BTB domain-containing protein

Overview
NameBTB domain-containing protein
Smed IDSMED30032297
Length (bp)1214
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of BTB domain-containing protein (SMED30032297) t-SNE clustered cells

Violin plots show distribution of expression levels for BTB domain-containing protein (SMED30032297) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of BTB domain-containing protein (SMED30032297) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for BTB domain-containing protein (SMED30032297) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032297

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30032297SMESG000017289.1 SmedASXL_004297SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30032297SMESG000017289.1 SMESG000017288.1 dd_Smed_v4_8895_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30032297SMESG000017289.1 SMESG000017288.1 dd_Smed_v6_8895_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30032297SMESG000017289.1 OX_Smed_1.0.10013ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of BTB domain-containing protein vs. Ensembl Human
Match: KCTD16 (potassium channel tetramerization domain containing 16 [Source:HGNC Symbol;Acc:HGNC:29244])

HSP 1 Score: 155.606 bits (392), Expect = 1.604e-42
Identity = 104/270 (38.52%), Postives = 141/270 (52.22%), Query Frame = 3
Query:  408 KVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVE-----------------NLEKRIQ----HIGPT-----------VITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            +VVELNVGG  Y +  ST +   P+S L  +         D   DSK R FIDR+G LFR+I+D+LR     + +  LPD F E   LK EA YF + ++V+                 + E   Q     I P             IT+GYRG+   GR+G AD KFR++ RILV G++S  KEVF +TLN SRDPD        +RY++RF+LK   LE+AFD L  CG+ MV       NS+ + +   Q +++  W  Y E+VF R
Sbjct:   25 EVVELNVGGQVYFTRHSTLI-SIPHSLLWKMFSPKRDTANDLAKDSKGRFFIDRDGFLFRYILDYLR-----DRQVVLPDHFPEKGRLKREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSLLPADRKWGFITVGYRGSCTLGREGQADAKFRRVPRILVCGRISLAKEVFGETLNESRDPD-----RAPERYTSRFYLKFKHLERAFDMLSECGFHMV-----ACNSSVTASFINQYTDDKIWSSYTEYVFYR 278          
BLAST of BTB domain-containing protein vs. Ensembl Human
Match: KCTD16 (potassium channel tetramerization domain containing 16 [Source:HGNC Symbol;Acc:HGNC:29244])

HSP 1 Score: 155.606 bits (392), Expect = 1.604e-42
Identity = 104/270 (38.52%), Postives = 141/270 (52.22%), Query Frame = 3
Query:  408 KVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVE-----------------NLEKRIQ----HIGPT-----------VITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            +VVELNVGG  Y +  ST +   P+S L  +         D   DSK R FIDR+G LFR+I+D+LR     + +  LPD F E   LK EA YF + ++V+                 + E   Q     I P             IT+GYRG+   GR+G AD KFR++ RILV G++S  KEVF +TLN SRDPD        +RY++RF+LK   LE+AFD L  CG+ MV       NS+ + +   Q +++  W  Y E+VF R
Sbjct:   25 EVVELNVGGQVYFTRHSTLI-SIPHSLLWKMFSPKRDTANDLAKDSKGRFFIDRDGFLFRYILDYLR-----DRQVVLPDHFPEKGRLKREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSLLPADRKWGFITVGYRGSCTLGREGQADAKFRRVPRILVCGRISLAKEVFGETLNESRDPD-----RAPERYTSRFYLKFKHLERAFDMLSECGFHMV-----ACNSSVTASFINQYTDDKIWSSYTEYVFYR 278          
BLAST of BTB domain-containing protein vs. Ensembl Human
Match: KCTD12 (potassium channel tetramerization domain containing 12 [Source:HGNC Symbol;Acc:HGNC:14678])

HSP 1 Score: 147.132 bits (370), Expect = 2.844e-40
Identity = 103/301 (34.22%), Postives = 141/301 (46.84%), Query Frame = 3
Query:  411 VVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLR-------------CKKNKESK-FNLPDTFRETSA--------------------LKNEAVYFGINEMVENLEKRIQHIGPTV------------------------------ITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            +VELNVGG  Y + + T V   P+S L  +  Q  +QP +   DSK R F+DR+G LFR+I+D+LR              +  +E++ F LP+  R   A                    L +E +  G +E  +          PT+                              IT+GYRG++  GRD  AD KFR+++RI V GK S  KEVF DTLN SRDPD        +RY++R++LK N LEQAFD L   G+ MV    +GT +  S       SE+  W  Y E+VF R
Sbjct:   35 IVELNVGGQVYVTRRCTVV-SVPDSLLWRMFTQ--QQPQELARDSKGRFFLDRDGFLFRYILDYLRDLQLVLPDYFPERSRLQREAEYFELPELVRRLGAPQQPGPGPPPSRRGVHKEGSLGDELLPLGYSEPEQQEGASAGAPSPTLELASRSPSGGAAGPLLTPSQSLDGSRRSGYITIGYRGSYTIGRDAQADAKFRRVARITVCGKTSLAKEVFGDTLNESRDPD-----RPPERYTSRYYLKFNFLEQAFDKLSESGFHMVACSSTGTCAFASST---DQSEDKIWTSYTEYVFCR 324          
BLAST of BTB domain-containing protein vs. Ensembl Human
Match: KCTD8 (potassium channel tetramerization domain containing 8 [Source:HGNC Symbol;Acc:HGNC:22394])

HSP 1 Score: 104.76 bits (260), Expect = 5.608e-24
Identity = 54/123 (43.90%), Postives = 77/123 (62.60%), Query Frame = 3
Query:  753 ITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            +TLGYRG++   RD  AD KFR+++RI+V G+++  KEVF DTLN SRDPD      + ++Y++RF+LK   LEQAFD L   G+ MV    SGT +  +  R     ++  W  Y E++F R
Sbjct:  209 LTLGYRGSYTTVRDNQADAKFRRVARIMVCGRIALAKEVFGDTLNESRDPD-----RQPEKYTSRFYLKFTYLEQAFDRLSEAGFHMVACNSSGTAAFVNQYR-----DDKIWSSYTEYIFFR 321          

HSP 2 Score: 67.781 bits (164), Expect = 1.199e-11
Identity = 42/113 (37.17%), Postives = 64/113 (56.64%), Query Frame = 3
Query:  408 KVVELNVGGITYASFKSTFVDQYPNSKLASLVLQY-----VKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRI 731
            +VVELNVGG  Y +  ST +   P+S LAS+          ++  +   DS+ R FIDR+G LFR+++D+LR K     +  LP+ F E   L  EA YF + ++V+ L  ++
Sbjct:   44 EVVELNVGGQVYVTKHSTLL-SVPDSTLASMFSPSSPRGGARRRGELPRDSRARFFIDRDGFLFRYVLDYLRDK-----QLALPEHFPEKERLLREAEYFQLTDLVKLLSPKV 150          
BLAST of BTB domain-containing protein vs. Ensembl Human
Match: KCTD1 (potassium channel tetramerization domain containing 1 [Source:HGNC Symbol;Acc:HGNC:18249])

HSP 1 Score: 74.3294 bits (181), Expect = 1.877e-14
Identity = 66/217 (30.41%), Postives = 101/217 (46.54%), Query Frame = 3
Query:  414 VELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQHIGPTVITLGYRGTFAFGRDG---LADVKFRKLSRILVSGKVSPCKEVFQ---DTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSA 1046
            V ++VGG  Y S  +T   +YP S++  L         DSL   K   FIDR+G +FR+I++FLR      SK  +PD F++ + L  EA YF +  M+  +E+  Q           R T  F R     +  V      RI +SG  S  +EVF    D +  S +    +  +   R+    +   N + Q  + L   G+++VGSCG G +S+
Sbjct:   32 VHIDVGGHMYTSSLATLT-KYPESRIGRLFDGTEPIVLDSL---KQHYFIDRDGQMFRYILNFLRT-----SKLLIPDDFKDYTLLYEEAKYFQLQPMLLEMERWKQD----------RETGRFSRPCECLVVRVAPDLGERITLSGDKSLIEEVFPEIGDVMCNSVNAGWNHDSTHVIRFPLNGYCHLNSV-QVLERLQQRGFEIVGSCGGGVDSS 228          
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Match: VM106R.1 (pep chromosome:WBcel235:II:10827716:10829556:-1 gene:WBGene00014848.1 transcript:VM106R.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:VM106R.1)

HSP 1 Score: 174.096 bits (440), Expect = 4.476e-51
Identity = 110/284 (38.73%), Postives = 147/284 (51.76%), Query Frame = 3
Query:  387 MSSKSDDKVVELNVGGITYASFKSTFVDQYPN--SKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQHIGPT------------------VITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRP-------------------GQDSEESKWQHYNEFVFVR 1121
            M+S  D  V+ LNVGG  Y + +ST   +     + +AS  L   +Q  + +      LF+DR+G LF +++ FLR       K +LP+ FRE + LK+EA ++ + E    L      I P                    ITLGYRGTFAFGRDG ADVKFRKL RILV G+ + C+EVF DTLN SRDP        G+RY++R +LKH  LE+A D +   G+K+V +C SG N   + N P                     D EE +W HY E+VF R
Sbjct:   23 MTSVED--VITLNVGGTMYTTTRSTLSKETDTLLANIASGSLSEDEQ-ANVVTLPDGTLFVDRDGPLFAYVLHFLR-----TDKLSLPEQFREVARLKDEADFYRL-ERFSTLLSNASSISPRPRTANGYNTITSGAETGGYITLGYRGTFAFGRDGQADVKFRKLHRILVCGRATLCREVFADTLNESRDPG---GPDDGERYTSRLYLKHQCLERACDLMAEKGFKLVATCCSGANGLAAANHPILTSNMGNINQTELMNHRNCGDYEEQRWAHYTEYVFFR 294          
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Match: F32B4.5 (pep chromosome:WBcel235:I:11517769:11520660:-1 gene:WBGene00009315.1 transcript:F32B4.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F32B4.5)

HSP 1 Score: 73.1738 bits (178), Expect = 4.542e-14
Identity = 42/99 (42.42%), Postives = 62/99 (62.63%), Query Frame = 3
Query:  828 RILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDS-EESKWQHYNEFVFVR 1121
            RI+VSGKV  C+ VF D+LN  RD   G    + DRY++RFFLKH+ LE+AFD L   GY+++ S     N+      P   + ++S++ H+++FVF R
Sbjct:  240 RIVVSGKVIMCRAVFGDSLNECRD--GGGTDFEMDRYTSRFFLKHSNLEKAFDQLASSGYRLIHS-----NTFAPSEMPKHAAKDDSQFIHHSQFVFHR 331          
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Match: F32B4.5 (pep chromosome:WBcel235:I:11517769:11519193:-1 gene:WBGene00009315.1 transcript:F32B4.5b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F32B4.5)

HSP 1 Score: 59.3066 bits (142), Expect = 4.403e-11
Identity = 35/89 (39.33%), Postives = 54/89 (60.67%), Query Frame = 3
Query:  858 CKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDS-EESKWQHYNEFVFVR 1121
            C+ VF D+LN  RD   G    + DRY++RFFLKH+ LE+AFD L   GY+++ S     N+      P   + ++S++ H+++FVF R
Sbjct:    2 CRAVFGDSLNECRDG--GGTDFEMDRYTSRFFLKHSNLEKAFDQLASSGYRLIHS-----NTFAPSEMPKHAAKDDSQFIHHSQFVFHR 83          
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Match: F32B4.5 (pep chromosome:WBcel235:I:11517748:11520597:-1 gene:WBGene00009315.1 transcript:F32B4.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F32B4.5)

HSP 1 Score: 59.3066 bits (142), Expect = 4.403e-11
Identity = 35/89 (39.33%), Postives = 54/89 (60.67%), Query Frame = 3
Query:  858 CKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDS-EESKWQHYNEFVFVR 1121
            C+ VF D+LN  RD   G    + DRY++RFFLKH+ LE+AFD L   GY+++ S     N+      P   + ++S++ H+++FVF R
Sbjct:    2 CRAVFGDSLNECRDG--GGTDFEMDRYTSRFFLKHSNLEKAFDQLASSGYRLIHS-----NTFAPSEMPKHAAKDDSQFIHHSQFVFHR 83          
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Match: F22E5.12 (pep chromosome:WBcel235:II:2646328:2646843:-1 gene:WBGene00017710.1 transcript:F22E5.12.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F22E5.12)

HSP 1 Score: 54.299 bits (129), Expect = 8.038e-9
Identity = 31/112 (27.68%), Postives = 61/112 (54.46%), Query Frame = 3
Query:  405 DKVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQHI 740
            DKV+ LN+GG  + + KST +      K      ++++ P  SLVD    +F+DR+   F  +++F+R     + + +LP+T ++   L  EA Y+ + E+ ++ ++ I  +
Sbjct:    6 DKVIRLNIGGKRFDTHKSTLM------KFDGYFKKFLQTPGSSLVDP---IFVDRSPTYFDIVLNFMR-----KGRADLPETLKDLKMLLGEAEYYELTELCDDCKREISRL 103          
BLAST of BTB domain-containing protein vs. Ensembl Fly
Match: Ktl (gene:FBgn0038839 transcript:FBtr0347575)

HSP 1 Score: 237.654 bits (605), Expect = 1.349e-76
Identity = 120/239 (50.21%), Postives = 163/239 (68.20%), Query Frame = 3
Query:  408 KVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLV-DSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQHIGPTVITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            +++ELNVGG++Y +  +T +        ++L+ +   +  DSL  DSK R F+DR+G LFR+I+DFLR     +   +LP+ FRE   L  EA +F +  M+E +        P  IT+GYRG+F FG+DGLADVKFRKLSRILV G+V+ C+EVF DTLN SRDPD G      DRY++RFFLKH  +EQAFD L+  GY+M GSCGSGT  + ++ +PG D+EE++W HYNEFVF+R
Sbjct:    3 EIIELNVGGVSYTTTLATLLQDK-----STLLAELFGEGRDSLAKDSKGRYFLDRDGVLFRYILDFLR-----DKALHLPEGFRERQRLLREAEHFKLTAMLECIRSERDARPPGCITIGYRGSFQFGKDGLADVKFRKLSRILVCGRVAQCREVFGDTLNESRDPDHGGT----DRYTSRFFLKHCYIEQAFDNLHDHGYRMAGSCGSGTAGSAAEPKPGVDTEENRWNHYNEFVFIR 227          
BLAST of BTB domain-containing protein vs. Ensembl Fly
Match: Ktl (gene:FBgn0038839 transcript:FBtr0083986)

HSP 1 Score: 237.654 bits (605), Expect = 1.349e-76
Identity = 120/239 (50.21%), Postives = 163/239 (68.20%), Query Frame = 3
Query:  408 KVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLV-DSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQHIGPTVITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            +++ELNVGG++Y +  +T +        ++L+ +   +  DSL  DSK R F+DR+G LFR+I+DFLR     +   +LP+ FRE   L  EA +F +  M+E +        P  IT+GYRG+F FG+DGLADVKFRKLSRILV G+V+ C+EVF DTLN SRDPD G      DRY++RFFLKH  +EQAFD L+  GY+M GSCGSGT  + ++ +PG D+EE++W HYNEFVF+R
Sbjct:    3 EIIELNVGGVSYTTTLATLLQDK-----STLLAELFGEGRDSLAKDSKGRYFLDRDGVLFRYILDFLR-----DKALHLPEGFRERQRLLREAEHFKLTAMLECIRSERDARPPGCITIGYRGSFQFGKDGLADVKFRKLSRILVCGRVAQCREVFGDTLNESRDPDHGGT----DRYTSRFFLKHCYIEQAFDNLHDHGYRMAGSCGSGTAGSAAEPKPGVDTEENRWNHYNEFVFIR 227          
BLAST of BTB domain-containing protein vs. Ensembl Fly
Match: twz (gene:FBgn0034636 transcript:FBtr0071692)

HSP 1 Score: 58.9214 bits (141), Expect = 2.369e-9
Identity = 37/103 (35.92%), Postives = 54/103 (52.43%), Query Frame = 3
Query:  414 VELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLE 722
            V ++VGG  Y S   T   +YP SKLA L    +    DSL   K   FIDR+G +FR I++F+R      S+  + + F +   L  EA Y+ +  M++ LE
Sbjct:  108 VHIDVGGTIYTSSLETLT-KYPESKLAKLFNGQIPIVLDSL---KQHYFIDRDGGMFRHILNFMR-----NSRLLIAEDFPDLELLLEEARYYEVEPMIKQLE 201          
BLAST of BTB domain-containing protein vs. Ensembl Fly
Match: twz (gene:FBgn0034636 transcript:FBtr0308642)

HSP 1 Score: 59.3066 bits (142), Expect = 2.464e-9
Identity = 37/103 (35.92%), Postives = 54/103 (52.43%), Query Frame = 3
Query:  414 VELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLE 722
            V ++VGG  Y S   T   +YP SKLA L    +    DSL   K   FIDR+G +FR I++F+R      S+  + + F +   L  EA Y+ +  M++ LE
Sbjct:  137 VHIDVGGTIYTSSLETLT-KYPESKLAKLFNGQIPIVLDSL---KQHYFIDRDGGMFRHILNFMR-----NSRLLIAEDFPDLELLLEEARYYEVEPMIKQLE 230          
BLAST of BTB domain-containing protein vs. Ensembl Fly
Match: CG14647 (gene:FBgn0037244 transcript:FBtr0290222)

HSP 1 Score: 50.8322 bits (120), Expect = 9.936e-7
Identity = 39/119 (32.77%), Postives = 63/119 (52.94%), Query Frame = 3
Query:  378 FHKMSSKSDDKVVELNVGGITYASFKSTFVDQYPNSKLASLVLQY-VKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRI 731
            F   S  + ++ V+LNVGG  YA+   T V + P+S LA + LQ    +P++   D +    IDR+   F  II++LR       +F + D+      +  EA +FGI  +V +LE+R+
Sbjct:   24 FVAASGFAPNRWVKLNVGGQIYATTIDTLVGREPDSMLARMFLQNGSMKPSER--DEQGAYLIDRSPRYFEPIINYLR-----HGQF-VCDSNISVLGVLEEARFFGIFSLVTHLEERL 134          
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Match: kctd12.2 (potassium channel tetramerisation domain containing 12.2 [Source:ZFIN;Acc:ZDB-GENE-060117-4])

HSP 1 Score: 167.933 bits (424), Expect = 5.559e-49
Identity = 105/279 (37.63%), Postives = 147/279 (52.69%), Query Frame = 3
Query:  390 SSKSDDKVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQH-------------------------IGPT----------VITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            SS    +++ELNVGG  Y +  ST +   PNS L ++  Q  K+P +   DSK R F+DR+G LFR+I+D+LR     +    LPD F+E ++L  EA YF + ++ + L+  +                            GP            IT+GYRG++  GRD   D KFR+++RI V GK S  KEVF +TLN SRDPD        +RY++R++LK+N LEQAFD L   G+ MV    +GT +  S N P +D     W  Y E+VF R
Sbjct:    9 SSPRFSEIIELNVGGQVYVTRHSTLL-SVPNSLLWTMFSQ--KKPAELTTDSKGRFFLDRDGFLFRYILDYLR-----DQTLVLPDYFKEKASLLKEAEYFQLQDLAKRLKPAVSKENSISEEVCQSDPEEAALAGTSMTCTGPRSPSLDARKTGFITIGYRGSYTIGRDLQQDAKFRRVARITVCGKTSLAKEVFGETLNESRDPD-----RPPERYTSRYYLKYNFLEQAFDRLAEVGFHMVACSSTGTCAYAS-NDPNED---KIWTSYTEYVFCR 270          
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Match: kctd12.2 (potassium channel tetramerisation domain containing 12.2 [Source:ZFIN;Acc:ZDB-GENE-060117-4])

HSP 1 Score: 167.933 bits (424), Expect = 5.559e-49
Identity = 105/279 (37.63%), Postives = 147/279 (52.69%), Query Frame = 3
Query:  390 SSKSDDKVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQH-------------------------IGPT----------VITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            SS    +++ELNVGG  Y +  ST +   PNS L ++  Q  K+P +   DSK R F+DR+G LFR+I+D+LR     +    LPD F+E ++L  EA YF + ++ + L+  +                            GP            IT+GYRG++  GRD   D KFR+++RI V GK S  KEVF +TLN SRDPD        +RY++R++LK+N LEQAFD L   G+ MV    +GT +  S N P +D     W  Y E+VF R
Sbjct:    9 SSPRFSEIIELNVGGQVYVTRHSTLL-SVPNSLLWTMFSQ--KKPAELTTDSKGRFFLDRDGFLFRYILDYLR-----DQTLVLPDYFKEKASLLKEAEYFQLQDLAKRLKPAVSKENSISEEVCQSDPEEAALAGTSMTCTGPRSPSLDARKTGFITIGYRGSYTIGRDLQQDAKFRRVARITVCGKTSLAKEVFGETLNESRDPD-----RPPERYTSRYYLKYNFLEQAFDRLAEVGFHMVACSSTGTCAYAS-NDPNED---KIWTSYTEYVFCR 270          
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Match: kctd12.1 (potassium channel tetramerisation domain containing 12.1 [Source:ZFIN;Acc:ZDB-GENE-030902-5])

HSP 1 Score: 155.992 bits (393), Expect = 3.575e-44
Identity = 101/282 (35.82%), Postives = 144/282 (51.06%), Query Frame = 3
Query:  411 VVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQH-----------------------IGPTV----------------------ITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            ++ELNVGG  Y +  +T +   P+S L ++  +  K P +   DSK R F+DR+G LFR+I+D+LR     +    LPD F E S L+ EA +F + ++ + L  ++                         +GP                        IT+GYRG++  GRD   D KFR+++RI V GK S  KEVF DTLN SRDPD        +RY++R++LK+N LEQAFD L   G++MV +C S    A S + P +D     W  Y E+VF R
Sbjct:   23 IIELNVGGQVYVTRHTTLI-AVPDSLLWNMFSK--KTPAELARDSKGRFFLDRDGFLFRYILDYLR-----DLNLVLPDYFPEKSRLQREAEFFQLRDLSKLLSPKMSKDNSITDEICQSDSEEPSASATPVVGPETSRTLSVASSAHSPSLESRKSGYITVGYRGSYTMGRDIQTDAKFRRVARITVCGKTSLAKEVFGDTLNESRDPD-----RPPERYTSRYYLKYNFLEQAFDKLSEFGFQMV-ACSSTGTCAYSSSDPNED---KVWTSYTEYVFCR 287          
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Match: kctd12.1 (potassium channel tetramerisation domain containing 12.1 [Source:ZFIN;Acc:ZDB-GENE-030902-5])

HSP 1 Score: 155.992 bits (393), Expect = 3.575e-44
Identity = 101/282 (35.82%), Postives = 144/282 (51.06%), Query Frame = 3
Query:  411 VVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQH-----------------------IGPTV----------------------ITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            ++ELNVGG  Y +  +T +   P+S L ++  +  K P +   DSK R F+DR+G LFR+I+D+LR     +    LPD F E S L+ EA +F + ++ + L  ++                         +GP                        IT+GYRG++  GRD   D KFR+++RI V GK S  KEVF DTLN SRDPD        +RY++R++LK+N LEQAFD L   G++MV +C S    A S + P +D     W  Y E+VF R
Sbjct:   23 IIELNVGGQVYVTRHTTLI-AVPDSLLWNMFSK--KTPAELARDSKGRFFLDRDGFLFRYILDYLR-----DLNLVLPDYFPEKSRLQREAEFFQLRDLSKLLSPKMSKDNSITDEICQSDSEEPSASATPVVGPETSRTLSVASSAHSPSLESRKSGYITVGYRGSYTMGRDIQTDAKFRRVARITVCGKTSLAKEVFGDTLNESRDPD-----RPPERYTSRYYLKYNFLEQAFDKLSEFGFQMV-ACSSTGTCAYSSSDPNED---KVWTSYTEYVFCR 287          
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Match: kctd8 (potassium channel tetramerization domain containing 8 [Source:ZFIN;Acc:ZDB-GENE-060117-3])

HSP 1 Score: 149.828 bits (377), Expect = 6.429e-42
Identity = 96/277 (34.66%), Postives = 142/277 (51.26%), Query Frame = 3
Query:  408 KVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQHIGPT-----------------------------------------VITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVF 1115
            +VVELNVGG  Y + +ST V   P++ L ++  +    P +   DS+ R FIDR+G LFR+++DFLR     + +  LP+ F E   L+ EA +F + E++  L  R+   G                                            IT+GYRG++   RD  AD KFR+++RI+V G+++  KEVF DTLN SRDPD        ++Y++RF+LK   LEQAFD L   G++MV +C    NS G+     Q  ++  W  Y E++F
Sbjct:   19 EVVELNVGGQVYVTKRSTLV-SVPDTTLHTMFTRCT--PHELPRDSRGRFFIDRDGFLFRYVLDFLR-----DRQLVLPEHFPERERLQREAEHFQLGELLRLLGPRVAKQGSLNDEGCQSDIEESSQSSELVTRTGHHAINYATTSSTLDKRSGFITIGYRGSYTMVRDNQADAKFRRVARIMVCGRIALAKEVFGDTLNESRDPD-----RPPEKYTSRFYLKFTYLEQAFDRLSEAGFQMV-AC----NSTGTAAFVNQYRDDKIWSSYTEYIF 277          
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Match: zmat3 (zinc finger matrin-type 3 [Source:Xenbase;Acc:XB-GENE-1014344])

HSP 1 Score: 149.443 bits (376), Expect = 2.441e-41
Identity = 97/283 (34.28%), Postives = 139/283 (49.12%), Query Frame = 3
Query:  411 VVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRI---------------QHIGPTV-------------------------------ITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            ++ELNVGG  Y +   T V   P S L+ +  Q   +P     DSK R F+DR+G LFR+++D++R     + +  LPD F E   L+ EA +F + E+V+ L  ++               +   P V                               IT+GYRG++  GRD   D KFR+++RI+V GK S  KEVF DTLN SRDPD        +RY++R++LK   LEQAFD L   G+ MV    +GT +   D      +++  W  Y E+VF R
Sbjct:   42 IIELNVGGQVYITRYPTLV-SVPGSLLSEMFSQRNSRPLAR--DSKGRYFLDRDGFLFRYVLDYMR-----DQQLVLPDHFPERLRLQREAEFFRLPELVKILAPKVSKQNSIGDDAFQSDSEEQSPNVEVARNLASVSAALAAAAGNQSTMSDLRRSGFITIGYRGSYTLGRDSQTDAKFRRVARIMVCGKTSLAKEVFGDTLNDSRDPD-----RPPERYTSRYYLKFTFLEQAFDRLADAGFHMVACNSTGTCAFAHDQ-----TDDKIWTSYTEYVFYR 306          
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000022598.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV461789.1:4151:5778:-1 gene:ENSXETG00000010726.1 transcript:ENSXETT00000022598.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.436 bits (363), Expect = 1.030e-39
Identity = 94/263 (35.74%), Postives = 137/263 (52.09%), Query Frame = 3
Query:  414 VELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQHIGPT-----------------------------VITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVF 1115
            ++LNVGG  Y + K T +   P+S L S+  +      +   D++ R FIDR+G LFR+I+DFLR K+      +LPD F E   L  EA YF + ++V+ L  ++                                    IT+GYRG++   RD  AD KFR+++RI+V G+++  KEVF DTLN SRDPD        ++Y++RF+LK   LEQAFD L   G+ MV +C    NS G+     Q  ++  W  Y E++F
Sbjct:   10 IKLNVGGQVYVT-KHTTLTSVPDSTLYSMFNR--NNVKEMPRDNRARFFIDRDGFLFRYILDFLRDKQ-----LSLPDHFPEKERLLREAEYFQLGDLVKLLTPKVTKQSSLNDEGCQSDIEDSSQSSDLVRTAALDKKSGFITIGYRGSYTMVRDNQADAKFRRVARIMVCGRIALAKEVFGDTLNESRDPD-----RPPEKYTSRFYLKFTYLEQAFDRLSEAGFHMV-AC----NSTGTAAFVNQYRDDKIWSSYTEYIF 254          
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Match: lsm11 (LSM11, U7 small nuclear RNA associated [Source:Xenbase;Acc:XB-GENE-1007644])

HSP 1 Score: 145.976 bits (367), Expect = 6.453e-39
Identity = 99/270 (36.67%), Postives = 140/270 (51.85%), Query Frame = 3
Query:  408 KVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENL------------------------EKRI---QHIGPT-----VITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            +VVELNVGG  Y +  +T     P+S L  +         D   D+K R FIDR+G LFR+++D+LR     + +  LPD F E   LK EA YF + ++V+ L                        E RI     + P+      +T+GYRG+   GR+  AD KFR++ RILV G++S  KEVF DTLN SRDPD        ++Y++RF+LK   LE+AFD L   G+ MV       NS+ + +   Q +++  W  Y E+VF R
Sbjct:   25 EVVELNVGGQVYFTRHATLTS-IPHSLLWKMFTCKRDSVNDLAKDAKGRFFIDRDGFLFRYVLDYLR-----DRQVVLPDHFPERGRLKREAEYFQLPDLVKLLIPEEVKQSPDDYCHSDYEEVSQGSETRICPSASLMPSDRKWGFVTVGYRGSCTMGRESQADAKFRRVPRILVCGRISLAKEVFGDTLNESRDPD-----RAPEKYTSRFYLKFKHLERAFDMLSESGFLMV-----ACNSSVTASFVNQYTDDKIWSSYTEYVFYR 278          
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000008990.1 (potassium channel tetramerization domain containing 8 [Source:NCBI gene;Acc:100492650])

HSP 1 Score: 136.732 bits (343), Expect = 8.501e-36
Identity = 92/251 (36.65%), Postives = 131/251 (52.19%), Query Frame = 3
Query:  411 VVELNVGGITYASFKSTFVDQYPNSKLASLV-LQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYF------GINEMVENLEKRIQHIGPTV-------ITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            V+ELNVGG  Y + K T +   P+S L S+     VK+      D++ R FIDR+G LFR+I+DFLR K+                 L  EA YF      G    +E+  +    +           IT+GYRG++   RD  AD KFR+++RI+V G+++  KEVF DTLN SRDPD        ++Y++RF+LK   LEQAFD L   G+ MV    +GT +  +  R     ++  W  Y E++F R
Sbjct:   24 VIELNVGGQVYVT-KHTTLTSVPDSTLYSMFNRNNVKE---MPRDNRTRFFIDRDGFLFRYILDFLRDKQ-----------------LSLEAEYFHSLNDEGCQSDIEDSSQSSDLVRTAALDKKSGFITIGYRGSYTMVRDNQADAKFRRVARIMVCGRIALAKEVFGDTLNESRDPD-----RPPEKYTSRFYLKFTYLEQAFDRLSEAGFHMVACNSTGTAAFVNQYR-----DDKIWSSYTEYIFYR 243          
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Match: kctd12 (potassium channel tetramerization domain containing 12 [Source:NCBI gene;Acc:100125072])

HSP 1 Score: 114.005 bits (284), Expect = 4.812e-28
Identity = 58/123 (47.15%), Postives = 79/123 (64.23%), Query Frame = 3
Query:  753 ITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            IT+GYRG++  GR+  AD KFR+++RI V GK S  KEVF +TLN SRDPD        +RY++R++LK N LEQAFD L   G+ MV    +GT +  S+++    SE+  W  Y E+VF R
Sbjct:  210 ITVGYRGSYTIGREAQADAKFRRVARITVCGKTSLAKEVFGETLNESRDPD-----RPPERYTSRYYLKFNFLEQAFDKLSEAGFHMVACSSTGTCAFASNDQ----SEDKVWTSYTEYVFCR 323          

HSP 2 Score: 72.7886 bits (177), Expect = 1.324e-13
Identity = 42/104 (40.38%), Postives = 64/104 (61.54%), Query Frame = 3
Query:  408 KVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENL 719
            ++VELNVGG  Y +  +T V   P+S L  +  Q  ++P +   DSK R F+DR+G LFR+++D+LR     + +  LPD F E S L+ EA +F + E+V+ L
Sbjct:   32 EIVELNVGGQVYVTRHTTLV-SVPDSLLWRMFSQ--QKPGELARDSKGRFFLDRDGFLFRYVLDYLR-----DLQLVLPDYFPERSRLQREAEHFQLPELVKRL 127          
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Match: Kctd12b (potassium channel tetramerisation domain containing 12b [Source:MGI Symbol;Acc:MGI:2444667])

HSP 1 Score: 155.992 bits (393), Expect = 3.732e-44
Identity = 97/289 (33.56%), Postives = 143/289 (49.48%), Query Frame = 3
Query:  408 KVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKR---------------IQHIGPTV------------------------------------ITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            +++ELNVGG  Y +   T +   P S+L  +    VK P   + D+K R FIDR+G LFR+++D++R     + +  LPD F E   L  EA YF + E+ + L  +               ++ + P++                                    IT+GYRG++  GRD  AD KFR+++RI+V GK+S  KEVF DTLN SRDPD        +RY++R++LK   LEQAFD L   G+ MV    +GT +   D      +++  W  Y E+VF R
Sbjct:   21 EIIELNVGGQVYITRYPTLI-SIPGSRLWEMF--SVKNPCSLIQDNKGRFFIDRDGFLFRYVLDYMR-----DMQVVLPDHFPECGRLHREAEYFKLPELAKMLAPKMNKLNSIGNDSCPIDLEELSPSIDTTFNFSSTNSIHISGPDNPMVLRAAPGSELKKAGFITIGYRGSYTLGRDSQADAKFRRVARIMVCGKISLAKEVFGDTLNESRDPD-----RPPERYTSRYYLKFTFLEQAFDKLADAGFHMVACNSTGTCTVTHDQ-----TDDRIWTSYTEYVFYR 291          
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Match: Kctd12b (potassium channel tetramerisation domain containing 12b [Source:MGI Symbol;Acc:MGI:2444667])

HSP 1 Score: 155.992 bits (393), Expect = 3.732e-44
Identity = 97/289 (33.56%), Postives = 143/289 (49.48%), Query Frame = 3
Query:  408 KVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKR---------------IQHIGPTV------------------------------------ITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            +++ELNVGG  Y +   T +   P S+L  +    VK P   + D+K R FIDR+G LFR+++D++R     + +  LPD F E   L  EA YF + E+ + L  +               ++ + P++                                    IT+GYRG++  GRD  AD KFR+++RI+V GK+S  KEVF DTLN SRDPD        +RY++R++LK   LEQAFD L   G+ MV    +GT +   D      +++  W  Y E+VF R
Sbjct:   21 EIIELNVGGQVYITRYPTLI-SIPGSRLWEMF--SVKNPCSLIQDNKGRFFIDRDGFLFRYVLDYMR-----DMQVVLPDHFPECGRLHREAEYFKLPELAKMLAPKMNKLNSIGNDSCPIDLEELSPSIDTTFNFSSTNSIHISGPDNPMVLRAAPGSELKKAGFITIGYRGSYTLGRDSQADAKFRRVARIMVCGKISLAKEVFGDTLNESRDPD-----RPPERYTSRYYLKFTFLEQAFDKLADAGFHMVACNSTGTCTVTHDQ-----TDDRIWTSYTEYVFYR 291          
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Match: Kctd16 (potassium channel tetramerisation domain containing 16 [Source:MGI Symbol;Acc:MGI:1914659])

HSP 1 Score: 157.532 bits (397), Expect = 2.600e-43
Identity = 102/270 (37.78%), Postives = 138/270 (51.11%), Query Frame = 3
Query:  408 KVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQHIGPT--------------------------------VITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            +V+ELNVGG  Y +  ST +   P+S L  +         D   DSK R FIDR+G LFR+I+D+LR     + +  LPD F E   LK EA YF + ++V+ L        P                                  IT+GYRG+   GR+G AD KFR++ RILV G++S  KEVF +TLN SRDPD        +RY++RF+LK   LE+AFD L  CG+ MV       NS+ + +   Q +E+  W  Y E+VF R
Sbjct:   25 EVIELNVGGQVYFTRHSTLI-SIPHSLLWKMFSPKRDTANDLAKDSKGRFFIDRDGFLFRYILDYLR-----DRQVVLPDHFPERGRLKREAEYFQLPDLVKLLAPEDVKQSPDEFCHSDFEDASQGSDTRICPPSSLLPHDRKWGFITVGYRGSCTLGREGQADAKFRRVPRILVCGRISLAKEVFGETLNESRDPD-----RAPERYTSRFYLKFKHLERAFDMLSECGFHMV-----ACNSSVTASFVNQYTEDKIWSSYTEYVFYR 278          
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Match: Kctd16 (potassium channel tetramerisation domain containing 16 [Source:MGI Symbol;Acc:MGI:1914659])

HSP 1 Score: 157.532 bits (397), Expect = 2.600e-43
Identity = 102/270 (37.78%), Postives = 138/270 (51.11%), Query Frame = 3
Query:  408 KVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQHIGPT--------------------------------VITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            +V+ELNVGG  Y +  ST +   P+S L  +         D   DSK R FIDR+G LFR+I+D+LR     + +  LPD F E   LK EA YF + ++V+ L        P                                  IT+GYRG+   GR+G AD KFR++ RILV G++S  KEVF +TLN SRDPD        +RY++RF+LK   LE+AFD L  CG+ MV       NS+ + +   Q +E+  W  Y E+VF R
Sbjct:   25 EVIELNVGGQVYFTRHSTLI-SIPHSLLWKMFSPKRDTANDLAKDSKGRFFIDRDGFLFRYILDYLR-----DRQVVLPDHFPERGRLKREAEYFQLPDLVKLLAPEDVKQSPDEFCHSDFEDASQGSDTRICPPSSLLPHDRKWGFITVGYRGSCTLGREGQADAKFRRVPRILVCGRISLAKEVFGETLNESRDPD-----RAPERYTSRFYLKFKHLERAFDMLSECGFHMV-----ACNSSVTASFVNQYTEDKIWSSYTEYVFYR 278          
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Match: Kctd12 (potassium channel tetramerisation domain containing 12 [Source:MGI Symbol;Acc:MGI:2145823])

HSP 1 Score: 144.821 bits (364), Expect = 1.687e-39
Identity = 103/303 (33.99%), Postives = 139/303 (45.87%), Query Frame = 3
Query:  411 VVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLR-------------CKKNKESK-FNLPDTFRETSA----------------------LKNEAVYFGINEMVENLEKRIQHIGPTV------------------------------ITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            +VELNVGG  Y + + T V   P+S L  +  Q  +QP +   DSK R F+DR+G LFR+I+D+LR              +  +E++ F LP+  R   A                      L +E +  G  E             PT+                              IT+GYRG++  GRD  AD KFR+++RI V GK S  KEVF DTLN SRDPD        +RY++R++LK N LEQAFD L   G+ MV    +GT +  S       SE+  W  Y E+VF R
Sbjct:   35 IVELNVGGQVYVTRRCTVV-SVPDSLLWRMFTQ--QQPQELARDSKGRFFLDRDGFLFRYILDYLRDLQLVLPDYFPERSRLQREAEYFELPELVRRLGAPQQPGPGPPPPHSRRGVHKEGSLGDELLPLGYAEPEPQEGASAGAPSPTLELASRSPSGGAAGPLLTPSQSLDGSRRSGYITIGYRGSYTIGRDAQADAKFRRVARITVCGKTSLAKEVFGDTLNESRDPD-----RPPERYTSRYYLKFNFLEQAFDKLSESGFHMVACSSTGTCAFASST---DQSEDKIWTSYTEYVFCR 326          
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5DTY9|KCD16_MOUSE (BTB/POZ domain-containing protein KCTD16 OS=Mus musculus OX=10090 GN=Kctd16 PE=1 SV=2)

HSP 1 Score: 157.532 bits (397), Expect = 1.819e-42
Identity = 102/270 (37.78%), Postives = 138/270 (51.11%), Query Frame = 3
Query:  408 KVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQHIGPT--------------------------------VITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            +V+ELNVGG  Y +  ST +   P+S L  +         D   DSK R FIDR+G LFR+I+D+LR     + +  LPD F E   LK EA YF + ++V+ L        P                                  IT+GYRG+   GR+G AD KFR++ RILV G++S  KEVF +TLN SRDPD        +RY++RF+LK   LE+AFD L  CG+ MV       NS+ + +   Q +E+  W  Y E+VF R
Sbjct:   25 EVIELNVGGQVYFTRHSTLI-SIPHSLLWKMFSPKRDTANDLAKDSKGRFFIDRDGFLFRYILDYLR-----DRQVVLPDHFPERGRLKREAEYFQLPDLVKLLAPEDVKQSPDEFCHSDFEDASQGSDTRICPPSSLLPHDRKWGFITVGYRGSCTLGREGQADAKFRRVPRILVCGRISLAKEVFGETLNESRDPD-----RAPERYTSRFYLKFKHLERAFDMLSECGFHMV-----ACNSSVTASFVNQYTEDKIWSSYTEYVFYR 278          
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q68DU8|KCD16_HUMAN (BTB/POZ domain-containing protein KCTD16 OS=Homo sapiens OX=9606 GN=KCTD16 PE=1 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 7.701e-42
Identity = 104/270 (38.52%), Postives = 141/270 (52.22%), Query Frame = 3
Query:  408 KVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVE-----------------NLEKRIQ----HIGPT-----------VITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            +VVELNVGG  Y +  ST +   P+S L  +         D   DSK R FIDR+G LFR+I+D+LR     + +  LPD F E   LK EA YF + ++V+                 + E   Q     I P             IT+GYRG+   GR+G AD KFR++ RILV G++S  KEVF +TLN SRDPD        +RY++RF+LK   LE+AFD L  CG+ MV       NS+ + +   Q +++  W  Y E+VF R
Sbjct:   25 EVVELNVGGQVYFTRHSTLI-SIPHSLLWKMFSPKRDTANDLAKDSKGRFFIDRDGFLFRYILDYLR-----DRQVVLPDHFPEKGRLKREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSLLPADRKWGFITVGYRGSCTLGREGQADAKFRRVPRILVCGRISLAKEVFGETLNESRDPD-----RAPERYTSRFYLKFKHLERAFDMLSECGFHMV-----ACNSSVTASFINQYTDDKIWSSYTEYVFYR 278          
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96CX2|KCD12_HUMAN (BTB/POZ domain-containing protein KCTD12 OS=Homo sapiens OX=9606 GN=KCTD12 PE=1 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 1.366e-39
Identity = 103/301 (34.22%), Postives = 141/301 (46.84%), Query Frame = 3
Query:  411 VVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLR-------------CKKNKESK-FNLPDTFRETSA--------------------LKNEAVYFGINEMVENLEKRIQHIGPTV------------------------------ITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            +VELNVGG  Y + + T V   P+S L  +  Q  +QP +   DSK R F+DR+G LFR+I+D+LR              +  +E++ F LP+  R   A                    L +E +  G +E  +          PT+                              IT+GYRG++  GRD  AD KFR+++RI V GK S  KEVF DTLN SRDPD        +RY++R++LK N LEQAFD L   G+ MV    +GT +  S       SE+  W  Y E+VF R
Sbjct:   35 IVELNVGGQVYVTRRCTVV-SVPDSLLWRMFTQ--QQPQELARDSKGRFFLDRDGFLFRYILDYLRDLQLVLPDYFPERSRLQREAEYFELPELVRRLGAPQQPGPGPPPSRRGVHKEGSLGDELLPLGYSEPEQQEGASAGAPSPTLELASRSPSGGAAGPLLTPSQSLDGSRRSGYITIGYRGSYTIGRDAQADAKFRRVARITVCGKTSLAKEVFGDTLNESRDPD-----RPPERYTSRYYLKFNFLEQAFDKLSESGFHMVACSSTGTCAFASST---DQSEDKIWTSYTEYVFCR 324          
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6WVG3|KCD12_MOUSE (BTB/POZ domain-containing protein KCTD12 OS=Mus musculus OX=10090 GN=Kctd12 PE=1 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 5.153e-38
Identity = 102/303 (33.66%), Postives = 138/303 (45.54%), Query Frame = 3
Query:  411 VVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLR-------------CKKNKESK-FNLPDTFRETSA----------------------LKNEAVYFGINEMVENLEKRIQHIGPTV------------------------------ITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            +VELNVGG  Y + + T V   P+S L  +  Q  +QP +   DSK R F+DR+G  FR+I+D+LR              +  +E++ F LP+  R   A                      L +E +  G  E             PT+                              IT+GYRG++  GRD  AD KFR+++RI V GK S  KEVF DTLN SRDPD        +RY++R++LK N LEQAFD L   G+ MV    +GT +  S       SE+  W  Y E+VF R
Sbjct:   35 IVELNVGGQVYVTRRCTVV-SVPDSLLWRMFTQ--QQPQELARDSKGRFFLDRDGFFFRYILDYLRDLQLVLPDYFPERSRLQREAEYFELPELVRRLGAPQQPGPGPPPPHSRRGVHKEGSLGDELLPLGYAEPEPQEGASAGAPSPTLELASRSPSGGAAGPLLTPSQSLDGSRRSGYITIGYRGSYTIGRDAQADAKFRRVARITVCGKTSLAKEVFGDTLNESRDPD-----RPPERYTSRYYLKFNFLEQAFDKLSESGFHMVACSSTGTCAFASST---DQSEDKIWTSYTEYVFCR 326          
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6ZWB6|KCTD8_HUMAN (BTB/POZ domain-containing protein KCTD8 OS=Homo sapiens OX=9606 GN=KCTD8 PE=1 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 2.693e-23
Identity = 54/123 (43.90%), Postives = 77/123 (62.60%), Query Frame = 3
Query:  753 ITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            +TLGYRG++   RD  AD KFR+++RI+V G+++  KEVF DTLN SRDPD      + ++Y++RF+LK   LEQAFD L   G+ MV    SGT +  +  R     ++  W  Y E++F R
Sbjct:  209 LTLGYRGSYTTVRDNQADAKFRRVARIMVCGRIALAKEVFGDTLNESRDPD-----RQPEKYTSRFYLKFTYLEQAFDRLSEAGFHMVACNSSGTAAFVNQYR-----DDKIWSSYTEYIFFR 321          

HSP 2 Score: 67.781 bits (164), Expect = 5.756e-11
Identity = 42/113 (37.17%), Postives = 64/113 (56.64%), Query Frame = 3
Query:  408 KVVELNVGGITYASFKSTFVDQYPNSKLASLVLQY-----VKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRI 731
            +VVELNVGG  Y +  ST +   P+S LAS+          ++  +   DS+ R FIDR+G LFR+++D+LR K     +  LP+ F E   L  EA YF + ++V+ L  ++
Sbjct:   44 EVVELNVGGQVYVTKHSTLL-SVPDSTLASMFSPSSPRGGARRRGELPRDSRARFFIDRDGFLFRYVLDYLRDK-----QLALPEHFPEKERLLREAEYFQLTDLVKLLSPKV 150          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: A0A0L8G5C0 (BTB domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22000108mg PE=4 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 1.984e-75
Identity = 138/264 (52.27%), Postives = 170/264 (64.39%), Query Frame = 3
Query:  387 MSSKSDD--KVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEK-----------------RIQHIGPTVITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            MS K+ D  +++ELNVGG++Y +  +T   + P+S L+ +     K P   L DSK + F+DR+G LFR+I+D+LR       K  LP+ F E   LK EA YF +  +V NL                    I    P  IT+GYRGTFAFGRDGLADVKFRKL+RI+V GKVS C+EVFQDTLN SRDPD G      DRY++RFFLKH  LEQAFD L   G+ M GSCGSGTNSAG + +PG D+EESKWQHYNEF+F R
Sbjct:    1 MSEKAADLPEILELNVGGVSYTTTLNTLRKE-PDSLLSQMFSNSGKTPI--LRDSKGKFFLDRDGVLFRYILDYLR-----NQKLILPENFHEKDRLKTEAEYFRLPNLVRNLSTISVSRSIGQSTNVCCNGLITGKQPGYITVGYRGTFAFGRDGLADVKFRKLARIIVCGKVSLCREVFQDTLNESRDPDRGTE----DRYTSRFFLKHTFLEQAFDMLVEQGFYMAGSCGSGTNSAG-EIKPGLDTEESKWQHYNEFIFER 251          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: A0A267FLD9 (BTB_2 domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014324g1 PE=4 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 1.315e-74
Identity = 129/251 (51.39%), Postives = 172/251 (68.53%), Query Frame = 3
Query:  384 KMSSKSDD---KVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSL-VDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQHIGPTVITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVRM 1124
            +M+++  D    VVELNVGG  ++  ++T   + P S+L+     +   P   L  DS  R FIDR+G  F  ++++LR   ++ + F+LP  F   S L+ EA ++G+   V  LE+         IT+ YRGTFAFGRDGLADVKFRKL+RILV+G+VS C+ VF DTLN SRDPD G    + DRY++RFFLKH+VLEQAF+ LY  G+ MVGSCGSGTNS+ +D +PGQD+EE+KWQHYNEFVFVR+
Sbjct:   20 RMATQPGDWAGGVVELNVGGSHFSCSRATLCSE-PGSRLSEW---FSGDPAKHLPADSAGRFFIDRDGPAFGQLLNYLR---DRPAGFHLPAGFSGRSRLRQEAAFYGLQGAVAALERGGPAAPSGCITVSYRGTFAFGRDGLADVKFRKLTRILVAGRVSVCRAVFGDTLNESRDPDRG----QEDRYTSRFFLKHSVLEQAFEMLYDAGFSMVGSCGSGTNSSMTDVKPGQDNEETKWQHYNEFVFVRV 259          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: U5EF17 (Putative potassium channel tetramerisation domain protein (Fragment) OS=Corethrella appendiculata OX=1370023 PE=2 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 1.432e-74
Identity = 132/240 (55.00%), Postives = 164/240 (68.33%), Query Frame = 3
Query:  411 VVELNVGGITYAS-FKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQHIGPTVITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGS--DNRPGQDSEESKWQHYNEFVFVR 1121
            V+ELNVGG+ Y +  K+   DQ  NSKL  L   +  +  D   D+K R+FIDR+G LFR+I+D+LR     +S   LPD FRE   LK EA YF +N  +  + ++   + P  IT+GYRG+F FGRDGLADVKFRKLSRILV G+V  C+EVF DTLN SRDPD G      DRY+ARFFLKH  +EQAFDAL   G+K+ GSCGSGT  AGS  + +PG D EE++W HYNEFVF+R
Sbjct:    3 VIELNVGGVHYTTTLKTLLSDQ--NSKLHEL---FSGKADDVTKDTKGRIFIDRDGVLFRYILDYLR-----DSTIVLPDGFREKDRLKKEAEYFKLNSFIRAINEQ-PSLMPGCITVGYRGSFQFGRDGLADVKFRKLSRILVCGRVVLCREVFGDTLNESRDPDHGGP----DRYTARFFLKHAFIEQAFDALQENGFKLAGSCGSGTAGAGSAAELKPGVDHEENRWNHYNEFVFIR 227          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: A0A1A9V4Y8 (BTB_2 domain-containing protein OS=Glossina austeni OX=7395 PE=4 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 2.892e-74
Identity = 118/238 (49.58%), Postives = 168/238 (70.59%), Query Frame = 3
Query:  408 KVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQHIGPTVITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            +++ELNVGG+ Y    +T +D     K +SL+ +   +  D L D+K R F+DR+G LFR+I+D+LR     + + NLP+ FRE   L+ EA+++ +N M++ + +  +   P  IT+GYRG+F FG+DGLADVKFRKLSRILV G+V+ C+EVF DTLN SRDPD G      +RY++RFFLKH  +EQAFD L+  G++M GSCGSGT  + ++ +PG D+EE++W HYNEFVF+R
Sbjct:    3 EIIELNVGGVHY----TTTMDSLLQDK-SSLLCELFSKKDDLLKDAKGRYFLDRDGVLFRYILDYLR-----DKQLNLPEGFREKQRLQKEAMHYKLNGMLDCMRRERESRTPGCITIGYRGSFQFGKDGLADVKFRKLSRILVCGRVALCREVFGDTLNESRDPDHGGI----NRYTSRFFLKHCFIEQAFDMLHEQGFRMAGSCGSGTAGSAAEPKPGVDAEENRWNHYNEFVFIR 226          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: A0A1A9Z7D2 (BTB_2 domain-containing protein OS=Glossina pallidipes OX=7398 PE=4 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 2.988e-74
Identity = 118/238 (49.58%), Postives = 168/238 (70.59%), Query Frame = 3
Query:  408 KVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQHIGPTVITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            +++ELNVGG+ Y    +T +D     K +SL+ +   +  D L D+K R F+DR+G LFR+I+D+LR     + + NLP+ FRE   L+ EA+++ +N M++ + +  +   P  IT+GYRG+F FG+DGLADVKFRKLSRILV G+V+ C+EVF DTLN SRDPD G      +RY++RFFLKH  +EQAFD L+  G++M GSCGSGT  + ++ +PG D+EE++W HYNEFVF+R
Sbjct:    3 EIIELNVGGVHY----TTTMDSLLQDK-SSLLCEMFSKKDDLLKDAKGRYFLDRDGVLFRYILDYLR-----DKQLNLPEGFREKQRLQKEAMHYKLNGMLDCMRRERESRTPGCITIGYRGSFQFGKDGLADVKFRKLSRILVCGRVALCREVFGDTLNESRDPDHGGI----NRYTSRFFLKHCFIEQAFDMLHEQGFRMAGSCGSGTAGSAAEPKPGVDAEENRWNHYNEFVFIR 226          
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Match: kctd12.1 (potassium channel tetramerisation domain containing 12.1 [Source:ZFIN;Acc:ZDB-GENE-030902-5])

HSP 1 Score: 164.081 bits (414), Expect = 1.788e-47
Identity = 108/277 (38.99%), Postives = 146/277 (52.71%), Query Frame = 3
Query:  408 KVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQ----------HI--------GPT---------------------VITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            +++ELNVGG  Y +   T V   P+S L S+  +  K P +   DSK R F+DR+G LFR+I+D+LR     +    LPD F E S L+ EA +F + E+ + L  R+           HI        GP                       IT+GYRG++  GRD   D KFR+++RI V GK S  KEVF +TLN SRDPD        +RY++R++LK+N LEQAFD L   G++MV +C S    A S N P   SE+  W  Y E+VF R
Sbjct:   15 EIIELNVGGQVYVTRHRTLV-SVPDSLLWSMFSK--KTPRELARDSKGRFFLDRDGFLFRYILDYLR-----DLNLVLPDYFPEKSRLQREAEFFQLRELSKRLSPRVSKENSISEDLSHISSDWDEAPGPGGALLPPSTSPSPSQENKKSCGYITVGYRGSYTIGRDIQTDAKFRRVARITVCGKTSLAKEVFGETLNESRDPD-----RPPERYTSRYYLKYNFLEQAFDKLTEFGFRMV-ACSSTGTCAYSSNEP---SEDKVWTSYTEYVFCR 274          
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Match: KCTD12 (potassium channel tetramerization domain containing 12 [Source:HGNC Symbol;Acc:HGNC:14678])

HSP 1 Score: 161.384 bits (407), Expect = 2.318e-46
Identity = 104/289 (35.99%), Postives = 143/289 (49.48%), Query Frame = 3
Query:  408 KVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENL---------------------------------------------------EKRIQHIGPTVITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            ++VELNVGG  Y + +ST V   P+S L  +  Q  + P +   D+K R F+DR+G LFR+I+D+LR     +    LPD FRE + L+ EA +F + E+   L                                                   E R   +    IT+GYRG++  GRD   D KFR+++RI V GK S  KEVF DTLN SRDPD        +RY++R++LK+N LEQAFD L   G++MV +C S    A + N P +D     W  Y E+VF R
Sbjct:   13 ELVELNVGGQVYVTRRSTLV-SVPDSLLGRMFGQ--QSPAELSTDTKGRFFLDRDGFLFRYILDYLR-----DGNLVLPDYFRERAGLRREAEFFQLRELARRLAPQVSKENSISDEAQGEHDHDDVCGGGSVGSIGSIGSALPTTSTTSTIALTEPRSPSLKCGYITIGYRGSYTIGRDIQTDAKFRRVARITVCGKTSLAKEVFGDTLNESRDPD-----RPPERYTSRYYLKYNFLEQAFDRLAEMGFRMV-ACSSTGTCAYTSNDPNED---KIWTSYTEYVFCR 284          
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Match: kctd12b (potassium channel tetramerisation domain containing 12b [Source:ZFIN;Acc:ZDB-GENE-050417-104])

HSP 1 Score: 159.844 bits (403), Expect = 4.998e-46
Identity = 99/265 (37.36%), Postives = 140/265 (52.83%), Query Frame = 3
Query:  390 SSKSDDKVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRI---------------QHIGPTV------ITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            SS     ++ELNVGG  Y +  ST     P+S L  +  Q  K       D+K R F+DR+G LFR+I+D++R     + +  LPD F E   L+ EA YF + E+V+ L  +I               +   P+       IT+GYRG++  GRD   D KFR+++RI+V GK S  KEVF +TLN SRDPD        +RY++R++LK   LEQAFD L   G+ MV    +GT +   D      +++  W  Y E+VF R
Sbjct:    8 SSSPRRSIIELNVGGQVYITRYSTLT-SVPDSLLWEMFSQ--KSQKGLARDTKGRFFVDRDGFLFRYILDYMR-----DQQLVLPDHFPERGRLQREAEYFNLPELVKLLAPKISKQNSLGDEGCQSDPEESSPSADTRSGFITIGYRGSYTLGRDSQTDAKFRRVARIMVCGKTSLAKEVFGETLNESRDPD-----RPPERYTSRYYLKFTFLEQAFDKLADAGFHMVACNSTGTCAFAHDQ-----TDDKIWTSYTEYVFYR 254          
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Match: kctd8 (potassium channel tetramerization domain containing 8 [Source:NCBI gene;Acc:103044733])

HSP 1 Score: 142.895 bits (359), Expect = 2.678e-39
Identity = 91/279 (32.62%), Postives = 141/279 (50.54%), Query Frame = 3
Query:  408 KVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQHIGPT-------------------------------------------VITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVF 1115
            +V+ELNVGG  Y + ++T +   P++ L ++  +  + P +   DS+ R FIDR+G LFR+++DFLR     + +  LP+ F E   L+ EA +F + E++  L  ++   G                                              IT+GYRG++   RD   D KFR+++RI+V G+++  KEVF DTLN SRDPD        ++Y++RF+LK   LEQAFD L   G+ MV +C    NS G+     Q  ++  W  Y E++F
Sbjct:   21 EVIELNVGGQVYVTKRATLLS-VPDTPLHAMFAR--RAPRELPRDSRGRFFIDRDGFLFRYVLDFLR-----DRQLVLPEHFPERERLQREAEHFQLGELLRILGPKVAKQGSLNDEGCQSDIEESSQSSELQLGRTSGSGAVSGPFSSTAQDKRSGFITIGYRGSYTMVRDNQTDAKFRRVARIMVCGRIALAKEVFGDTLNESRDPD-----RPPEKYTSRFYLKFTHLEQAFDRLSESGFNMV-AC----NSTGTAAFVNQYRDDKIWSSYTEYIF 281          
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Match: kctd8 (potassium channel tetramerization domain containing 8 [Source:NCBI gene;Acc:103044733])

HSP 1 Score: 142.51 bits (358), Expect = 6.341e-39
Identity = 91/279 (32.62%), Postives = 141/279 (50.54%), Query Frame = 3
Query:  408 KVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQHIGPT-------------------------------------------VITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVF 1115
            +V+ELNVGG  Y + ++T +   P++ L ++  +  + P +   DS+ R FIDR+G LFR+++DFLR     + +  LP+ F E   L+ EA +F + E++  L  ++   G                                              IT+GYRG++   RD   D KFR+++RI+V G+++  KEVF DTLN SRDPD        ++Y++RF+LK   LEQAFD L   G+ MV +C    NS G+     Q  ++  W  Y E++F
Sbjct:   21 EVIELNVGGQVYVTKRATLLS-VPDTPLHAMFAR--RAPRELPRDSRGRFFIDRDGFLFRYVLDFLR-----DRQLVLPEHFPERERLQREAEHFQLGELLRILGPKVAKQGSLNDEGCQSDIEESSQSSELQLGRTSGSGAVSGPFSSTAQDKRSGFITIGYRGSYTMVRDNQTDAKFRRVARIMVCGRIALAKEVFGDTLNESRDPD-----RPPEKYTSRFYLKFTHLEQAFDRLSESGFNMV-AC----NSTGTAAFVNQYRDDKIWSSYTEYIF 281          
BLAST of BTB domain-containing protein vs. Ensembl Sea Lamprey
Match: kctd12b (potassium channel tetramerisation domain containing 12b [Source:ZFIN;Acc:ZDB-GENE-050417-104])

HSP 1 Score: 107.071 bits (266), Expect = 1.446e-26
Identity = 59/127 (46.46%), Postives = 77/127 (60.63%), Query Frame = 3
Query:  744 PTVITLGYRGTFAFGRDG-LADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            P  IT+GYRG++   RD   AD KFR+++RI+V GK +  KEVF +TLN SRDPD        +RY++R++LK   LEQAFD L   G+ MV       NS GS    G  SE+  W +Y E+VF R
Sbjct:  193 PGFITVGYRGSYTVARDSQAADAKFRRVARIMVCGKTALAKEVFGETLNESRDPD-----RPPERYTSRYYLKFTFLEQAFDRLAEAGFHMV-----ACNSNGSAAYAGDLSEDRIWTNYTEYVFFR 309          

HSP 2 Score: 62.7734 bits (151), Expect = 2.516e-11
Identity = 41/113 (36.28%), Postives = 61/113 (53.98%), Query Frame = 3
Query:  408 KVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRL------FIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKR 728
            +V+ELNVGG  Y +  +T V   P+S L  +           L+D   R       FIDR+G LFR+I+D+LR     +++  LP+ F E S L+ EA +FG+ E+  +L  R
Sbjct:   20 EVIELNVGGQVYLTRCATLVSA-PDSLLGRIF--------SCLIDRACRFRTLLCYFIDRDGFLFRYILDYLR-----DNRLVLPEHFPERSRLQREAEFFGLPELARSLAPR 118          
BLAST of BTB domain-containing protein vs. Ensembl Sea Lamprey
Match: kctd6a (potassium channel tetramerization domain containing 6a [Source:ZFIN;Acc:ZDB-GENE-050208-474])

HSP 1 Score: 58.9214 bits (141), Expect = 2.804e-10
Identity = 35/104 (33.65%), Postives = 61/104 (58.65%), Query Frame = 3
Query:  414 VELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEK 725
            V LNVGG  Y++ ++T   +Y +S L ++    +  PT    D++   FIDR+G LFR++++FLR      S+  LP  F+E   L+ EA ++ I ++++ L +
Sbjct:   14 VTLNVGGHLYSTSRATLT-RYSDSMLGAMFSGDL--PTAR--DAQGHYFIDRDGPLFRYVLNFLRT-----SELTLPQDFKEIDLLRKEADFYQIEQLIQCLNE 107          
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Match: EDO34699 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNM1])

HSP 1 Score: 178.718 bits (452), Expect = 5.652e-54
Identity = 109/244 (44.67%), Postives = 143/244 (58.61%), Query Frame = 3
Query:  411 VVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQHIGPT-------VITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            VVELNVGG  Y +   T +     S L+S+     K P DS    + R FIDR+G LFR+I+D+LR       K  LP+ F E   L  EA +F +  MV  +++   +I  T        I++G RGT+AFGRDG+ADVKFRKL RILV G V+  +EVF D+LN +RDPD         RY+ RF+LKH+ LE+AFD L   GY MV S   G   AG D     ++EE+KW H+N++VF R
Sbjct:   16 VVELNVGGQLYTTSLPTLLKD-SESLLSSMFSGRQKIPRDS----RGRFFIDRDGVLFRYILDYLR-----NCKLALPEGFNERERLTMEAEHFKLKGMVRAIQREKDNIKSTDKGRPSGYISIGVRGTYAFGRDGVADVKFRKLQRILVCGNVALAREVFGDSLNETRDPD-----RDDQRYTNRFYLKHSYLEKAFDQLMEKGYTMVTSSAGG---AGYD----PENEETKWNHFNDYVFFR 237          
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Match: EDO38835 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBR2])

HSP 1 Score: 147.902 bits (372), Expect = 3.391e-42
Identity = 92/245 (37.55%), Postives = 134/245 (54.69%), Query Frame = 3
Query:  414 VELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQ-HIGPTV--------ITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            +ELNVGG  +++  S F        L   +    +   D   D+  + FIDR+G LFR+I+D+LR K       ++P+ F E   LK EA ++ + ++ + L++     I P +        I+L  R TFAFGR G ADV FRKL RI V G+VS  KE F D+LNM+RDP+          Y++RF+LK+N LE+AF  L+  G+++V S G  T    S       S+E KW+H+  + FVR
Sbjct:    5 IELNVGGKYFST--SVFTLTRIKDSLLGRIFSGRQSELDK--DNSGKYFIDRDGFLFRYILDYLRSKA-----LHIPEKFDEIERLKMEADFYELEDLRQRLDRLTSGEISPKISEGGKHGYISLHIRSTFAFGRSGQADVNFRKLQRICVCGRVSLLKEAFGDSLNMTRDPN-----QNAMHYTSRFYLKYNQLERAFMQLHSSGFEIVSSEGGKTGDVASPK-----SDEEKWEHFTIYYFVR 230          
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Match: EDO43731 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXW1])

HSP 1 Score: 57.3806 bits (137), Expect = 1.141e-10
Identity = 37/100 (37.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query:  414 VELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVE 713
            V LNVGG  Y S   T + QYP S LA +    +  P D     K + FIDR+GA FR+I+ FLR       K  +P+ ++    L  EA ++ +  +VE
Sbjct:    1 VSLNVGGYNYTSTAYT-LTQYPKSVLAQMCNGIIPVPRDL----KGQQFIDRDGATFRYILTFLRT-----GKLTVPEGYKYFRELLTEAEFYRLEPLVE 90          
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Match: EDO32194 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVR4])

HSP 1 Score: 55.0694 bits (131), Expect = 9.040e-10
Identity = 34/105 (32.38%), Postives = 60/105 (57.14%), Query Frame = 3
Query:  411 VVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEK 725
            +++LNVGG  + +     +  +P+S L S+    +  P +   DS  R FIDR+G LFR+I++FLR      +  +LP  F++   L NEA ++ I  ++E +++
Sbjct:   10 IIDLNVGG-NHFTTTLLTLTTFPDSMLGSMFSGRI--PVNR--DSNGRFFIDRDGTLFRYILNFLRS-----NVLSLPANFKDYELLLNEADFYQIEPLIEEIKR 104          
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Match: EDO28987 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVR4])

HSP 1 Score: 55.0694 bits (131), Expect = 9.040e-10
Identity = 34/105 (32.38%), Postives = 60/105 (57.14%), Query Frame = 3
Query:  411 VVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEK 725
            +++LNVGG  + +     +  +P+S L S+    +  P +   DS  R FIDR+G LFR+I++FLR      +  +LP  F++   L NEA ++ I  ++E +++
Sbjct:   10 IIDLNVGG-NHFTTTLLTLTTFPDSMLGSMFSGRI--PVNR--DSNGRFFIDRDGTLFRYILNFLRS-----NVLSLPANFKDYELLLNEADFYQIEPLIEEIKR 104          
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Match: kctd12.2 (potassium channel tetramerisation domain containing 12.2 [Source:ZFIN;Acc:ZDB-GENE-060117-4])

HSP 1 Score: 160.614 bits (405), Expect = 2.531e-46
Identity = 104/272 (38.24%), Postives = 140/272 (51.47%), Query Frame = 3
Query:  393 SKSDDKVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEK-----------------------------RIQHIGPTVITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            S   D  +ELNVGG  Y +   T     PNS L     Q    P++   D   R F DR+G LFR+I+D+LR     +++  LP+ F+E   L+ EA +F + E+ + L +                             R    G   IT+GYRG++  GRD  AD KFR+++RI V  K+S  KEVF +TLN SRDPD        D+Y+AR++LK+N LEQAFD L   G+ MV    +GT S GS N PG+D     W  Y E+VF R
Sbjct:    3 SARADATLELNVGGQVYVTRLETLT-AVPNSLLWVRFTQ--SSPSELPKDRHGRFFFDRDGHLFRYILDYLR-----DTELFLPEFFKERKRLQREADFFQLPELAKRLAEAAYPEDGGDPEEAELGSPVCSSTSSERALRSPGSGSGYITIGYRGSYTIGRDIQADAKFRRVARITVCSKISLAKEVFGETLNESRDPD-----RPPDKYTARYYLKYNFLEQAFDRLAEAGFHMVACNSTGTCSYGS-NDPGED---KLWTSYTEYVFCR 257          
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Match: kctd12.1 (potassium channel tetramerisation domain containing 12.1 [Source:ZFIN;Acc:ZDB-GENE-030902-5])

HSP 1 Score: 153.295 bits (386), Expect = 4.326e-43
Identity = 101/285 (35.44%), Postives = 145/285 (50.88%), Query Frame = 3
Query:  408 KVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRI-------QHI---------------------------------GPTV-------ITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            +++ELNVGG  Y +   T V   P+S L ++  +  K P +   DSK R F+DR+G LFR+I+D+LR     +    LPD F E S L+ EA +F + ++ + L  R+       + I                                  P++       IT+GYRG++  GRD   D KFR+++RI V GK S  KEVF +TLN SRDPD        +RY++R++LK+N LEQAFD L   G+ MV +C S    A + N P +D     W  Y E+VF +
Sbjct:   22 EIIELNVGGQVYVTRHKTLV-AVPDSLLWNMFSK--KSPKELARDSKGRFFLDRDGFLFRYILDYLR-----DLNLVLPDYFPEKSRLQREADFFQLRDLAKRLSPRVSKDNSICEEIINQSDTEDGGLQCCSTSGGIDTLRAASVSGAMRSPSLDSRKSGYITIGYRGSYTIGRDIQTDAKFRRVARITVCGKTSLAKEVFGETLNESRDPD-----RPPERYTSRYYLKYNFLEQAFDKLTEAGFHMV-ACSSTGTCAYTSNDPNED---KIWTSYTEYVFFK 289          
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Match: kctd16b (potassium channel tetramerization domain containing 16 [Source:NCBI gene;Acc:101171513])

HSP 1 Score: 151.754 bits (382), Expect = 2.512e-41
Identity = 98/269 (36.43%), Postives = 136/269 (50.56%), Query Frame = 3
Query:  411 VVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQHIGPT--------------------------------VITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            VVELNVGG  Y +  +T V   P+S L  L         D   D K R FIDR+G LFR+++D+LR     + +  LPD F E   L+ EA YF + ++V+ L        P                                  IT+GYRG+   GR+   D KFR++ RIL+ G+V+  KEVF +TLN SRDPD        DRY++RF+LK   LE++FD L  CG++MV +C S   ++  +    Q +E+  W  Y E+VF R
Sbjct:   28 VVELNVGGQVYYTRHATLVST-PSSLLGKLFSSKKDAGNDLARDPKGRYFIDRDGFLFRYVLDYLR-----DKQVVLPDHFPEKGRLRKEAEYFQLPDLVKLLTTEDVKFSPDDYILSDYEDGSQGSDHRQCPPPSLVPADRKSGYITVGYRGSCTTGRESQTDAKFRRVPRILICGRVALAKEVFGETLNESRDPD-----RTPDRYTSRFYLKFKHLERSFDMLSECGFQMV-ACNSSVTASFVN----QHTEDKNWSSYTEYVFYR 280          
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Match: kctd12b (BTB/POZ domain-containing protein KCTD12 [Source:NCBI gene;Acc:101170105])

HSP 1 Score: 150.214 bits (378), Expect = 2.167e-40
Identity = 96/283 (33.92%), Postives = 139/283 (49.12%), Query Frame = 3
Query:  408 KVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQH-------------------------------------IGPTV--------ITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            +++ELNVGG  Y +  ST     P+S L  +  Q  K       D+K R F+DR+G LFR+I+D++R     + +  LPD F E   L+ EA +F + E+V+ L  +I                                       +GP          IT+GYRG++  GRD   D KFR+++RI+V GK S  KEVF +TLN SRDPD        +RY++R++LK   LEQAFD L   G+ MV    +GT +   +      +++  W  Y E+VF R
Sbjct:   17 EIIELNVGGQVYITRYSTLT-SVPDSLLWEMFSQ--KSAKGLARDTKGRFFVDRDGFLFRYILDYMR-----DQQLVLPDHFPERGRLQREAEFFNLPELVKQLAPKISKQNSLGDEGCQSDPEDSSPGMDTVRSLGSLGATATCSSLGPVAMDGKRSGFITIGYRGSYTLGRDSHTDAKFRRVARIMVCGKTSLAKEVFGETLNESRDPD-----RPPERYTSRYYLKFTFLEQAFDKLADAGFHMVACNSTGTCAFAHEQ-----TDDKIWTSYTEYVFYR 281          
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Match: kctd16a (BTB/POZ domain-containing protein KCTD16 [Source:NCBI gene;Acc:101167549])

HSP 1 Score: 121.324 bits (303), Expect = 3.401e-30
Identity = 86/266 (32.33%), Postives = 128/266 (48.12%), Query Frame = 3
Query:  411 VVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQHIGPT----------------------------VITLGYRGTFAF-GRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            V+ELNVGG  Y +  +T     PNS L  L         D   D + R FIDR+G LFR+++D+LR     + +  LPD F E   LK EA +F + E+V+ L      + P                              IT+ + G  A   R+G  + K +KL RI +S ++   KEVF D LN ++D D        DRY+ RF+LK   LE+AFD L  CG+ +V    S T+S+      G  +++  W ++++++F R
Sbjct:   25 VIELNVGGQVYYTRHATLT-SIPNSLLGKLFSNKKGSLNDLSRDLRGRYFIDRDGFLFRYVLDYLR-----DKQVVLPDHFPERGRLKREAEHFQLPELVKLLSADESKLFPDDLYCSDLEDASQCSERFYSSFSFDRRYGYITVTFIGACAARSREGHTETKNKKLPRIFISSRIGLAKEVFGDALNENKDAD-----RPSDRYTCRFYLKFKHLERAFDMLSECGFHIVACNTSLTSSSM-----GHYTDDRAWSNHSQYIFYR 274          
BLAST of BTB domain-containing protein vs. Planmine SMEST
Match: SMESG000017289.1 (SMESG000017289.1)

HSP 1 Score: 478.019 bits (1229), Expect = 2.039e-170
Identity = 240/272 (88.24%), Postives = 247/272 (90.81%), Query Frame = 3
Query:  387 MSSKSDDKVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQHIGPTVITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVRM*TGFTC--------KFWISITYYTAY 1178
            MSSKSDDKVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQHIGPTVITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEE K  +Y   +++ +   F C         FW S+    A+
Sbjct:    1 MSSKSDDKVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQHIGPTVITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEE-KMDNYCLVLYLWI--FFLCVVDMDKRTPFWDSVKVQAAH 269          
BLAST of BTB domain-containing protein vs. Planmine SMEST
Match: SMESG000014239.1 (SMESG000014239.1)

HSP 1 Score: 265.774 bits (678), Expect = 1.156e-87
Identity = 136/240 (56.67%), Postives = 176/240 (73.33%), Query Frame = 3
Query:  405 DKVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQHIGPTVITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVRM 1124
            D +V LNVGG  Y + K+T + +  NS    L+ +     +D    +K ++FIDR+G+LFRF+++FLR       +  LP  F E   LK EA+Y+ + EM+  ++++     P+VIT+GYRGTFAFGRDGLADVKFRKLSRILVSGKV+ C+EVF+DTLN SRDPD G+    GDRYS+R+FLKHN+LEQAF+ LY  GY MV SCGSGTNS+GS+ +PGQDSEE+KWQHYNEFVF R+
Sbjct:    2 DSIVHLNVGGTNYMTLKTTLL-KCTNSIFPELLDK--SSFSDPNTGAK-KIFIDRDGSLFRFVLEFLRI-----GRVELPSNFGELQLLKREAIYYKLTEMMNQIDEK----SPSVITVGYRGTFAFGRDGLADVKFRKLSRILVSGKVNACREVFKDTLNDSRDPDNGF----GDRYSSRYFLKHNILEQAFEMLYDAGYAMVASCGSGTNSSGSEIKPGQDSEENKWQHYNEFVFSRL 224          
BLAST of BTB domain-containing protein vs. Planmine SMEST
Match: SMESG000025160.1 (SMESG000025160.1)

HSP 1 Score: 226.483 bits (576), Expect = 1.796e-71
Identity = 126/265 (47.55%), Postives = 162/265 (61.13%), Query Frame = 3
Query:  402 DDKVVELNVGGITYASFKSTFVDQYPNSKLASLVLQY---------VKQPTDSLVD----SKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEKRIQHIGPTV-----------ITLGYRGTFAFGRDGLADVKFRKLSRILVSGKVSPCKEVFQDTLNMSRDPD-CGYAGSKGDRYSARFFLKHNVLEQAFDALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVR 1121
            D+K+V+LNVGG  Y++  ST + Q PNS LA +             V  P  SLVD    S N  FIDR+G LF+FI+++LR       +  LPD F E + LKNE  ++ I     N++    HI   +           IT+GY+GTFAFGRDG+ DVKFRKL RIL++G  S C+ VF+DTLN +RDP+ C       DRYS+RF+LKHN LE AFD LY  G+ MVGSCGS T+   S+ +P   SEES+WQHYNEF+F R
Sbjct:   25 DEKIVQLNVGGQDYSTLLSTLIKQ-PNSWLAKMFYPLQNSFDLSFSVSLPNKSLVDLPKDSDNHYFIDRDGYLFQFILEYLRT-----DRLFLPDNFDEITRLKNEFQFYKIKFTDLNIDSHKLHISRDIALSSWTDKSKSITVGYQGTFAFGRDGVVDVKFRKLYRILIAGHASLCRWVFEDTLNDNRDPERCS-----EDRYSSRFYLKHNSLETAFDMLYAKGFDMVGSCGSNTHGGSSETKPSHHSEESRWQHYNEFIFAR 278          
BLAST of BTB domain-containing protein vs. Planmine SMEST
Match: SMESG000017037.1 (SMESG000017037.1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.194e-13
Identity = 38/106 (35.85%), Postives = 64/106 (60.38%), Query Frame = 3
Query:  405 DKVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLE 722
            +KV  +NVGGI + +  ST   +YPNS +A + +  +  P    +DS   +F+DR+G LF ++++FLR          LPD F   ++L+ EA Y+G++E++E L+
Sbjct:   15 NKVYTINVGGIIHTTTLSTLC-RYPNSMIARMFIGSI--PPSQSIDSNGNIFLDRDGVLFGYVLNFLRS-----GVLTLPDGFHSFNSLQIEADYYGLDELLEALK 112          
BLAST of BTB domain-containing protein vs. Planmine SMEST
Match: SMESG000071877.1 (SMESG000071877.1)

HSP 1 Score: 55.8398 bits (133), Expect = 1.667e-8
Identity = 66/233 (28.33%), Postives = 94/233 (40.34%), Query Frame = 3
Query:  414 VELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSLVDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAVYFGINEMVENLEK----RIQHIGPTVITLGYRGTF--------AFGRDGLADVKFRKL----------SRILVSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARF----FLKHNVLEQAFDALYLCGYKMVGSCGSG 1034
            V L+VGG  Y +   T      NSKLA L    +    D L   K   FIDR+G LFR I++FLRC     S+ +L   F E   L  EA YF +  M+E L+     R +  G +++       F           R     V   +            RIL+SG       +F + L  + +       S  D+Y  R     +L  N +E   + ++  G + V SCG G
Sbjct:   60 VHLDVGGTIYTTTLITLTKYT-NSKLAQLFNGTLPVVLDEL---KQHYFIDRDGTLFRHILNFLRC-----SQCHLKPDFPELDQLLEEASYFELEPMLEQLKNLKSIRDKQTGNSLVPDNSNAKFDIESKKPKQLKRTTTCQVNQNRCLVVSTSPELQERILISGSRILINRIFPN-LQAAIEKYSPNNWSSTDKYWIRLPLNGYLSMNSIE-TLETIFQFGMEFVASCGLG 281          
The following BLAST results are available for this feature:
BLAST of BTB domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCTD161.604e-4238.52potassium channel tetramerization domain containin... [more]
KCTD161.604e-4238.52potassium channel tetramerization domain containin... [more]
KCTD122.844e-4034.22potassium channel tetramerization domain containin... [more]
KCTD85.608e-2443.90potassium channel tetramerization domain containin... [more]
KCTD11.877e-1430.41potassium channel tetramerization domain containin... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VM106R.14.476e-5138.73pep chromosome:WBcel235:II:10827716:10829556:-1 ge... [more]
F32B4.54.542e-1442.42pep chromosome:WBcel235:I:11517769:11520660:-1 gen... [more]
F32B4.54.403e-1139.33pep chromosome:WBcel235:I:11517769:11519193:-1 gen... [more]
F32B4.54.403e-1139.33pep chromosome:WBcel235:I:11517748:11520597:-1 gen... [more]
F22E5.128.038e-927.68pep chromosome:WBcel235:II:2646328:2646843:-1 gene... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ktl1.349e-7650.21gene:FBgn0038839 transcript:FBtr0347575[more]
Ktl1.349e-7650.21gene:FBgn0038839 transcript:FBtr0083986[more]
twz2.369e-935.92gene:FBgn0034636 transcript:FBtr0071692[more]
twz2.464e-935.92gene:FBgn0034636 transcript:FBtr0308642[more]
CG146479.936e-732.77gene:FBgn0037244 transcript:FBtr0290222[more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kctd12.25.559e-4937.63potassium channel tetramerisation domain containin... [more]
kctd12.25.559e-4937.63potassium channel tetramerisation domain containin... [more]
kctd12.13.575e-4435.82potassium channel tetramerisation domain containin... [more]
kctd12.13.575e-4435.82potassium channel tetramerisation domain containin... [more]
kctd86.429e-4234.66potassium channel tetramerization domain containin... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zmat32.441e-4134.28zinc finger matrin-type 3 [Source:Xenbase;Acc:XB-G... [more]
ENSXETT00000022598.11.030e-3935.74pep primary_assembly:Xenopus_tropicalis_v9.1:KV461... [more]
lsm116.453e-3936.67LSM11, U7 small nuclear RNA associated [Source:Xen... [more]
ENSXETT00000008990.18.501e-3636.65potassium channel tetramerization domain containin... [more]
kctd124.812e-2847.15potassium channel tetramerization domain containin... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kctd12b3.732e-4433.56potassium channel tetramerisation domain containin... [more]
Kctd12b3.732e-4433.56potassium channel tetramerisation domain containin... [more]
Kctd162.600e-4337.78potassium channel tetramerisation domain containin... [more]
Kctd162.600e-4337.78potassium channel tetramerisation domain containin... [more]
Kctd121.687e-3933.99potassium channel tetramerisation domain containin... [more]
back to top
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5DTY9|KCD16_MOUSE1.819e-4237.78BTB/POZ domain-containing protein KCTD16 OS=Mus mu... [more]
sp|Q68DU8|KCD16_HUMAN7.701e-4238.52BTB/POZ domain-containing protein KCTD16 OS=Homo s... [more]
sp|Q96CX2|KCD12_HUMAN1.366e-3934.22BTB/POZ domain-containing protein KCTD12 OS=Homo s... [more]
sp|Q6WVG3|KCD12_MOUSE5.153e-3833.66BTB/POZ domain-containing protein KCTD12 OS=Mus mu... [more]
sp|Q6ZWB6|KCTD8_HUMAN2.693e-2343.90BTB/POZ domain-containing protein KCTD8 OS=Homo sa... [more]
back to top
BLAST of BTB domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L8G5C01.984e-7552.27BTB domain-containing protein OS=Octopus bimaculoi... [more]
A0A267FLD91.315e-7451.39BTB_2 domain-containing protein (Fragment) OS=Macr... [more]
U5EF171.432e-7455.00Putative potassium channel tetramerisation domain ... [more]
A0A1A9V4Y82.892e-7449.58BTB_2 domain-containing protein OS=Glossina austen... [more]
A0A1A9Z7D22.988e-7449.58BTB_2 domain-containing protein OS=Glossina pallid... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kctd12.11.788e-4738.99potassium channel tetramerisation domain containin... [more]
KCTD122.318e-4635.99potassium channel tetramerization domain containin... [more]
kctd12b4.998e-4637.36potassium channel tetramerisation domain containin... [more]
kctd82.678e-3932.62potassium channel tetramerization domain containin... [more]
kctd86.341e-3932.62potassium channel tetramerization domain containin... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
kctd12b1.446e-2646.46potassium channel tetramerisation domain containin... [more]
kctd6a2.804e-1033.65potassium channel tetramerization domain containin... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO346995.652e-5444.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388353.391e-4237.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437311.141e-1037.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO321949.040e-1032.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289879.040e-1032.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kctd12.22.531e-4638.24potassium channel tetramerisation domain containin... [more]
kctd12.14.326e-4335.44potassium channel tetramerisation domain containin... [more]
kctd16b2.512e-4136.43potassium channel tetramerization domain containin... [more]
kctd12b2.167e-4033.92BTB/POZ domain-containing protein KCTD12 [Source:N... [more]
kctd16a3.401e-3032.33BTB/POZ domain-containing protein KCTD16 [Source:N... [more]
back to top
BLAST of BTB domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017289.12.039e-17088.24SMESG000017289.1[more]
SMESG000014239.11.156e-8756.67SMESG000014239.1[more]
SMESG000025160.11.796e-7147.55SMESG000025160.1[more]
SMESG000017037.11.194e-1335.85SMESG000017037.1[more]
SMESG000071877.11.667e-828.33SMESG000071877.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032297 ID=SMED30032297|Name=BTB domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1214bp
CGACAGGAATTTTCTGAAAATTGAAGATTATAGAAATTATCAAGAAATTA
ATCGTAATTTAATTAAATTAATAAAAATTAACAAAAGCGGAATATCGAGT
TCAGTTGGTAAACACGCACAATTTATCGATTAATGTTTCATTAACGATTC
CATCATGCTTCAGCCAGAAAATCGACGGGGATTTTTTCACCACTTGCGAC
GACTCACTGAGCGTGTGTGTGTGTACGCGTGGGTGAGTGGGTGTGTATGC
CATTGGAGTGTGTGTTTAGATGTCTGTAATTTGTCTGCGATGCCACTCGA
CAATTCCTGTTCTCTCGAATGCAGGTAAAACAGCTATTAAAATCTTGTTA
CAAACCAGTTGAGTTCATCTCATATTTTTCCATAAAATGTCGAGCAAATC
AGATGACAAAGTCGTGGAACTCAATGTCGGTGGTATAACATACGCCTCGT
TCAAGTCGACCTTTGTCGACCAGTATCCGAACTCAAAGCTTGCGAGTCTC
GTGCTGCAATATGTCAAGCAGCCGACAGATTCTCTGGTCGATTCGAAGAA
CCGACTCTTCATAGATCGGAACGGAGCACTTTTTCGATTCATTATTGATT
TTTTGAGATGTAAAAAAAATAAAGAATCAAAATTCAATCTTCCAGACACG
TTTCGAGAAACTTCAGCATTGAAAAATGAGGCAGTGTACTTTGGAATTAA
TGAAATGGTGGAGAATTTAGAGAAAAGAATACAACATATCGGACCAACTG
TCATCACGCTTGGCTACCGGGGCACTTTTGCCTTTGGAAGGGATGGATTA
GCCGATGTTAAATTTAGAAAATTGTCAAGAATTCTTGTCAGTGGAAAAGT
TTCTCCTTGCAAAGAAGTTTTCCAAGATACTTTGAACATGAGTAGGGATC
CAGATTGTGGATATGCAGGTTCCAAAGGTGACAGATATTCAGCACGTTTC
TTTCTCAAACATAACGTCCTGGAACAGGCTTTTGATGCGCTATACTTGTG
TGGATATAAAATGGTTGGTTCTTGTGGATCTGGTACGAATTCGGCTGGCT
CAGACAATCGGCCTGGACAAGATTCAGAGGAAAGTAAGTGGCAGCATTAC
AACGAATTTGTATTTGTGAGAATGTAGACAGGATTTACTTGTAAATTTTG
GATTTCGATTACTTATTACACAGCTTATCATGGACACGGGACCATTTTTG
GTGACCATAAATAT
back to top

protein sequence of SMED30032297-orf-1

>SMED30032297-orf-1 ID=SMED30032297-orf-1|Name=SMED30032297-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=247bp
MSSKSDDKVVELNVGGITYASFKSTFVDQYPNSKLASLVLQYVKQPTDSL
VDSKNRLFIDRNGALFRFIIDFLRCKKNKESKFNLPDTFRETSALKNEAV
YFGINEMVENLEKRIQHIGPTVITLGYRGTFAFGRDGLADVKFRKLSRIL
VSGKVSPCKEVFQDTLNMSRDPDCGYAGSKGDRYSARFFLKHNVLEQAFD
ALYLCGYKMVGSCGSGTNSAGSDNRPGQDSEESKWQHYNEFVFVRM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR003131T1-type_BTB
IPR011333SKP1/BTB/POZ_sf
Vocabulary: biological process
TermDefinition
GO:0051260protein homooligomerization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.710.10coord: 1..119
e-value: 1.8E-24
score: 87.8
NoneNo IPR availablePANTHERPTHR14499:SF82GH08630Pcoord: 2..245
NoneNo IPR availablePANTHERPTHR14499POTASSIUM CHANNEL TETRAMERIZATION DOMAIN-CONTAININGcoord: 2..245
NoneNo IPR availableCDDcd18367BTB_POZ_KCTD8-likecoord: 9..111
e-value: 9.5559E-26
score: 95.0507
IPR003131Potassium channel tetramerisation-type BTB domainPFAMPF02214BTB_2coord: 10..108
e-value: 4.9E-11
score: 42.8
IPR011333SKP1/BTB/POZ domain superfamilySUPERFAMILYSSF54695POZ domaincoord: 7..116