1 Score: 377.481 bits (968), Expect = 5.698e-132
Identity = 172/235 (73.19%), Postives = 205/235 (87.23%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M   + +NID+II +LLEV+G +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGD+HGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ + RP +VPD GL+CDLLW+DPD+D++GW EN+RGVS TFG+DVV KF
Sbjct:    1 MAEPDKLNIDSIIQRLLEVKGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQIRRVMRPTDVPDQGLLCDLLWADPDKDVLGWGENDRGVSFTFGADVVAKF 235          

HSP 2 Score: 114.005 bits (284), Expect = 5.698e-132
Identity = 53/56 (94.64%), Postives = 55/56 (98.21%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKK 975
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA KK
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK 302          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ppp1cab (serine/threonine-protein phosphatase alpha-2 isoform [Source:NCBI gene;Acc:101171445])

HSP 1 Score: 378.252 bits (970), Expect = 3.717e-131
Identity = 172/235 (73.19%), Postives = 205/235 (87.23%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M   + +NID+II +LLEV+G +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGD+HGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA++DEKI C HGGLSP+L+S++QI+ + RP +VPD GL+CDLLW+DPD+D++GW EN+RGVS TFG+DVV KF
Sbjct:    1 MAEADKLNIDSIIQRLLEVKGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQIRRVMRPTDVPDQGLLCDLLWADPDKDVLGWGENDRGVSFTFGADVVTKF 235          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: PPP1CB (serine/threonine-protein phosphatase PP1-beta catalytic subunit [Source:NCBI gene;Acc:101155811])

HSP 1 Score: 370.933 bits (951), Expect = 1.066e-129
Identity = 169/229 (73.80%), Postives = 201/229 (87.77%), Query Frame = 2
Query:   92 INIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            +N+D++I++LLEVRG +PG+ V + E E++ LC K+R+IFL QP  LELEAP+KICGDIHGQY DLLRLFEYGGFPP +NYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRR+NI+LWK FTDCFN LP AA+IDEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD+D+ GW EN+RGVS TFG+DVV KF
Sbjct:    6 LNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKF 234          

HSP 2 Score: 112.849 bits (281), Expect = 1.066e-129
Identity = 51/59 (86.44%), Postives = 56/59 (94.92%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKKNKF 984
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAG MMSVDE+LMCSFQILKP+ KK K+
Sbjct:  246 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDESLMCSFQILKPSEKKAKY 304          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000075857.1 (SMESG000075857.1)

HSP 1 Score: 380.563 bits (976), Expect = 4.425e-133
Identity = 176/235 (74.89%), Postives = 205/235 (87.23%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M   + +NID+IIA+LLEVRG +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA+IDEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD++ +GW EN+RGVS TFG++VV KF
Sbjct:    1 MGDVDKLNIDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKF 235          

HSP 2 Score: 114.005 bits (284), Expect = 4.425e-133
Identity = 53/56 (94.64%), Postives = 55/56 (98.21%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKK 975
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA KK
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK 302          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000067423.1 (SMESG000067423.1)

HSP 1 Score: 379.022 bits (972), Expect = 1.283e-132
Identity = 174/235 (74.04%), Postives = 206/235 (87.66%), Query Frame = 2
Query:   74 MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            M  ++ +N+D+IIA+LLEVRG +PG++V L E EI+ LC K+R+IFL QP  LELEAP+KICGDIHGQY+DLLRLFEYGGFPP SNYLFLGDYVDRG+QS+E I LLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRRYNI+LWK FTDCFN LP AA+IDEKI C HGGLSP+L+S++QI+ I RP +VPD GL+CDLLWSDPD++ +GW EN+RGVS TFG++VV KF
Sbjct:    1 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKF 235          

HSP 2 Score: 114.005 bits (284), Expect = 1.283e-132
Identity = 54/65 (83.08%), Postives = 59/65 (90.77%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKKNKFFDVLKK 1002
            AHQVVEDGYEFFAKR+LVT+FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA KK   ++ L +
Sbjct:  247 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLNQ 311          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000015282.1 (SMESG000015282.1)

HSP 1 Score: 365.925 bits (938), Expect = 1.910e-127
Identity = 168/232 (72.41%), Postives = 200/232 (86.21%), Query Frame = 2
Query:   83 NESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            +  +N+D++I +LLEVRG +PG++V + E EI+ALC K+++IFL Q   LELEAPIKICGDIHGQY DLLRLFEYGGFPP SNYLFLGDYVDRG+ S+E I LLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRR+ I+LWK FTDCFN LP AA+IDEKI C HGGLSP+L+S+ QI+ I+RP E+PD GL+CD+LWSDPD+++  W EN+RGVS TFGSD+V KF
Sbjct:    3 DSDLNVDSLITRLLEVRGCRPGKTVDMKEDEIRALCLKSKEIFLNQNILLELEAPIKICGDIHGQYTDLLRLFEYGGFPPDSNYLFLGDYVDRGKFSLETICLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRFTIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMDQIRRITRPTEIPDTGLLCDILWSDPDKEVEAWGENDRGVSFTFGSDIVSKF 234          

HSP 2 Score: 109.768 bits (273), Expect = 1.910e-127
Identity = 49/59 (83.05%), Postives = 54/59 (91.53%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKKNKF 984
            AHQVVEDGYEFFA+R+LVT+FSAPNYCGEFDNAG MMSVDE L+CSFQILKP  KK K+
Sbjct:  246 AHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMSVDENLLCSFQILKPTEKKAKY 304          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000024840.1 (SMESG000024840.1)

HSP 1 Score: 353.214 bits (905), Expect = 2.884e-123
Identity = 160/230 (69.57%), Postives = 198/230 (86.09%), Query Frame = 2
Query:   89 SINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            ++N++TII+KLLE +     + V L E EIK LC K+++IF+ Q   LELEAP+KICGDIHGQY DLLRLF+YGG+PPT+NYLFLGDYVDRG+QSIEC+ LLLAYKIK+PENFFLLRGNHES+A+NR+YGFYDE KRRY+I++WK+FTD FN LPFAALIDEKIICFHGGLSP L+  KQ+++I RP EVPD+GL CD+LW+DP+RDI G+ EN+RGVS+ FG D V++F
Sbjct:    5 TVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERF 234          

HSP 2 Score: 108.997 bits (271), Expect = 2.884e-123
Identity = 49/58 (84.48%), Postives = 52/58 (89.66%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKKNK 981
            AHQVVEDGYEFF KRKLVTIFSAPNYCGEFDNAGAMMSVDE L+CSF +LKP  K+ K
Sbjct:  246 AHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMK 303          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000024840.1 (SMESG000024840.1)

HSP 1 Score: 352.829 bits (904), Expect = 3.610e-123
Identity = 160/230 (69.57%), Postives = 198/230 (86.09%), Query Frame = 2
Query:   89 SINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQPPFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQSIECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWKIFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGLICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKF 778
            ++N++TII+KLLE +     + V L E EIK LC K+++IF+ Q   LELEAP+KICGDIHGQY DLLRLF+YGG+PPT+NYLFLGDYVDRG+QSIEC+ LLLAYKIK+PENFFLLRGNHES+A+NR+YGFYDE KRRY+I++WK+FTD FN LPFAALIDEKIICFHGGLSP L+  KQ+++I RP EVPD+GL CD+LW+DP+RDI G+ EN+RGVS+ FG D V++F
Sbjct:    2 TVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERF 231          

HSP 2 Score: 108.612 bits (270), Expect = 3.610e-123
Identity = 49/58 (84.48%), Postives = 52/58 (89.66%), Query Frame = 1
Query:  808 AHQVVEDGYEFFAKRKLVTIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAVKKNK 981
            AHQVVEDGYEFF KRKLVTIFSAPNYCGEFDNAGAMMSVDE L+CSF +LKP  K+ K
Sbjct:  243 AHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMK 300          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP1CA8.718e-13374.04protein phosphatase 1 catalytic subunit alpha [Sou... [more]
PPP1CC9.163e-13374.47protein phosphatase 1 catalytic subunit gamma [Sou... [more]
PPP1CC1.186e-13274.47protein phosphatase 1 catalytic subunit gamma [Sou... [more]
PPP1CC2.016e-13174.47protein phosphatase 1 catalytic subunit gamma [Sou... [more]
PPP1CC2.428e-13174.47protein phosphatase 1 catalytic subunit gamma [Sou... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gsp-22.419e-13275.76Serine/threonine-protein phosphatase PP1-beta [So... [more]
gsp-13.161e-13172.34Serine/threonine-protein phosphatase PP1-alpha [S... [more]
pph-15.467e-10861.41Serine/threonine-protein phosphatase [Source:UniP... [more]
F52H3.64.040e-9253.91Serine/threonine-protein phosphatase [Source:UniP... [more]
gsp-36.383e-9254.82Serine/threonine-protein phosphatase PP1-gamma [S... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pp1-87B2.643e-13175.55gene:FBgn0004103 transcript:FBtr0082595[more]
Pp1alpha-96A1.566e-13075.11gene:FBgn0003134 transcript:FBtr0334334[more]
Pp1alpha-96A1.566e-13075.11gene:FBgn0003134 transcript:FBtr0084642[more]
Pp1-13C6.615e-12972.73gene:FBgn0003132 transcript:FBtr0074017[more]
flw2.590e-12771.62gene:FBgn0000711 transcript:FBtr0071447[more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1cab2.486e-13373.62protein phosphatase 1, catalytic subunit, alpha is... [more]
ppp1caa3.560e-13272.34protein phosphatase 1, catalytic subunit, alpha is... [more]
CABZ01076667.13.743e-13273.62protein phosphatase 1, catalytic subunit, gamma is... [more]
ppp1cb8.409e-13073.80protein phosphatase 1, catalytic subunit, beta iso... [more]
ppp1caa1.227e-12672.20protein phosphatase 1, catalytic subunit, alpha is... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1cc8.705e-13374.47protein phosphatase 1, catalytic subunit, gamma is... [more]
ppp1cb1.440e-12973.36protein phosphatase 1, catalytic subunit, beta iso... [more]
ppp1cc5.839e-12775.69protein phosphatase 1, catalytic subunit, gamma is... [more]
ppp1cc8.488e-12774.44protein phosphatase 1, catalytic subunit, gamma is... [more]
ppp1cc2.227e-12676.39protein phosphatase 1, catalytic subunit, gamma is... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppp1cc6.867e-13374.47protein phosphatase 1 catalytic subunit gamma [Sou... [more]
Ppp1cc9.500e-13374.47protein phosphatase 1 catalytic subunit gamma [Sou... [more]
Ppp1ca1.743e-13273.62protein phosphatase 1 catalytic subunit alpha [Sou... [more]
Ppp1ca1.743e-13273.62protein phosphatase 1 catalytic subunit alpha [Sou... [more]
Ppp1cc3.849e-13174.47protein phosphatase 1 catalytic subunit gamma [Sou... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6NVU2|PPIG_XENTR3.521e-13274.47Serine/threonine-protein phosphatase PP1-gamma cat... [more]
sp|P36874|PP1GA_XENLA3.521e-13274.47Serine/threonine-protein phosphatase PP1-gamma cat... [more]
sp|P62138|PP1A_RAT3.763e-13274.04Serine/threonine-protein phosphatase PP1-alpha cat... [more]
sp|P62139|PP1A_RABIT3.763e-13274.04Serine/threonine-protein phosphatase PP1-alpha cat... [more]
sp|P62136|PP1A_HUMAN3.763e-13274.04Serine/threonine-protein phosphatase PP1-alpha cat... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1J8R1U32.113e-13573.50Serine/threonine-protein phosphatase OS=Rhizopogon... [more]
T1KMY82.452e-13476.82Serine/threonine-protein phosphatase OS=Tetranychu... [more]
C5LJH82.942e-13377.06Serine/threonine-protein phosphatase OS=Perkinsus ... [more]
A0A1B0YZ164.939e-13374.47Serine/threonine-protein phosphatase OS=Limulus po... [more]
A0A087TYI95.421e-13275.74Serine/threonine-protein phosphatase (Fragment) OS... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1cab1.257e-13473.62serine/threonine-protein phosphatase alpha-2 isofo... [more]
ppp1cab9.309e-13373.62serine/threonine-protein phosphatase alpha-2 isofo... [more]
ppp1caa3.394e-13272.34serine/threonine-protein phosphatase alpha-2 isofo... [more]
ENSAMXT00000007129.21.172e-13173.19protein phosphatase 1 catalytic subunit gamma [Sou... [more]
ppp1cb6.565e-13072.53serine/threonine-protein phosphatase PP1-beta cata... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1cab1.118e-12676.96protein phosphatase 1, catalytic subunit, alpha is... [more]
ppp1cb1.066e-12374.21protein phosphatase 1, catalytic subunit, beta iso... [more]
ENSPMAT00000010086.15.170e-10777.27pep scaffold:Pmarinus_7.0:GL479411:90249:92178:-1 ... [more]
ENSPMAT00000005085.14.044e-6677.42pep scaffold:Pmarinus_7.0:GL481040:2845:3652:-1 ge... [more]
ENSPMAT00000005238.15.647e-5650.32pep scaffold:Pmarinus_7.0:GL487052:8065:11513:-1 g... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
GLC74.551e-13174.57Type 1 S/T protein phosphatase (PP1) catalytic sub... [more]
PPZ11.997e-10060.00Serine/threonine protein phosphatase Z, isoform of... [more]
PPZ26.552e-10059.13Serine/threonine protein phosphatase Z, isoform of... [more]
PPQ14.395e-9853.33Protein phosphatase that regulates the mating resp... [more]
PPH212.923e-7149.76Catalytic subunit of protein phosphatase 2A (PP2A)... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO446482.704e-13374.47Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO297594.530e-7648.90Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO499363.554e-7350.48Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO400841.949e-5765.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362725.137e-5246.81Serine/threonine-protein phosphatase [Source:UniP... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000019964.22.223e-13374.89protein phosphatase 1 catalytic subunit gamma [Sou... [more]
ppp1cab1.126e-13273.19serine/threonine-protein phosphatase alpha-2 isofo... [more]
ppp1caa5.698e-13273.19serine/threonine-protein phosphatase alpha-2 isofo... [more]
ppp1cab3.717e-13173.19serine/threonine-protein phosphatase alpha-2 isofo... [more]
PPP1CB1.066e-12973.80serine/threonine-protein phosphatase PP1-beta cata... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075857.14.425e-13374.89SMESG000075857.1[more]
SMESG000067423.11.283e-13274.04SMESG000067423.1[more]
SMESG000015282.11.910e-12772.41SMESG000015282.1[more]
SMESG000024840.12.884e-12369.57SMESG000024840.1[more]
SMESG000024840.13.610e-12369.57SMESG000024840.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032302 ID=SMED30032302|Name=Serine/threonine-protein phosphatase|organism=Schmidtea mediterranea sexual|type=transcript|length=1170bp
AAATAATTGATTATAGTTTAATTTTTAAGTCCATTCTTTTTTGGAAATGA
TCTAAGAAAAGTAACTAGAAAAGATGAACACAAACGAGTCAATAAATATT
GATACTATTATAGCGAAATTGCTTGAAGTACGCGGCGGGCAGCCGGGTAG
AAGTGTTTTATTGGGTGAAGGAGAAATCAAGGCTCTATGCTATAAAGCTC
GGGATATATTTTTACAACAACCGCCATTTTTGGAATTGGAGGCACCGATA
AAGATTTGTGGTGACATACATGGACAGTATTACGATCTATTGAGACTGTT
TGAATATGGCGGATTTCCTCCAACCTCGAATTATTTATTTCTTGGGGACT
ACGTGGATCGTGGACGTCAATCAATCGAATGTATAACATTACTATTAGCA
TATAAAATTAAATATCCGGAAAATTTTTTTCTCCTCAGAGGCAACCATGA
AAGTGCTGCAATTAACAGGATTTATGGGTTTTATGATGAATGTAAGCGTC
GGTATAATATACGGCTATGGAAAATATTCACAGATTGTTTCAATGCATTA
CCCTTTGCTGCACTTATTGATGAAAAAATAATTTGTTTTCATGGTGGTTT
GTCTCCTGAATTGCGCAGTTTAAAACAAATTAAAGAAATTAGTAGACCGA
GAGAAGTACCAGATGATGGTTTAATATGTGATTTGTTGTGGTCTGATCCA
GATAGGGATATTGTTGGTTGGGCAGAAAACGAAAGGGGTGTAAGTCATAC
TTTTGGATCTGATGTAGTAGACAAATTCCTTCAAGTTCAAGATCTTGATC
TCATATAGCTCATCAAGTTGTCGAGGACGGATATGAGTTTTTTGCCAAAC
GCAAACTAGTAACGATATTTTCAGCGCCAAATTATTGCGGTGAGTTTGAC
AATGCTGGTGCCATGATGTCGGTAGATGAAACGCTAATGTGTTCCTTTCA
AATACTGAAACCAGCAGTGAAAAAAAATAAATTTTTCGATGTGTTAAAAA
AGCACGCGTCGGCTCGGCCTCAATTTACTTAAAAGATTATTTTAAAACAT
TCAATTATATTAGAAAACTTATTACTTGATGCTATCATAATAATCATAGT
AAGATTAATAAAACTAGTAATATATTAGTGTAATTTTGTGATTAAAATTT
GAGATTTGATTTATTTTAAG
back to top

protein sequence of SMED30032302-orf-1

>SMED30032302-orf-1 ID=SMED30032302-orf-1|Name=SMED30032302-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=245bp
MNTNESINIDTIIAKLLEVRGGQPGRSVLLGEGEIKALCYKARDIFLQQP
PFLELEAPIKICGDIHGQYYDLLRLFEYGGFPPTSNYLFLGDYVDRGRQS
IECITLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRYNIRLWK
IFTDCFNALPFAALIDEKIICFHGGLSPELRSLKQIKEISRPREVPDDGL
ICDLLWSDPDRDIVGWAENERGVSHTFGSDVVDKFLQVQDLDLI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0000164protein phosphatase type 1 complex
GO:0072357PTW/PP1 phosphatase complex
Vocabulary: molecular function
TermDefinition
GO:0004722protein serine/threonine phosphatase activity
GO:0016787hydrolase activity
GO:0004721phosphoprotein phosphatase activity
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR037979PPP1CA
IPR029052Metallo-depent_PP-like
IPR006186Ser/Thr-sp_prot-phosphatase
IPR031675STPPase_N
IPR004843Calcineurin-like_PHP_ApaH
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatasePRINTSPR00114STPHPHTASEcoord: 87..114
score: 69.51
coord: 240..244
score: 14.32
coord: 183..210
score: 54.64
coord: 120..144
score: 70.53
coord: 154..180
score: 58.68
coord: 58..85
score: 64.71
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphataseSMARTSM00156pp2a_7coord: 30..243
e-value: 3.1E-94
score: 329.0
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatasePROSITEPS00125SER_THR_PHOSPHATASEcoord: 121..126
IPR004843Calcineurin-like phosphoesterase domain, ApaH typePFAMPF00149Metallophoscoord: 58..244
e-value: 9.7E-37
score: 127.5
IPR031675Serine-threonine protein phosphatase, N-terminalPFAMPF16891STPPase_Ncoord: 9..56
e-value: 2.8E-17
score: 62.9
IPR029052Metallo-dependent phosphatase-likeGENE3DG3DSA:3.60.21.10coord: 1..244
e-value: 7.5E-103
score: 345.3
IPR037979Serine/threonine-protein phosphatase PP1-alpha catalytic subunitPANTHERPTHR11668:SF377SERINE/THREONINE-PROTEIN PHOSPHATASE PP1-ALPHA CATALYTIC SUBUNITcoord: 1..244
NoneNo IPR availablePANTHERPTHR11668SERINE/THREONINE PROTEIN PHOSPHATASEcoord: 1..244
NoneNo IPR availableSUPERFAMILYSSF56300Metallo-dependent phosphatasescoord: 22..244