COP9 signalosome complex subunit 2

Overview
NameCOP9 signalosome complex subunit 2
Smed IDSMED30032295
Length (bp)1549
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of COP9 signalosome complex subunit 2 (SMED30032295) t-SNE clustered cells

Violin plots show distribution of expression levels for COP9 signalosome complex subunit 2 (SMED30032295) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of COP9 signalosome complex subunit 2 (SMED30032295) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for COP9 signalosome complex subunit 2 (SMED30032295) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032295

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30032295SMESG000023422.1 SmedASXL_007923SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30032295SMESG000023422.1 SmedASXL_007923SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
muscle cellSMED30032295SMESG000023422.1 dd_Smed_v4_4989_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032295SMESG000023422.1 dd_Smed_v4_4989_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Human
Match: COPS2 (COP9 signalosome subunit 2 [Source:HGNC Symbol;Acc:HGNC:30747])

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 297/421 (70.55%), Postives = 354/421 (84.09%), Query Frame = 1
Query:   64 IEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVID-EPRKEAKYKSLDKLISEIDKLHH 1323
            +EYS + NSEP+VDLENQYY++K+LKE +P +A+  F+KVL++E  GE+GEWGFKALKQ+IKI+F+L N  EMM  Y QLLTYIRSAVTRNYSEKSINSILDY+STSKQM +LQ+FY TTLEALK+A+N+RLWFKTNTKLGKLYLE  ++  L +I+++L QSCQT+DGEDDL+KGTQLLEIYALEIQMYT Q+NNKKLK LYEQSLHIKSAIPHPLIMG+IRECGGKMHLR+GEF+KAHTDFFEAFKNYDESGS RRT CLKYLVL+NML KS INPFDSQE KPY+++PEI+AMTNLVSAYQ NDI  FE  L  N   IM DPFIREHIEELLRNIR  VLI L+KPY  + I F+++ LNI   +VESLLV CI DN I G+IDQ + +L +D + R  A+Y +LDK  ++++ L+ 
Sbjct:   18 LEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELE--GEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQ 436          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Human
Match: COPS2 (COP9 signalosome subunit 2 [Source:HGNC Symbol;Acc:HGNC:30747])

HSP 1 Score: 610.527 bits (1573), Expect = 0.000e+0
Identity = 297/428 (69.39%), Postives = 354/428 (82.71%), Query Frame = 1
Query:   64 IEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQ-------MTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVID-EPRKEAKYKSLDKLISEIDKLHH 1323
            +EYS + NSEP+VDLENQYY++K+LKE +P +A+  F+KVL++E  GE+GEWGFKALKQ+IKI+F+L N  EMM  Y QLLTYIRSAVTRNYSEKSINSILDY+STSKQ       M +LQ+FY TTLEALK+A+N+RLWFKTNTKLGKLYLE  ++  L +I+++L QSCQT+DGEDDL+KGTQLLEIYALEIQMYT Q+NNKKLK LYEQSLHIKSAIPHPLIMG+IRECGGKMHLR+GEF+KAHTDFFEAFKNYDESGS RRT CLKYLVL+NML KS INPFDSQE KPY+++PEI+AMTNLVSAYQ NDI  FE  L  N   IM DPFIREHIEELLRNIR  VLI L+KPY  + I F+++ LNI   +VESLLV CI DN I G+IDQ + +L +D + R  A+Y +LDK  ++++ L+ 
Sbjct:   18 LEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELE--GEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQNSDFLCQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQ 443          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Human
Match: COPS2 (COP9 signalosome subunit 2 [Source:HGNC Symbol;Acc:HGNC:30747])

HSP 1 Score: 527.709 bits (1358), Expect = 0.000e+0
Identity = 255/356 (71.63%), Postives = 297/356 (83.43%), Query Frame = 1
Query:  256 FRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVID-EPRKEAKYKSLDKLISEIDKLH 1320
            + L N  EMM  Y QLLTYIRSAVTRNYSEKSINSILDY+STSKQM +LQ+FY TTLEALK+A+N+RLWFKTNTKLGKLYLE  ++  L +I+++L QSCQT+DGEDDL+KGTQLLEIYALEIQMYT Q+NNKKLK LYEQSLHIKSAIPHPLIMG+IRECGGKMHLR+GEF+KAHTDFFEAFKNYDESGS RRT CLKYLVL+NML KS INPFDSQE KPY+++PEI+AMTNLVSAYQ NDI  FE  L  N   IM DPFIREHIEELLRNIR  VLI L+KPY  + I F+++ LNI   +VESLLV CI DN I G+IDQ + +L +D + R  A+Y +LDK  ++++ L+
Sbjct:   16 YDLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLN 371          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Human
Match: COPS2 (COP9 signalosome subunit 2 [Source:HGNC Symbol;Acc:HGNC:30747])

HSP 1 Score: 403.675 bits (1036), Expect = 3.199e-139
Identity = 190/248 (76.61%), Postives = 224/248 (90.32%), Query Frame = 1
Query:   64 IEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFK 807
            +EYS + NSEP+VDLENQYY++K+LKE +P +A+  F+KVL++E  GE+GEWGFKALKQ+IKI+F+L N  EMM  Y QLLTYIRSAVTRNYSEKSINSILDY+STSKQM +LQ+FY TTLEALK+A+N+RLWFKTNTKLGKLYLE  ++  L +I+++L QSCQT+DGEDDL+KGTQLLEIYALEIQMYT Q+NNKKLK LYEQSLHIKSAIPHPLIMG+IRECGGKMHLR+GEF+KAHTDFFEAFK
Sbjct:   18 LEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELE--GEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFK 263          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Human
Match: COPS2 (COP9 signalosome subunit 2 [Source:HGNC Symbol;Acc:HGNC:30747])

HSP 1 Score: 281.182 bits (718), Expect = 1.700e-92
Identity = 134/168 (79.76%), Postives = 151/168 (89.88%), Query Frame = 1
Query:  256 FRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLR 759
            + L N  EMM  Y QLLTYIRSAVTRNYSEKSINSILDY+STSKQM +LQ+FY TTLEALK+A+N+RLWFKTNTKLGKLYLE  ++  L +I+++L QSCQT+DGEDDL+KGTQLLEIYALEIQMYT Q+NNKKLK LYEQSLHIKSAIPHPLIMG+IRECGGKMHLR
Sbjct:   16 YDLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLR 183          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Celegans
Match: csn-2 (COP9 signalosome complex subunit 2 [Source:UniProtKB/Swiss-Prot;Acc:O01422])

HSP 1 Score: 525.783 bits (1353), Expect = 0.000e+0
Identity = 255/413 (61.74%), Postives = 323/413 (78.21%), Query Frame = 1
Query:   61 SIEYSSEDNSEPDVDLENQYYHAKSLKEANPLS-AIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYE---QSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVIDEPRKEAKYKSL 1287
              EY  +  SEPDVD+ENQYY AK L+    L  AI+ F+KVL++E  GE+GEWGFKALKQ+IKI F  N  ++M+  Y QLLTYI+SAVT+NYSEKSIN+ILDY+STS+QM +LQ FY TTL+ALK+A+NERLWFKTNTKLGKL+ +++++  L +I+K+L+ SC+   GE+D RKGTQLLEIYALEIQMYT Q+NNK LK +YE   Q++H KSAIPHPLI+G IRECGGKMHLR G F  AHTDFFEAFKNYDESGS RRT CLKYLVL+NML KS INPFDSQE KP+++ PEIVAMT +V AYQ NDI+ FE  +  ++D+IM DPFIREH EEL+ NIR  VL+ L++PY  VRI +L+Q+L +S  EV  LLV  I D+ ++ KI+++S ++ + + +K+    SL
Sbjct:   13 GFEYEDDSGSEPDVDMENQYYTAKGLRSDGKLDEAIKSFEKVLELE--GEKGEWGFKALKQMIKITFGQNRLEKMLEYYRQLLTYIKSAVTKNYSEKSINAILDYISTSRQMDLLQHFYETTLDALKDAKNERLWFKTNTKLGKLFFDLHEFTKLEKIVKQLKVSCKNEQGEEDQRKGTQLLEIYALEIQMYTEQKNNKALKWVYELATQAIHTKSAIPHPLILGTIRECGGKMHLRDGRFLDAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLIKSDINPFDSQEAKPFKNEPEIVAMTQMVQAYQDNDIQAFEQIMAAHQDSIMADPFIREHTEELMNNIRTQVLLRLIRPYTNVRISYLSQKLKVSQKEVIHLLVDAILDDGLEAKINEESGMIEMPKNKKKMMVTSL 423          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Celegans
Match: csn-2 (COP9 signalosome complex subunit 2 [Source:UniProtKB/Swiss-Prot;Acc:O01422])

HSP 1 Score: 525.783 bits (1353), Expect = 0.000e+0
Identity = 255/413 (61.74%), Postives = 323/413 (78.21%), Query Frame = 1
Query:   61 SIEYSSEDNSEPDVDLENQYYHAKSLKEANPLS-AIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYE---QSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVIDEPRKEAKYKSL 1287
              EY  +  SEPDVD+ENQYY AK L+    L  AI+ F+KVL++E  GE+GEWGFKALKQ+IKI F  N  ++M+  Y QLLTYI+SAVT+NYSEKSIN+ILDY+STS+QM +LQ FY TTL+ALK+A+NERLWFKTNTKLGKL+ +++++  L +I+K+L+ SC+   GE+D RKGTQLLEIYALEIQMYT Q+NNK LK +YE   Q++H KSAIPHPLI+G IRECGGKMHLR G F  AHTDFFEAFKNYDESGS RRT CLKYLVL+NML KS INPFDSQE KP+++ PEIVAMT +V AYQ NDI+ FE  +  ++D+IM DPFIREH EEL+ NIR  VL+ L++PY  VRI +L+Q+L +S  EV  LLV  I D+ ++ KI+++S ++ + + +K+    SL
Sbjct:   13 GFEYEDDSGSEPDVDMENQYYTAKGLRSDGKLDEAIKSFEKVLELE--GEKGEWGFKALKQMIKITFGQNRLEKMLEYYRQLLTYIKSAVTKNYSEKSINAILDYISTSRQMDLLQHFYETTLDALKDAKNERLWFKTNTKLGKLFFDLHEFTKLEKIVKQLKVSCKNEQGEEDQRKGTQLLEIYALEIQMYTEQKNNKALKWVYELATQAIHTKSAIPHPLILGTIRECGGKMHLRDGRFLDAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLIKSDINPFDSQEAKPFKNEPEIVAMTQMVQAYQDNDIQAFEQIMAAHQDSIMADPFIREHTEELMNNIRTQVLLRLIRPYTNVRISYLSQKLKVSQKEVIHLLVDAILDDGLEAKINEESGMIEMPKNKKKMMVTSL 423          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Celegans
Match: rpn-6.2 (Probable 26S proteasome regulatory subunit rpn-6.2 [Source:UniProtKB/Swiss-Prot;Acc:P34481])

HSP 1 Score: 74.7146 bits (182), Expect = 3.734e-15
Identity = 42/173 (24.28%), Postives = 92/173 (53.18%), Query Frame = 1
Query:  766 EFDKAHTDFFEAFKNYDESGSQ-RRTQCLKYLVLSNML---TKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVIDEPRKEA 1272
            ++  + + F+EAF+ +   G +   T  LKY++L  ++   T+       ++EI  Y+ +P I+A+ ++  A++   +K F   L E++  +++D  +  H + L RN+    +  +++PY  + + ++A+ + ++   VE  +   I D  + G IDQ  D +V+  P+ +A
Sbjct:   13 DYKTSFSYFYEAFEGFASIGDKINATSALKYMILCKIMLNETEQLAGLLAAKEIVAYQKSPRIIAIRSMADAFRKRSLKDFVKALAEHKIELVEDKVVAVHSQNLERNMLEKEISRVIEPYSEIELSYIARVIGMTVPPVERAIARMILDKKLMGSIDQHGDTVVV-YPKADA 184          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Celegans
Match: rpn-6.2 (Probable 26S proteasome regulatory subunit rpn-6.2 [Source:UniProtKB/Swiss-Prot;Acc:P34481])

HSP 1 Score: 76.2554 bits (186), Expect = 1.004e-14
Identity = 75/348 (21.55%), Postives = 154/348 (44.25%), Query Frame = 1
Query:  304 LTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLE-------ALKEARNERLWFKTN-----TKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQM--------YTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMH-LRQGEFDKAHTDFFEAFKNYDESGSQ-RRTQCLKYLVLSNML---TKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVIDEPRKEA 1272
            +T IR+ V      +SI S  D V  ++   +++      L        AL   + E++   TN     T   + +L  +    L+R+  ++R          DL K  + LE   L I++        + +    K    L     +  SA   P +   +    G ++   + ++  + + F+EAF+ +   G +   T  LKY++L  ++   T+       ++EI  Y+ +P I+A+ ++  A++   +K F   L E++  +++D  +  H + L RN+    +  +++PY  + + ++A+ + ++   VE  +   I D  + G IDQ  D +V+  P+ +A
Sbjct:   47 ITGIRTLV------ESIRSFYDLVGKARASKLIRDIVEHALTIDQGVGPALDHGKKEKIDLLTNCIGWATSNKREFLRRSLQARLIRLYNDIRDFTNAQKLAQDLSKELKKLEDRELLIEVSVEESKSSFNLNNLAKAKTALLTAKTNTNSAFASPQLQASVDMQSGVLYSAEERDYKTSFSYFYEAFEGFASIGDKINATSALKYMILCKIMLNETEQLAGLLAAKEIVAYQKSPRIIAIRSMADAFRKRSLKDFVKALAEHKIELVEDKVVAVHSQNLERNMLEKEISRVIEPYSEIELSYIARVIGMTVPPVERAIARMILDKKLMGSIDQHGDTVVV-YPKADA 387          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Celegans
Match: rpn-6.1 (Probable 26S proteasome regulatory subunit rpn-6.1 [Source:UniProtKB/Swiss-Prot;Acc:Q20938])

HSP 1 Score: 59.6918 bits (143), Expect = 2.087e-9
Identity = 44/167 (26.35%), Postives = 81/167 (48.50%), Query Frame = 1
Query:  766 EFDKAHTDFFEAFKNYDESGSQRRT-QCLKYLVLSNMLT--KSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVIDE 1257
            +F  A + F+EAF+ YD    +      LKY++L  ++      +N   S ++    +  ++ AM  + +A Q   +K F+         +  DP +R+H   L   +    L  +++PY  V+IE +AQ++ I  ++VE  L   I D  + G +DQ   +L++ E
Sbjct:  221 DFKTAFSYFYEAFEGYDSVDEKVSALTALKYMLLCKVMLDLPDEVNSLLSAKLALKYNGSDLDAMKAIAAAAQKRSLKDFQVAFGSFPQELQMDPVVRKHFHSLSERMLEKDLCRIIEPYSFVQIEHVAQQIGIDRSKVEKKLSQMILDQKLSGSLDQGEGMLIVFE 387          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Fly
Match: alien (gene:FBgn0013746 transcript:FBtr0339550)

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 291/421 (69.12%), Postives = 352/421 (83.61%), Query Frame = 1
Query:   61 SIEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVIDEPRKEA-KYKSLDKLISEIDKLH 1320
             +EYS + NSEPDVDLENQYY++K+LKE  P +A+  F+KVL +E+ GE+GEWGFKALKQ+IKI+FRL N DEMM  Y QLLTYI+SAVTRN+SEKSINSILDY+STSK M +LQ FY TTL+AL++A+N+RLWFKTNTKLGKLY + + +  L +I+K+L QSCQT+DGEDDL+KGTQLLEIYALEIQMYT+Q+NNKKLK LYEQSLHIKSAIPHPLIMG+IRECGGKMHLR+GEF+KAHTDFFEAFKNYDESGS RRT CLKYLVL+NML KS INPFDSQE KPY+++PEI+AMTNLV++YQ NDI  FE+ L ++   IM D FIREHIE+LLRNIR  VLI L++PYK + I F+A  LNI   EVESLLVSCI D+ IKG+IDQ + +L +D+    A +Y +L+K  ++I  L 
Sbjct:   17 GLEYSEDSNSEPDVDLENQYYNSKALKEEEPKAALASFQKVLDLEN-GEKGEWGFKALKQMIKINFRLCNYDEMMVRYKQLLTYIKSAVTRNHSEKSINSILDYISTSKNMALLQNFYETTLDALRDAKNDRLWFKTNTKLGKLYFDRSDFTKLQKILKQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTVQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVNSYQNNDINEFETILRQHRSNIMADQFIREHIEDLLRNIRTQVLIKLIRPYKNIAIPFIANALNIEPAEVESLLVSCILDDTIKGRIDQVNQVLQLDKINSSASRYNALEKWSNQIQSLQ 436          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Fly
Match: alien (gene:FBgn0013746 transcript:FBtr0343095)

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 291/421 (69.12%), Postives = 352/421 (83.61%), Query Frame = 1
Query:   61 SIEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVIDEPRKEA-KYKSLDKLISEIDKLH 1320
             +EYS + NSEPDVDLENQYY++K+LKE  P +A+  F+KVL +E+ GE+GEWGFKALKQ+IKI+FRL N DEMM  Y QLLTYI+SAVTRN+SEKSINSILDY+STSK M +LQ FY TTL+AL++A+N+RLWFKTNTKLGKLY + + +  L +I+K+L QSCQT+DGEDDL+KGTQLLEIYALEIQMYT+Q+NNKKLK LYEQSLHIKSAIPHPLIMG+IRECGGKMHLR+GEF+KAHTDFFEAFKNYDESGS RRT CLKYLVL+NML KS INPFDSQE KPY+++PEI+AMTNLV++YQ NDI  FE+ L ++   IM D FIREHIE+LLRNIR  VLI L++PYK + I F+A  LNI   EVESLLVSCI D+ IKG+IDQ + +L +D+    A +Y +L+K  ++I  L 
Sbjct:   17 GLEYSEDSNSEPDVDLENQYYNSKALKEEEPKAALASFQKVLDLEN-GEKGEWGFKALKQMIKINFRLCNYDEMMVRYKQLLTYIKSAVTRNHSEKSINSILDYISTSKNMALLQNFYETTLDALRDAKNDRLWFKTNTKLGKLYFDRSDFTKLQKILKQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTVQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVNSYQNNDINEFETILRQHRSNIMADQFIREHIEDLLRNIRTQVLIKLIRPYKNIAIPFIANALNIEPAEVESLLVSCILDDTIKGRIDQVNQVLQLDKINSSASRYNALEKWSNQIQSLQ 436          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Fly
Match: alien (gene:FBgn0013746 transcript:FBtr0079780)

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 291/421 (69.12%), Postives = 352/421 (83.61%), Query Frame = 1
Query:   61 SIEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVIDEPRKEA-KYKSLDKLISEIDKLH 1320
             +EYS + NSEPDVDLENQYY++K+LKE  P +A+  F+KVL +E+ GE+GEWGFKALKQ+IKI+FRL N DEMM  Y QLLTYI+SAVTRN+SEKSINSILDY+STSK M +LQ FY TTL+AL++A+N+RLWFKTNTKLGKLY + + +  L +I+K+L QSCQT+DGEDDL+KGTQLLEIYALEIQMYT+Q+NNKKLK LYEQSLHIKSAIPHPLIMG+IRECGGKMHLR+GEF+KAHTDFFEAFKNYDESGS RRT CLKYLVL+NML KS INPFDSQE KPY+++PEI+AMTNLV++YQ NDI  FE+ L ++   IM D FIREHIE+LLRNIR  VLI L++PYK + I F+A  LNI   EVESLLVSCI D+ IKG+IDQ + +L +D+    A +Y +L+K  ++I  L 
Sbjct:   17 GLEYSEDSNSEPDVDLENQYYNSKALKEEEPKAALASFQKVLDLEN-GEKGEWGFKALKQMIKINFRLCNYDEMMVRYKQLLTYIKSAVTRNHSEKSINSILDYISTSKNMALLQNFYETTLDALRDAKNDRLWFKTNTKLGKLYFDRSDFTKLQKILKQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTVQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVNSYQNNDINEFETILRQHRSNIMADQFIREHIEDLLRNIRTQVLIKLIRPYKNIAIPFIANALNIEPAEVESLLVSCILDDTIKGRIDQVNQVLQLDKINSSASRYNALEKWSNQIQSLQ 436          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Fly
Match: alien (gene:FBgn0013746 transcript:FBtr0079781)

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 291/421 (69.12%), Postives = 352/421 (83.61%), Query Frame = 1
Query:   61 SIEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVIDEPRKEA-KYKSLDKLISEIDKLH 1320
             +EYS + NSEPDVDLENQYY++K+LKE  P +A+  F+KVL +E+ GE+GEWGFKALKQ+IKI+FRL N DEMM  Y QLLTYI+SAVTRN+SEKSINSILDY+STSK M +LQ FY TTL+AL++A+N+RLWFKTNTKLGKLY + + +  L +I+K+L QSCQT+DGEDDL+KGTQLLEIYALEIQMYT+Q+NNKKLK LYEQSLHIKSAIPHPLIMG+IRECGGKMHLR+GEF+KAHTDFFEAFKNYDESGS RRT CLKYLVL+NML KS INPFDSQE KPY+++PEI+AMTNLV++YQ NDI  FE+ L ++   IM D FIREHIE+LLRNIR  VLI L++PYK + I F+A  LNI   EVESLLVSCI D+ IKG+IDQ + +L +D+    A +Y +L+K  ++I  L 
Sbjct:   17 GLEYSEDSNSEPDVDLENQYYNSKALKEEEPKAALASFQKVLDLEN-GEKGEWGFKALKQMIKINFRLCNYDEMMVRYKQLLTYIKSAVTRNHSEKSINSILDYISTSKNMALLQNFYETTLDALRDAKNDRLWFKTNTKLGKLYFDRSDFTKLQKILKQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTVQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVNSYQNNDINEFETILRQHRSNIMADQFIREHIEDLLRNIRTQVLIKLIRPYKNIAIPFIANALNIEPAEVESLLVSCILDDTIKGRIDQVNQVLQLDKINSSASRYNALEKWSNQIQSLQ 436          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Fly
Match: Rpn6 (gene:FBgn0028689 transcript:FBtr0087475)

HSP 1 Score: 67.781 bits (164), Expect = 7.271e-12
Identity = 52/224 (23.21%), Postives = 103/224 (45.98%), Query Frame = 1
Query:  598 LLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAI-PHPLIMGIIRECGGKMHLR-QGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSA--INPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVIDE 1257
            L+E+  LE + Y    N  K +     +    +AI   P + G +    G +H   + +F  A + F+EAF+ +D   S +    LKY++L  ++   +  +N   S ++       +I AM ++  A     +  F++ L E +  + +D  ++ H+  L   +    L  +++PY  V++  +A+ + +   +VE  L   I D    G +DQ   +L++ E
Sbjct:  166 LVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKVQGALDLQSGILHAADERDFKTAFSYFYEAFEGFDSVDSVKALTSLKYMLLCKIMLGQSDDVNQLVSGKLAITYSGRDIDAMKSVAEASHKRSLADFQAALKEYKKELAEDVIVQAHLGTLYDTMLEQNLCRIIEPYSRVQVAHVAESIQLPMPQVEKKLSQMILDKKFSGILDQGEGVLIVFE 389          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Zebrafish
Match: cops2 (COP9 signalosome subunit 2 [Source:NCBI gene;Acc:415145])

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 297/421 (70.55%), Postives = 354/421 (84.09%), Query Frame = 1
Query:   64 IEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVID-EPRKEAKYKSLDKLISEIDKLHH 1323
            +EYS + NSEP+VDLENQYY++K+LKE +P +A+  F+KVL++E  GE+GEWGFKALKQ+IKI+F+L N  EMM  Y QLLTYIRSAVTRNYSEKSINSILDY+STSKQM +LQ+FY TTLEALK+A+N+RLWFKTNTKLGKLYLE  ++  L +I+++L QSCQT+DGEDDL+KGTQLLEIYALEIQMYT Q+NNKKLK LYEQSLHIKSAIPHPLIMG+IRECGGKMHLR+GEF+KAHTDFFEAFKNYDESGS RRT CLKYLVL+NML KS INPFDSQE KPY+++PEI+AMTNLVSAYQ NDI  FE  L  N   IM DPFIREHIEELLRNIR  VLI L+KPY  + I F+++ LNI   +VESLLV CI DN I G+IDQ + +L +D + R  A+Y +LDK  ++++ L+ 
Sbjct:   18 LEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELE--GEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEFGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTINGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQ 436          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Zebrafish
Match: cops2 (COP9 signalosome subunit 2 [Source:NCBI gene;Acc:415145])

HSP 1 Score: 429.483 bits (1103), Expect = 2.789e-149
Identity = 205/267 (76.78%), Postives = 239/267 (89.51%), Query Frame = 1
Query:   64 IEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQ--MTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYL 858
            +EYS + NSEP+VDLENQYY++K+LKE +P +A+  F+KVL++E  GE+GEWGFKALKQ+IKI+F+L N  EMM  Y QLLTYIRSAVTRNYSEKSINSILDY+STSKQ  M +LQ+FY TTLEALK+A+N+RLWFKTNTKLGKLYLE  ++  L +I+++L QSCQT+DGEDDL+KGTQLLEIYALEIQMYT Q+NNKKLK LYEQSLHIKSAIPHPLIMG+IRECGGKMHLR+GEF+KAHTDFFEAFKNYDESGS RRT CLKYL
Sbjct:   18 LEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELE--GEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQVMMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEFGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYL 282          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Zebrafish
Match: psmd11a (proteasome 26S subunit, non-ATPase 11a [Source:NCBI gene;Acc:503934])

HSP 1 Score: 84.3445 bits (207), Expect = 5.252e-17
Identity = 83/359 (23.12%), Postives = 166/359 (46.24%), Query Frame = 1
Query:  301 LLTYIR---SAVTRNYSEKSINSILDY-----VSTSKQMTMLQKFYTTTLEALKEARNERLWF---KTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAI--PHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSA--INPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVI-DEPRKEAKYKSLDKLISEIDKLHHNL 1329
            LL Y+R   +++++  + + + S+LD       +T +++ +        LE ++ A++E+  F       +L  LY +  ++   L++  +L Q  +  D +        L+E+  LE + Y    N  K +     +    +AI  P  L   +  + G      + ++  A++ F+EAF+ YD   S R    LKY++L  ++  S   +    S ++       +  A+  +  A +   +  FE  LTE +  +  DP I  H+ +L  N+    LI +++P+  V+IE +++ + +S  +VE  L   I D    G +DQ   +L++ DEP  +  Y++  + I  + K+  +L
Sbjct:   68 LLKYVRPFLNSISKAKAARLVRSLLDMFLDMEAATGQEVEL-------CLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALQLGSQLLQELKKMDDK------ALLVELQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQAALDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPRAITALKYMLLCKIMLNSPEDVQSLISGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTEYKAELRDDPIISTHLTKLYDNLLEQNLIRVIEPFSRVQIEHISELIKLSKGDVERKLSQMILDQKFHGILDQGEGVLIVFDEPPVDKTYEASLETIQNMSKVVDSL 413          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Zebrafish
Match: psmd11a (proteasome 26S subunit, non-ATPase 11a [Source:NCBI gene;Acc:503934])

HSP 1 Score: 84.3445 bits (207), Expect = 5.252e-17
Identity = 83/359 (23.12%), Postives = 166/359 (46.24%), Query Frame = 1
Query:  301 LLTYIR---SAVTRNYSEKSINSILDY-----VSTSKQMTMLQKFYTTTLEALKEARNERLWF---KTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAI--PHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSA--INPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVI-DEPRKEAKYKSLDKLISEIDKLHHNL 1329
            LL Y+R   +++++  + + + S+LD       +T +++ +        LE ++ A++E+  F       +L  LY +  ++   L++  +L Q  +  D +        L+E+  LE + Y    N  K +     +    +AI  P  L   +  + G      + ++  A++ F+EAF+ YD   S R    LKY++L  ++  S   +    S ++       +  A+  +  A +   +  FE  LTE +  +  DP I  H+ +L  N+    LI +++P+  V+IE +++ + +S  +VE  L   I D    G +DQ   +L++ DEP  +  Y++  + I  + K+  +L
Sbjct:   68 LLKYVRPFLNSISKAKAARLVRSLLDMFLDMEAATGQEVEL-------CLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALQLGSQLLQELKKMDDK------ALLVELQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQAALDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPRAITALKYMLLCKIMLNSPEDVQSLISGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTEYKAELRDDPIISTHLTKLYDNLLEQNLIRVIEPFSRVQIEHISELIKLSKGDVERKLSQMILDQKFHGILDQGEGVLIVFDEPPVDKTYEASLETIQNMSKVVDSL 413          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Zebrafish
Match: psmd11b (proteasome 26S subunit, non-ATPase 11b [Source:NCBI gene;Acc:322265])

HSP 1 Score: 82.8037 bits (203), Expect = 1.378e-16
Identity = 84/359 (23.40%), Postives = 162/359 (45.13%), Query Frame = 1
Query:  301 LLTYIRS---AVTRNYSEKSINSILDY-----VSTSKQMTMLQKFYTTTLEALKEARNERLWF---KTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAI--PHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTK--SAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVI-DEPRKEAKYKSLDKLISEIDKLHHNL 1329
            LL ++R    ++++  + + + S+LD       +T +++ +        LE ++ A+ E+  F       +L  LY +  ++   L++  +L Q  +  D +        L+E+  LE + Y    N  K +     +    +AI  P  L   +  + G      + ++  A++ FFEAF+ YD   S R    LKY++L  ++      +    S ++       +  A+  +  A +   +  FE  LTE    +  DP I  H+ +L  N+    LI +++P+  V+I  +A  + +S N+VE  L   I D    G +DQ  D+L+I +EP  +  Y++  + I  + K+  +L
Sbjct:   69 LLKFVRPFLISISKAKAARLVRSLLDLFLDMEAATGQEVEL-------CLECIEWAKAEKRTFLRQALEARLISLYFDTKRYQEALQLESQLLQELKKMDDK------ALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQAALDMQSGIIHAAEEKDWKTAYSYFFEAFEGYDSIDSPRAVTALKYMLLCKIMLSLPEEVQALISGKLGLRYAGRQTDALKCIAQASKNRSLADFEKALTEYTKELRDDPIINTHLAKLYDNLLEQNLIRVIEPFSRVQITHIAGLIKLSKNDVERKLSQMILDKKFHGILDQGEDVLIIFEEPPVDKTYEAALETIQNMSKVVDSL 414          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Xenopus
Match: cops2 (COP9 signalosome subunit 2 [Source:NCBI gene;Acc:548537])

HSP 1 Score: 617.461 bits (1591), Expect = 0.000e+0
Identity = 297/421 (70.55%), Postives = 354/421 (84.09%), Query Frame = 1
Query:   64 IEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVID-EPRKEAKYKSLDKLISEIDKLHH 1323
            +EYS + NSEP+VDLENQYY++K+LKE +P +A+  F+KVL++E  GE+GEWGFKALKQ+IKI+F+L N  EMM  Y QLLTYIRSAVTRNYSEKSINSILDY+STSKQM +LQ+FY TTLEALK+A+N+RLWFKTNTKLGKLYLE  ++  L +I+++L QSCQT+DGEDDL+KGTQLLEIYALEIQMYT Q+NNKKLK LYEQSLHIKSAIPHPLIMG+IRECGGKMHLR+GEF+KAHTDFFEAFKNYDESGS RRT CLKYLVL+NML KS INPFDSQE KPY+++PEI+AMTNLVSAYQ NDI  FE  L  N   IM DPFIREHIEELLRNIR  VLI L+KPY  + I F+++ LNI   +VESLLV CI DN I G+IDQ + +L +D + R  A+Y +LDK  ++++ L+ 
Sbjct:   18 LEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELE--GEKGEWGFKALKQMIKINFKLGNYPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQ 436          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Xenopus
Match: cops2 (COP9 signalosome subunit 2 [Source:NCBI gene;Acc:548537])

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 272/379 (71.77%), Postives = 318/379 (83.91%), Query Frame = 1
Query:  190 IESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVID-EPRKEAKYKSLDKLISEIDKLHH 1323
            +E  GE+GEWGFKALKQ+IKI+F+L N  EMM  Y QLLTYIRSAVTRNYSEKSINSILDY+STSKQM +LQ+FY TTLEALK+A+N+RLWFKTNTKLGKLYLE  ++  L +I+++L QSCQT+DGEDDL+KGTQLLEIYALEIQMYT Q+NNKKLK LYEQSLHIKSAIPHPLIMG+IRECGGKMHLR+GEF+KAHTDFFEAFKNYDESGS RRT CLKYLVL+NML KS INPFDSQE KPY+++PEI+AMTNLVSAYQ NDI  FE  L  N   IM DPFIREHIEELLRNIR  VLI L+KPY  + I F+++ LNI   +VESLLV CI DN I G+IDQ + +L +D + R  A+Y +LDK  ++++ L+ 
Sbjct:    3 LELEGEKGEWGFKALKQMIKINFKLGNYPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQ 381          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Xenopus
Match: psmd11 (proteasome 26S subunit, non-ATPase 11 [Source:NCBI gene;Acc:100492225])

HSP 1 Score: 73.559 bits (179), Expect = 2.053e-13
Identity = 79/359 (22.01%), Postives = 162/359 (45.13%), Query Frame = 1
Query:  301 LLTYIR---SAVTRNYSEKSINSILDY-----VSTSKQMTMLQKFYTTTLEALKEARNERLWF---KTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAI--PHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNML--TKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVI-DEPRKEAKYKSLDKLISEIDKLHHNL 1329
            LL Y+R   +++++  + + + S+LD       +T +++ +        LE ++ A+ E+  F       +L  LY +  ++   L++  +L +  +  D +        L+E+  LE + Y    N  K +     +    +AI  P  L   +  + G      + ++  A++ F+EAF+  D   S +    LKY++L  ++  T   +    S ++       +  A+  +  A +   +  FE  LT+ +  +  DP I  H+ +L  N+    LI +++P+  V+I+ ++  + +   EVE  L   I D    G +DQ   +L+I DEP  +  Y++  + I  + K+  +L
Sbjct:   69 LLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVEL-------CLECIEWAKAEKRTFLRQALEARLVSLYFDTKRYQEALQLGSQLLRELKKMDDK------ALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQAALDMQSGIIHAAEEKDWKTAYSYFYEAFEGNDSIDSPKAITALKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLANFEKALTDYKAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIDHISSLIKLPKPEVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSL 414          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Xenopus
Match: psmd11 (proteasome 26S subunit, non-ATPase 11 [Source:NCBI gene;Acc:100492225])

HSP 1 Score: 68.1662 bits (165), Expect = 1.217e-11
Identity = 81/359 (22.56%), Postives = 160/359 (44.57%), Query Frame = 1
Query:  301 LLTYIR---SAVTRNYSEKSINSILDY-----VSTSKQMTMLQKFYTTTLEALKEARNERLWF---KTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAI--PHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNML--TKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVI-DEPRKEAKYKSLDKLISEIDKLHHNL 1329
            LL Y+R   +++++  + + + S+LD       +T +++ +        LE ++ A+ E+  F       +L  LY +  ++   L++  +L +  +  D +        L+E+  LE + Y    N  K +     +    +AI  P  L   +  + G      + ++  A++ F+EAF+  D   S +    LKY++L  ++  T   +    S ++       +  A+  +  A +   +  FE  LT+ +  +  DP I  H+ +L  N+    LI +++P+  V++ FL   L     EVE  L   I D    G +DQ   +L+I DEP  +  Y++  + I  + K+  +L
Sbjct:   69 LLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVEL-------CLECIEWAKAEKRTFLRQALEARLVSLYFDTKRYQEALQLGSQLLRELKKMDDK------ALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQAALDMQSGIIHAAEEKDWKTAYSYFYEAFEGNDSIDSPKAITALKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLANFEKALTDYKAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQVIFLL--LYDFQPEVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSL 412          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Xenopus
Match: psmd11 (proteasome 26S subunit, non-ATPase 11 [Source:NCBI gene;Acc:100492225])

HSP 1 Score: 65.0846 bits (157), Expect = 8.809e-11
Identity = 80/363 (22.04%), Postives = 159/363 (43.80%), Query Frame = 1
Query:  301 LLTYIR---SAVTRNYSEKSINSILDY-----VSTSKQMTMLQKFYTTTLEALKEARNERLWF---KTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAI--PHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNML--TKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTN----EVESLLVSCIADNVIKGKIDQKSDILVI-DEPRKEAKYKSLDKLISEIDKLHHNL 1329
            LL Y+R   +++++  + + + S+LD       +T +++ +        LE ++ A+ E+  F       +L  LY +  ++   L++  +L +  +  D +        L+E+  LE + Y    N  K +     +    +AI  P  L   +  + G      + ++  A++ F+EAF+  D   S +    LKY++L  ++  T   +    S ++       +  A+  +  A +   +  FE  LT+ +  +  DP I  H+ +L  N+    LI +++P+          R+ +ST     EVE  L   I D    G +DQ   +L+I DEP  +  Y++  + I  + K+  +L
Sbjct:   44 LLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVEL-------CLECIEWAKAEKRTFLRQALEARLVSLYFDTKRYQEALQLGSQLLRELKKMDDK------ALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQAALDMQSGIIHAAEEKDWKTAYSYFYEAFEGNDSIDSPKAITALKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLANFEKALTDYKAELRDDPIISTHLAKLYDNLLEQNLIRVIEPF---------SRVQVSTKYHQPEVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSL 384          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Mouse
Match: Cops2 (COP9 signalosome subunit 2 [Source:MGI Symbol;Acc:MGI:1330276])

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 297/421 (70.55%), Postives = 354/421 (84.09%), Query Frame = 1
Query:   64 IEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVID-EPRKEAKYKSLDKLISEIDKLHH 1323
            +EYS + NSEP+VDLENQYY++K+LKE +P +A+  F+KVL++E  GE+GEWGFKALKQ+IKI+F+L N  EMM  Y QLLTYIRSAVTRNYSEKSINSILDY+STSKQM +LQ+FY TTLEALK+A+N+RLWFKTNTKLGKLYLE  ++  L +I+++L QSCQT+DGEDDL+KGTQLLEIYALEIQMYT Q+NNKKLK LYEQSLHIKSAIPHPLIMG+IRECGGKMHLR+GEF+KAHTDFFEAFKNYDESGS RRT CLKYLVL+NML KS INPFDSQE KPY+++PEI+AMTNLVSAYQ NDI  FE  L  N   IM DPFIREHIEELLRNIR  VLI L+KPY  + I F+++ LNI   +VESLLV CI DN I G+IDQ + +L +D + R  A+Y +LDK  ++++ L+ 
Sbjct:   18 LEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELE--GEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQ 436          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Mouse
Match: Cops2 (COP9 signalosome subunit 2 [Source:MGI Symbol;Acc:MGI:1330276])

HSP 1 Score: 610.527 bits (1573), Expect = 0.000e+0
Identity = 297/428 (69.39%), Postives = 354/428 (82.71%), Query Frame = 1
Query:   64 IEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQ-------MTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVID-EPRKEAKYKSLDKLISEIDKLHH 1323
            +EYS + NSEP+VDLENQYY++K+LKE +P +A+  F+KVL++E  GE+GEWGFKALKQ+IKI+F+L N  EMM  Y QLLTYIRSAVTRNYSEKSINSILDY+STSKQ       M +LQ+FY TTLEALK+A+N+RLWFKTNTKLGKLYLE  ++  L +I+++L QSCQT+DGEDDL+KGTQLLEIYALEIQMYT Q+NNKKLK LYEQSLHIKSAIPHPLIMG+IRECGGKMHLR+GEF+KAHTDFFEAFKNYDESGS RRT CLKYLVL+NML KS INPFDSQE KPY+++PEI+AMTNLVSAYQ NDI  FE  L  N   IM DPFIREHIEELLRNIR  VLI L+KPY  + I F+++ LNI   +VESLLV CI DN I G+IDQ + +L +D + R  A+Y +LDK  ++++ L+ 
Sbjct:   18 LEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELE--GEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQNSDFLCQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQ 443          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Mouse
Match: Cops2 (COP9 signalosome subunit 2 [Source:MGI Symbol;Acc:MGI:1330276])

HSP 1 Score: 496.123 bits (1276), Expect = 1.171e-173
Identity = 253/428 (59.11%), Postives = 308/428 (71.96%), Query Frame = 1
Query:   64 IEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQ-------MTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVID-EPRKEAKYKSLDKLISEIDKLHH 1323
            +EYS + NSEP+VDLENQYY++K+LKE +P +A+  F+KVL++E  GE+GEWGFKALKQ+IKI+F+L N  EMM  Y QLLTYIRSAVTRNYSEKSINSILDY+STSKQ       M +LQ+FY TTLEALK+A+N+RLWFKTNTKLGKLYLE  ++  L +I+++L QSCQT+DGEDDL+K                                                ECGGKMHLR+GEF+KAHTDFFEAFKNYDESGS RRT CLKYLVL+NML KS INPFDSQE KPY+++PEI+AMTNLVSAYQ NDI  FE  L  N   IM DPFIREHIEELLRNIR  VLI L+KPY  + I F+++ LNI   +VESLLV CI DN I G+IDQ + +L +D + R  A+Y +LDK  ++++ L+ 
Sbjct:   18 LEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELE--GEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQNSDFLCQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKK------------------------------------------------ECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQ 395          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Mouse
Match: Psmd11 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 11 [Source:MGI Symbol;Acc:MGI:1916327])

HSP 1 Score: 78.1814 bits (191), Expect = 4.682e-15
Identity = 81/359 (22.56%), Postives = 164/359 (45.68%), Query Frame = 1
Query:  301 LLTYIR---SAVTRNYSEKSINSILDY-----VSTSKQMTMLQKFYTTTLEALKEARNERLWF---KTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAI-PHPLIMGIIRECGGKMHL-RQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNML--TKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVI-DEPRKEAKYKSLDKLISEIDKLHHNL 1329
            LL Y+R   +++++  + + + S+LD       +T +++ +        LE ++ A++E+  F       +L  LY +  ++   L +  +L +  +  D +        L+E+  LE + Y    N  K +     +    +AI   P +   +    G +H   + ++  A++ F+EAF+ YD   S +    LKY++L  ++  T   +    S ++       +  A+  +  A +   +  FE  LT+    +  DP I  H+ +L  N+    LI +++P+  V+IE ++  + +S  +VE  L   I D    G +DQ   +L+I DEP  +  Y++  + I  + K+  +L
Sbjct:   69 LLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVEL-------CLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDK------ALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSL 414          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Mouse
Match: Psmd11 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 11 [Source:MGI Symbol;Acc:MGI:1916327])

HSP 1 Score: 78.1814 bits (191), Expect = 4.682e-15
Identity = 81/359 (22.56%), Postives = 164/359 (45.68%), Query Frame = 1
Query:  301 LLTYIR---SAVTRNYSEKSINSILDY-----VSTSKQMTMLQKFYTTTLEALKEARNERLWF---KTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAI-PHPLIMGIIRECGGKMHL-RQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNML--TKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVI-DEPRKEAKYKSLDKLISEIDKLHHNL 1329
            LL Y+R   +++++  + + + S+LD       +T +++ +        LE ++ A++E+  F       +L  LY +  ++   L +  +L +  +  D +        L+E+  LE + Y    N  K +     +    +AI   P +   +    G +H   + ++  A++ F+EAF+ YD   S +    LKY++L  ++  T   +    S ++       +  A+  +  A +   +  FE  LT+    +  DP I  H+ +L  N+    LI +++P+  V+IE ++  + +S  +VE  L   I D    G +DQ   +L+I DEP  +  Y++  + I  + K+  +L
Sbjct:   69 LLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVEL-------CLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDK------ALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSL 414          
BLAST of COP9 signalosome complex subunit 2 vs. UniProt/SwissProt
Match: sp|P61203|CSN2_RAT (COP9 signalosome complex subunit 2 OS=Rattus norvegicus OX=10116 GN=Cops2 PE=1 SV=1)

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 297/421 (70.55%), Postives = 354/421 (84.09%), Query Frame = 1
Query:   64 IEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVID-EPRKEAKYKSLDKLISEIDKLHH 1323
            +EYS + NSEP+VDLENQYY++K+LKE +P +A+  F+KVL++E  GE+GEWGFKALKQ+IKI+F+L N  EMM  Y QLLTYIRSAVTRNYSEKSINSILDY+STSKQM +LQ+FY TTLEALK+A+N+RLWFKTNTKLGKLYLE  ++  L +I+++L QSCQT+DGEDDL+KGTQLLEIYALEIQMYT Q+NNKKLK LYEQSLHIKSAIPHPLIMG+IRECGGKMHLR+GEF+KAHTDFFEAFKNYDESGS RRT CLKYLVL+NML KS INPFDSQE KPY+++PEI+AMTNLVSAYQ NDI  FE  L  N   IM DPFIREHIEELLRNIR  VLI L+KPY  + I F+++ LNI   +VESLLV CI DN I G+IDQ + +L +D + R  A+Y +LDK  ++++ L+ 
Sbjct:   18 LEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELE--GEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQ 436          
BLAST of COP9 signalosome complex subunit 2 vs. UniProt/SwissProt
Match: sp|P61202|CSN2_MOUSE (COP9 signalosome complex subunit 2 OS=Mus musculus OX=10090 GN=Cops2 PE=1 SV=1)

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 297/421 (70.55%), Postives = 354/421 (84.09%), Query Frame = 1
Query:   64 IEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVID-EPRKEAKYKSLDKLISEIDKLHH 1323
            +EYS + NSEP+VDLENQYY++K+LKE +P +A+  F+KVL++E  GE+GEWGFKALKQ+IKI+F+L N  EMM  Y QLLTYIRSAVTRNYSEKSINSILDY+STSKQM +LQ+FY TTLEALK+A+N+RLWFKTNTKLGKLYLE  ++  L +I+++L QSCQT+DGEDDL+KGTQLLEIYALEIQMYT Q+NNKKLK LYEQSLHIKSAIPHPLIMG+IRECGGKMHLR+GEF+KAHTDFFEAFKNYDESGS RRT CLKYLVL+NML KS INPFDSQE KPY+++PEI+AMTNLVSAYQ NDI  FE  L  N   IM DPFIREHIEELLRNIR  VLI L+KPY  + I F+++ LNI   +VESLLV CI DN I G+IDQ + +L +D + R  A+Y +LDK  ++++ L+ 
Sbjct:   18 LEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELE--GEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQ 436          
BLAST of COP9 signalosome complex subunit 2 vs. UniProt/SwissProt
Match: sp|P61201|CSN2_HUMAN (COP9 signalosome complex subunit 2 OS=Homo sapiens OX=9606 GN=COPS2 PE=1 SV=1)

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 297/421 (70.55%), Postives = 354/421 (84.09%), Query Frame = 1
Query:   64 IEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVID-EPRKEAKYKSLDKLISEIDKLHH 1323
            +EYS + NSEP+VDLENQYY++K+LKE +P +A+  F+KVL++E  GE+GEWGFKALKQ+IKI+F+L N  EMM  Y QLLTYIRSAVTRNYSEKSINSILDY+STSKQM +LQ+FY TTLEALK+A+N+RLWFKTNTKLGKLYLE  ++  L +I+++L QSCQT+DGEDDL+KGTQLLEIYALEIQMYT Q+NNKKLK LYEQSLHIKSAIPHPLIMG+IRECGGKMHLR+GEF+KAHTDFFEAFKNYDESGS RRT CLKYLVL+NML KS INPFDSQE KPY+++PEI+AMTNLVSAYQ NDI  FE  L  N   IM DPFIREHIEELLRNIR  VLI L+KPY  + I F+++ LNI   +VESLLV CI DN I G+IDQ + +L +D + R  A+Y +LDK  ++++ L+ 
Sbjct:   18 LEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELE--GEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQ 436          
BLAST of COP9 signalosome complex subunit 2 vs. UniProt/SwissProt
Match: sp|Q6IQT4|CSN2_DANRE (COP9 signalosome complex subunit 2 OS=Danio rerio OX=7955 GN=cops2 PE=2 SV=1)

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 297/421 (70.55%), Postives = 354/421 (84.09%), Query Frame = 1
Query:   64 IEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVID-EPRKEAKYKSLDKLISEIDKLHH 1323
            +EYS + NSEP+VDLENQYY++K+LKE +P +A+  F+KVL++E  GE+GEWGFKALKQ+IKI+F+L N  EMM  Y QLLTYIRSAVTRNYSEKSINSILDY+STSKQM +LQ+FY TTLEALK+A+N+RLWFKTNTKLGKLYLE  ++  L +I+++L QSCQT+DGEDDL+KGTQLLEIYALEIQMYT Q+NNKKLK LYEQSLHIKSAIPHPLIMG+IRECGGKMHLR+GEF+KAHTDFFEAFKNYDESGS RRT CLKYLVL+NML KS INPFDSQE KPY+++PEI+AMTNLVSAYQ NDI  FE  L  N   IM DPFIREHIEELLRNIR  VLI L+KPY  + I F+++ LNI   +VESLLV CI DN I G+IDQ + +L +D + R  A+Y +LDK  ++++ L+ 
Sbjct:   18 LEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELE--GEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEFGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTINGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQ 436          
BLAST of COP9 signalosome complex subunit 2 vs. UniProt/SwissProt
Match: sp|Q6IR75|CSN2_XENLA (COP9 signalosome complex subunit 2 (Fragment) OS=Xenopus laevis OX=8355 GN=csn2 PE=2 SV=1)

HSP 1 Score: 616.305 bits (1588), Expect = 0.000e+0
Identity = 296/421 (70.31%), Postives = 354/421 (84.09%), Query Frame = 1
Query:   64 IEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVID-EPRKEAKYKSLDKLISEIDKLHH 1323
            +EYS + NSEP+VDLENQYY++K+LKE +P +A+  F+KVL++E  GE+GEWGFKALKQ+IKI+F+L N  EMM  Y QLLTYIRSAVTRNYSEKSINSILDY+STSKQM +LQ+FY TTL+ALK+A+N+RLWFKTNTKLGKLYLE  ++  L +I+++L QSCQT+DGEDDL+KGTQLLEIYALEIQMYT Q+NNKKLK LYEQSLHIKSAIPHPLIMG+IRECGGKMHLR+GEF+KAHTDFFEAFKNYDESGS RRT CLKYLVL+NML KS INPFDSQE KPY+++PEI+AMTNLVSAYQ NDI  FE  L  N   IM DPFIREHIEELLRNIR  VLI L+KPY  + I F+++ LNI   +VESLLV CI DN I G+IDQ + +L +D + R  A+Y +LDK  ++++ L+ 
Sbjct:   16 LEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELE--GEKGEWGFKALKQMIKINFKLGNYPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLDALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQ 434          
BLAST of COP9 signalosome complex subunit 2 vs. TrEMBL
Match: A0A504YDG3 (COP9 constitutive photomorphogenic subunit 2 OS=Fasciola gigantica OX=46835 GN=FGIG_01961 PE=4 SV=1)

HSP 1 Score: 652.514 bits (1682), Expect = 0.000e+0
Identity = 309/416 (74.28%), Postives = 366/416 (87.98%), Query Frame = 1
Query:   52 GELSIEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVID-EPRKEAKYKSLDKL 1296
            GELS+EYSS+DNSEPDVDLENQYY AKS KE +PL A+EEF+KVL IE++G +G+WGF+ALKQ+IKI+F+L    EMM NY  LLTYI+SAVTRNYSEKSINSILDYVSTSKQM +LQ+FYTTTL+ALKEA+NERLWFKTNTKLGKLYLE   ++ L RI+KELR+SCQTN+GEDDL+KGTQLLEIYALEIQMYT Q+NNKKLK LYEQSLHIKSAIPHPLIMGIIRECGGKMHLR+GE++K+HTDFFEAFKNYDESG QRRTQCLKYLVL++ML KS INPFDSQE KPY+++P+I+AMT+LV+AYQ NDI  FE+ L    D+IM+DPFIREHIE+LLRNIR +VLI L++PY  +RI F++Q+LN+S  EVESLLV+CI DN I+ KIDQ+  ILV+  E   EA+Y++LDKL
Sbjct:   11 GELSVEYSSDDNSEPDVDLENQYYMAKSRKEESPLMALEEFQKVLDIEATGAKGDWGFRALKQMIKINFKLGRFPEMMVNYKTLLTYIKSAVTRNYSEKSINSILDYVSTSKQMDLLQQFYTTTLDALKEAKNERLWFKTNTKLGKLYLEQGDYIQLQRIVKELRESCQTNEGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGIIRECGGKMHLREGEYNKSHTDFFEAFKNYDESGCQRRTQCLKYLVLASMLMKSGINPFDSQETKPYKNDPQIMAMTSLVTAYQNNDIGEFENILRRERDSIMEDPFIREHIEDLLRNIRTEVLIKLIRPYTRIRIPFISQQLNLSDAEVESLLVACILDNTIQAKIDQEQQILVLSPEATSEARYQALDKL 426          
BLAST of COP9 signalosome complex subunit 2 vs. TrEMBL
Match: A0A2H1CKI7 (COP9 constitutive photomorphogenic subunit 2 OS=Fasciola hepatica OX=6192 GN=D915_002562 PE=4 SV=1)

HSP 1 Score: 652.514 bits (1682), Expect = 0.000e+0
Identity = 309/416 (74.28%), Postives = 366/416 (87.98%), Query Frame = 1
Query:   52 GELSIEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVID-EPRKEAKYKSLDKL 1296
            GELS+EYSS+DNSEPDVDLENQYY AKS KE +PL A+EEF+KVL IE++G +G+WGF+ALKQ+IKI+F+L    EMM NY  LLTYI+SAVTRNYSEKSINSILDYVSTSKQM +LQ+FYTTTL+ALKEA+NERLWFKTNTKLGKLYLE   ++ L RI+KELR+SCQTN+GEDDL+KGTQLLEIYALEIQMYT Q+NNKKLK LYEQSLHIKSAIPHPLIMGIIRECGGKMHLR+GE++K+HTDFFEAFKNYDESG QRRTQCLKYLVL++ML KS INPFDSQE KPY+++P+I+AMT+LV+AYQ NDI  FE+ L    D+IM+DPFIREHIE+LLRNIR +VLI L++PY  +RI F++Q+LN+S  EVESLLV+CI DN I+ KIDQ+  ILV+  E   EA+Y++LDKL
Sbjct:   11 GELSVEYSSDDNSEPDVDLENQYYMAKSRKEESPLMALEEFQKVLDIEATGAKGDWGFRALKQMIKINFKLGRFPEMMVNYKTLLTYIKSAVTRNYSEKSINSILDYVSTSKQMDLLQQFYTTTLDALKEAKNERLWFKTNTKLGKLYLEQGDYIQLQRIVKELRESCQTNEGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGIIRECGGKMHLREGEYNKSHTDFFEAFKNYDESGCQRRTQCLKYLVLASMLMKSGINPFDSQETKPYKNDPQIMAMTSLVTAYQNNDIGEFENILRRERDSIMEDPFIREHIEDLLRNIRTEVLIKLIRPYTRIRIPFISQQLNLSDAEVESLLVACILDNTIQAKIDQEQQILVLSPEATSEARYQALDKL 426          
BLAST of COP9 signalosome complex subunit 2 vs. TrEMBL
Match: A0A183AYY6 (PCI domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS12169 PE=4 SV=1)

HSP 1 Score: 650.588 bits (1677), Expect = 0.000e+0
Identity = 308/416 (74.04%), Postives = 365/416 (87.74%), Query Frame = 1
Query:   52 GELSIEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVID-EPRKEAKYKSLDKL 1296
            GELS+EYSS+DNSEPDVDLENQYY AKS KE +PL A+EEF+KVL IE++G +G+WGF+ALKQ+IKI+F+L    EMM NY  LLTYI+SAVTRNYSEKSINSILDYVSTSKQM +LQ+FYTTTL+ALKEA+NERLWFKTNTKLGKLYLE   ++ L RI+KELR+SCQTN+GEDD++KGTQLLEIYALEIQMYT Q+NNKKLK LYEQSLHIKSAIPHPLIMGIIRECGGKMHLR+GE++K+HTDFFEAFKNYDESG QRRTQCLKYLVL++ML KS INPFDSQE KPY+++P+I+AMT+LV+AYQ NDI  FES L    D+IM+DPFIREHIE+LLRNIR +VLI L++PY  +RI F++Q+L +S  EVESLLV+CI DN I+ KIDQ+  ILV+  E   EA+Y++LDKL
Sbjct:    5 GELSVEYSSDDNSEPDVDLENQYYTAKSRKEESPLLALEEFQKVLDIEATGAKGDWGFRALKQMIKINFKLGRFSEMMINYRTLLTYIKSAVTRNYSEKSINSILDYVSTSKQMDLLQQFYTTTLDALKEAKNERLWFKTNTKLGKLYLEQGDYIQLQRIVKELRESCQTNEGEDDMKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGIIRECGGKMHLREGEYNKSHTDFFEAFKNYDESGCQRRTQCLKYLVLASMLMKSGINPFDSQETKPYKNDPQIMAMTSLVTAYQNNDIAEFESILRRERDSIMEDPFIREHIEDLLRNIRTEVLIKLIRPYTRIRIPFISQQLKLSDAEVESLLVACILDNSIQAKIDQEQQILVLSPEATSEARYQALDKL 420          
BLAST of COP9 signalosome complex subunit 2 vs. TrEMBL
Match: A0A074ZXY0 (PCI domain protein OS=Opisthorchis viverrini OX=6198 GN=T265_01886 PE=4 SV=1)

HSP 1 Score: 645.58 bits (1664), Expect = 0.000e+0
Identity = 310/427 (72.60%), Postives = 363/427 (85.01%), Query Frame = 1
Query:   52 GELSIEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVID-EPRKEAKYKSLDKLISEIDKLHHNL 1329
            GELS+EYSSEDNSEPDVDLENQYY AKS KE NP  A+EEF+KVL IE+SG +G+WGF+ALKQ+IKI+F+L N D MM NY  LLTYI++AVTRNYSEKSINSILDYVSTSKQM +LQ FY TTL+AL+EA+NERLWFKTNTKLGKLYLE   ++ L RI+KELR SC TN+GEDDL+KGTQLLEIYALEIQMYT Q+NNKKLK LYEQSLHIKSAIPHPLIMGIIRECGGKMHLR+GE+DK+HTDFFEAFKNYDESG  RRTQCLKYLVL++ML KS INPFDSQE KPY+++P+I+AMT+LV+AYQ NDI  FE+ L    D IM+DPFIREHIE+LLRNIR +VLI L++PY  +RI F++Q+LN+S NEVESLLV+CI DN I  +IDQ+  ILV+  E   EA+Y++LDKL   +  L   L
Sbjct:   11 GELSVEYSSEDNSEPDVDLENQYYMAKSRKEDNPQHALEEFQKVLDIEASGVKGDWGFRALKQMIKINFKLGNFDVMMENYKTLLTYIKTAVTRNYSEKSINSILDYVSTSKQMNLLQMFYATTLDALREAKNERLWFKTNTKLGKLYLEQEDYMQLQRIVKELRDSCLTNEGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGIIRECGGKMHLREGEYDKSHTDFFEAFKNYDESGCLRRTQCLKYLVLASMLMKSGINPFDSQETKPYKNDPQIMAMTSLVTAYQNNDIAEFENILRRERDAIMEDPFIREHIEDLLRNIRTEVLIKLIRPYTRIRIPFISQQLNLSENEVESLLVACILDNSIPARIDQEQQILVMSTEVTSEARYQALDKLAHRLRHLQTAL 437          
BLAST of COP9 signalosome complex subunit 2 vs. TrEMBL
Match: A0A4V3SEB6 (PCI domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006654 PE=4 SV=1)

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 309/427 (72.37%), Postives = 363/427 (85.01%), Query Frame = 1
Query:   52 GELSIEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVID-EPRKEAKYKSLDKLISEIDKLHHNL 1329
            GELS+EYSSEDNSEPDVDLENQYY AKS KE NP  A+EEF+KVL IE+SG +G+WGF+ALKQ+IKI+F+L N D MM NY  LLTYI++AVTRNYSEKSINSILDYVSTSKQM +LQ FY TTL+AL+EA+NERLWFKTNTKLGKLYLE   ++ L RI+KELR SC TN+GEDDL+KGTQLLEIYALEIQMYT Q+NNKKLK LYEQSLHIKSAIPHPLIMGIIRECGGKMHLR+GE+DK+HTDFFEAFKNYDESG  RRTQCLKYLVL++ML KS INPFDSQE KPY+++P+I+AMT+LV+AYQ NDI  FE+ L    D IM+DPFIREHIE+LLRNIR +VLI L++PY  +RI F++Q+LN+S +EVESLLV+CI DN I  +IDQ+  ILV+  E   EA+Y++LDKL   +  L   L
Sbjct:   11 GELSVEYSSEDNSEPDVDLENQYYMAKSRKEDNPQHALEEFQKVLDIEASGVKGDWGFRALKQMIKINFKLGNFDVMMDNYKTLLTYIKTAVTRNYSEKSINSILDYVSTSKQMNLLQMFYATTLDALREAKNERLWFKTNTKLGKLYLEQEDYMQLQRIVKELRDSCLTNEGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGIIRECGGKMHLREGEYDKSHTDFFEAFKNYDESGCLRRTQCLKYLVLASMLMKSGINPFDSQETKPYKNDPQIMAMTSLVTAYQNNDITEFENILRRERDAIMEDPFIREHIEDLLRNIRTEVLIKLIRPYTRIRIPFISQQLNLSESEVESLLVACILDNSIPARIDQEQQILVMSTEVTSEARYQALDKLAHRLRHLQTAL 437          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Cavefish
Match: cops2 (COP9 signalosome subunit 2 [Source:NCBI gene;Acc:103027287])

HSP 1 Score: 618.231 bits (1593), Expect = 0.000e+0
Identity = 297/421 (70.55%), Postives = 354/421 (84.09%), Query Frame = 1
Query:   64 IEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVID-EPRKEAKYKSLDKLISEIDKLHH 1323
            +EYS + NSEP+VDLENQYY++K+LKE +P +A+  F+KVL++E  GE+GEWGFKALKQ+IKI+F+L N  EMM  Y QLLTYIRSAVTRNYSEKSINSILDY+STSKQM +LQ+FY TTLEALK+A+N+RLWFKTNTKLGKLYLE  ++  L +I+++L QSCQT+DGEDDL+KGTQLLEIYALEIQMYT Q+NNKKLK LYEQSLHIKSAIPHPLIMG+IRECGGKMHLR+GEF+KAHTDFFEAFKNYDESGS RRT CLKYLVL+NML KS INPFDSQE KPY+++PEI+AMTNLVSAYQ NDI  FE  L  N   IM DPFIREHIEELLRNIR  VLI L+KPY  + I F+++ LNI   +VESLLV CI DN I G+IDQ + +L +D + R  A+Y +LDK  ++++ L+ 
Sbjct:   18 LEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELE--GEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTINGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQ 436          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Cavefish
Match: psmd11b (26S proteasome non-ATPase regulatory subunit 11B [Source:NCBI gene;Acc:103047433])

HSP 1 Score: 75.8702 bits (185), Expect = 2.375e-14
Identity = 81/359 (22.56%), Postives = 160/359 (44.57%), Query Frame = 1
Query:  301 LLTYIRS---AVTRNYSEKSINSILDY-----VSTSKQMTMLQKFYTTTLEALKEARNERLWF---KTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAI--PHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLT--KSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVI-DEPRKEAKYKSLDKLISEIDKLHHNL 1329
            LL ++R    ++++  + + + S+LD       +T +++ +        LE ++ A+ E+  F       +L  LY +  ++   L++  +L Q  +  D +        L+E+  LE + Y    N  K +     +    +AI  P  L   +  + G      + ++  A++ FFEAF+ YD   S R    LKY++L  ++      +    S ++       +  A+  +  A +   +  FE  LTE    +  DP I  H+ +L  N+    LI +++P+  V+I  ++  + +S  +VE  L   I D    G +DQ   +L+I +EP  +  Y++  + I  + K+  +L
Sbjct:   69 LLKFVRPFLISISKAKAARLVRSLLDLFLDMEAATGQEVEL-------CLECIEWAKAEKRTFLRQALEARLISLYFDTKRFQEALQLGSQLLQELKKMDDK------ALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQAALDMQSGIIHAAEEKDWKTAYSYFFEAFEGYDSIDSPRAITALKYMLLCKIMLNLPEEVQALISGKLALRYAGRQTDALKCVAQASKNRSLADFEKALTEYTKELRDDPIINTHLAKLYDNLLEQNLIRVIEPFSRVQITHISGLIKLSKGDVERKLSQMILDKKFHGILDQGEGVLIIFEEPPVDKTYEAALETIQNMSKVVDSL 414          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Cavefish
Match: psmd11a (26S proteasome non-ATPase regulatory subunit 11A [Source:NCBI gene;Acc:103047553])

HSP 1 Score: 73.1738 bits (178), Expect = 1.900e-13
Identity = 77/359 (21.45%), Postives = 161/359 (44.85%), Query Frame = 1
Query:  301 LLTYIR---SAVTRNYSEKSINSILDY-----VSTSKQMTMLQKFYTTTLEALKEARNERLWF---KTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAI--PHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSA--INPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVI-DEPRKEAKYKSLDKLISEIDKLHHNL 1329
            LL Y+R   +++++  + + + S+LD       +T +++ +        LE ++ A++E+  F       +L  LY +  ++   L++   L Q  +  D +        L+E+  LE + Y    N  K +     +    +AI  P  L   +  + G      + ++  A++ F+EAF+  D   S R    LKY++L  ++  +   +    S ++       +  ++  +  A +   +  FE  LT+    +  DP I  H+ +L  N+    LI +++P+   +IE ++  + +S  +VE  L   I D    G +DQ   +L++ DEP  +  Y++  + I  + ++  +L
Sbjct:   68 LLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVEL-------CLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALQLGSALLQELKKMDDK------ALLVEVQLLESKTYHALSNPPKARAALTSARTTANAIYCPPKLQAALDMQSGIIHAAEEKDWKTAYSYFYEAFEGNDSIDSPRAITALKYMLLCKIMLNAPEDVQALISGKLALRYAGRQTDSLKCVAQASKNRSLAEFEKALTDYRAELRDDPIISMHLAKLYDNLLEQNLIRVIEPFSRAQIEHISSLIRLSKGDVERKLSQMILDKKFYGILDQGEGVLIVFDEPPVDKTYEAALETIQNMSRVVDSL 413          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Cavefish
Match: psmd11a (26S proteasome non-ATPase regulatory subunit 11A [Source:NCBI gene;Acc:103047553])

HSP 1 Score: 53.5286 bits (127), Expect = 3.320e-7
Identity = 61/297 (20.54%), Postives = 129/297 (43.43%), Query Frame = 1
Query:  301 LLTYIR---SAVTRNYSEKSINSILDY-----VSTSKQMTMLQKFYTTTLEALKEARNERLWF---KTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAI--PHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSA--INPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQ 1146
            LL Y+R   +++++  + + + S+LD       +T +++ +        LE ++ A++E+  F       +L  LY +  ++   L++   L Q  +  D +        L+E+  LE + Y    N  K +     +    +AI  P  L   +  + G      + ++  A++ F+EAF+  D   S R    LKY++L  ++  +   +    S ++       +  ++  +  A +   +  FE  LT+    +  DP I  H+ +L  N+    LI +++P+   ++  L Q
Sbjct:   68 LLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVEL-------CLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALQLGSALLQELKKMDDK------ALLVEVQLLESKTYHALSNPPKARAALTSARTTANAIYCPPKLQAALDMQSGIIHAAEEKDWKTAYSYFYEAFEGNDSIDSPRAITALKYMLLCKIMLNAPEDVQALISGKLALRYAGRQTDSLKCVAQASKNRSLAEFEKALTDYRAELRDDPIISMHLAKLYDNLLEQNLIRVIEPFSRAQVRILDQ 351          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001532.1 (pep scaffold:Pmarinus_7.0:GL477608:3889:17671:-1 gene:ENSPMAG00000001377.1 transcript:ENSPMAT00000001532.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 605.905 bits (1561), Expect = 0.000e+0
Identity = 293/427 (68.62%), Postives = 351/427 (82.20%), Query Frame = 1
Query:   64 IEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQ------MTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVID-EPRKEAKYKSLDKLISEIDKLHH 1323
            +EYS + NSEP+VDLENQYY++K+LKE +P +A+  F+KVL++E  GE+GEWGFKALKQ+IKI+F+L N  EMM  Y QLLTYI+SAVTRNYSEKSINSILDY+STSKQ      M +LQ FY TTLEALK+A+N+RLWFKTNTKLGKLY +  ++  L +I+++L QSCQT++GEDDL+KGTQLLEIYALEIQMYT Q+NNKKLK LYEQSLHIKSAIPHPLIMG+IRECGGKMHLR+GEF+KAHTDFFEAFKNYDESGS RRT CLKYLVL+NML KS INPFDSQE KPY+++PEI+AMTNLVSAYQ NDI  FE  L  N   IM DPFIREHIEELLRNIR  VLI L+ PY  + I F+++ LNI  ++VESLLV CI DN I G+IDQ + +L +D + R  A+Y +LDK  +++  LH 
Sbjct:   18 LEYSEDSNSEPNVDLENQYYNSKALKEDDPHAALASFQKVLELE--GEKGEWGFKALKQMIKINFKLGNYAEMMNRYKQLLTYIKSAVTRNYSEKSINSILDYISTSKQNSSPLQMELLQDFYETTLEALKDAKNDRLWFKTNTKLGKLYFDREEYGKLQKILRQLHQSCQTDEGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDINEFEKILKTNRSNIMDDPFIREHIEELLRNIRTQVLIKLIMPYTRIHIPFISKELNIDVSDVESLLVQCILDNTINGRIDQVNQLLELDHQKRGGARYAALDKWTNQLSSLHQ 442          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Sea Lamprey
Match: psmd11b (proteasome 26S subunit, non-ATPase 11b [Source:NCBI gene;Acc:322265])

HSP 1 Score: 76.2554 bits (186), Expect = 3.478e-15
Identity = 81/358 (22.63%), Postives = 164/358 (45.81%), Query Frame = 1
Query:  301 LLTYIR---SAVTRNYSEKSINSILDY-----VSTSKQMTMLQKFYTTTLEALKEARNERLWF---KTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIM-GIIRECGGKMHL-RQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYR-----DNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVI-DEPRKEAKYKSLDKLISEIDKL 1317
            LL ++R   ++V++  + + + S+LD       +T +++ +        LE ++ A+ E+  F       +L  LY +  ++   L++  +L +  +  D +        L+E+  +E + Y    N  + +     +    + I  P  M   +    G +H   + ++  A++ F+EAF+ YD   S R    LKY++L  ++  +   P D Q I   +        +  AM ++  A +   +  F   L E ++ +  DP I  H+E+L +N+    LI +++P+  V+I+ +A  + +  N VE  L   I D    G +DQ   +L++ +EP  +  Y+S  + I  + K+
Sbjct:   72 LLKFVRPFLNSVSKAKAARLVRSLLDMFLDMEAATGQEVDL-------CLECIEWAKAEKRTFLRQALEARLVALYFDTKRYPEALQLGSQLLRELKKLDDK------ALLVEVQLMESKTYHALSNLPRARAALTSARTTANGIYCPPKMQAALDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPRAITALKYMLLCKIMLNT---PEDVQNIVSGKLALRYAGRKTDAMKSIAQASKDRSLSDFNKALCEYKEELQNDPIIATHLEKLYQNLLEKNLIRVIEPFSRVQIDHVATLIKLKKNLVEKKLSQMILDKKFYGILDQGEGVLIVWEEPPVDKTYESALETIQSMSKV 413          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Nematostella
Match: EDO47654 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLS7])

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 272/420 (64.76%), Postives = 336/420 (80.00%), Query Frame = 1
Query:   64 IEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVIDEPRKEA-KYKSLDKLISEIDKLH 1320
            +EYS +  SEPDVDLENQYY++K+LKE +P  A++ F+KVL +E   E+GEWGFKALKQ+IKI+F+L   DEMM  Y QLLTYI+SAVTRN+SEKSINSILDY+STSKQM +LQ FY TTL+AL++A+N+RLWFKTNTKLGKLY + N++  L +I+K+L QSCQ   G+            YALEIQMYT Q+NNKKLK LYEQSLHIKSAIPHPLIMG+IRECGGKMHLR+G++++AHTDFFEAFKNYDESGS RRT CLKYLVL+NML KS INPFDSQE KPY+++PEI+AMTNLVSAYQ +DI  FE  L  N   IM DPFIREHIE+LLRNIR  VLI L+KPY  + I F+++ LNI + EVESLLVSCI D+ I G+IDQ + +L +D   + A ++ +LD+  ++++ LH
Sbjct:   18 LEYSEDSTSEPDVDLENQYYNSKALKEDDPKGALQNFQKVLDLEQ--EKGEWGFKALKQMIKINFKLQKYDEMMSKYKQLLTYIKSAVTRNHSEKSINSILDYISTSKQMELLQNFYETTLDALRDAKNDRLWFKTNTKLGKLYYDRNEFNRLSKILKQLHQSCQVIAGD------------YALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGDYERAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNDDINEFEKILKTNRKNIMDDPFIREHIEDLLRNIRTQVLIKLIKPYTRIHIPFISKELNIDSEEVESLLVSCILDSTIHGRIDQVNQLLELDRRSQNADRFTALDRWTNQLNSLH 423          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Nematostella
Match: EDO31601 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXG5])

HSP 1 Score: 74.3294 bits (181), Expect = 2.253e-14
Identity = 53/195 (27.18%), Postives = 95/195 (48.72%), Query Frame = 1
Query:  742 GKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYR-----DNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVI-DEPRKEAKYKSLDKLISEI 1308
            G +H  + +F  A++ F+EAF+  D   S +    LKY++L  ++  S   P D Q I   +       P++VAM  + +A     +  F+  L   +  + +DP IR H++ L  N+    L+ +++PY   R+E L          VE  L   I D  + G +DQ S +L++ D+   +  Y++  +L+ E+
Sbjct:  211 GILHAEEKDFKTAYSYFYEAFEGMDSIDSPKAMAALKYMLLCKIMLNS---PDDVQSIISRKLALRYSGPQLVAMRTIANASHNRSLSEFQQALATYKKELTEDPIIRTHLDALYDNLLSQNLLRIIEPYS--RVEDL----------VEKKLSQMILDKKLHGILDQGSGVLIVFDDAFPDKTYENTLELVQEM 390          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Medaka
Match: cops2 (COP9 signalosome subunit 2 [Source:NCBI gene;Acc:101171063])

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 297/420 (70.71%), Postives = 354/420 (84.29%), Query Frame = 1
Query:   64 IEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVID-EPRKEAKYKSLDKLISEIDKLH 1320
            +EYS + NSEP+VDLENQYY++K+LKE +P +A+  F+KVL++E  GE+GEWGFKALKQ+IKI+F+L N  EMM  Y QLLTYIRSAVTRNYSEKSINSILDY+STSKQM +LQ+FY TTLEALK+A+N+RLWFKTNTKLGKLYLE  ++  L +I+++L QSCQT+DGEDDL+KGTQLLEIYALEIQMYT Q+NNKKLK LYEQSLHIKSAIPHPLIMG+IRECGGKMHLR+GEF+KAHTDFFEAFKNYDESGS RRT CLKYLVL+NML KS INPFDSQE KPY+++PEI+AMTNLVSAYQ NDI  FE  L  N   IM DPFIREHIEELLRNIR  VLI L+KPY  + I F+++ LNI   +VESLLV CI DN I G+IDQ + +L +D + R  A+Y +LDK  ++++ L+
Sbjct:   55 LEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELE--GEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVCDVESLLVQCILDNTIHGRIDQVNQLLELDYQKRGGARYTALDKWTNQLNSLN 472          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Medaka
Match: psmd11b (26S proteasome non-ATPase regulatory subunit 11B [Source:NCBI gene;Acc:101174707])

HSP 1 Score: 78.1814 bits (191), Expect = 4.533e-15
Identity = 82/359 (22.84%), Postives = 161/359 (44.85%), Query Frame = 1
Query:  301 LLTYIRS---AVTRNYSEKSINSILDY-----VSTSKQMTMLQKFYTTTLEALKEARNERLWF---KTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAI--PHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLT--KSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVI-DEPRKEAKYKSLDKLISEIDKLHHNL 1329
            LL ++R    ++++  + + + S+LD       +T +++ +        LE ++ A+ E+  F       +L  LY +  ++   L +  +L Q  +  D +        L+E+  LE + Y    N  K +     +    +AI  P  L   +  + G      + ++  A++ FFEAF+ YD   S R    LKY++L  ++      +    S ++       +  A+  +  A +   +  FE  LTE +  +  DP I  H+ +L  N+    LI +++P+  V+IE ++  + +S  +VE  L   I D    G +DQ   +L+I +EP  +  Y++  + I  + K+  +L
Sbjct:   69 LLKFVRPFLISISKAKAARLVRSLLDLFLDMEAATGQEVEL-------CLECIEWAKAEKRTFLRQALEARLISLYFDTKRYQEALALGTQLLQELKKMDDK------ALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQAALDMQSGIIHAAEEKDWKTAYSYFFEAFEGYDSIDSPRAITALKYMLLCKIVLNLPEEVQALISGKLALRYAGRQTDALKCVAQASKNRSLADFEKVLTEYKAELKDDPIINTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKGDVERKLSQMILDKKFHGILDQGEGVLIIFEEPPVDKTYEAALETIQNMSKVVDSL 414          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Medaka
Match: ENSORLT00000023519.2 (26S proteasome non-ATPase regulatory subunit 11A [Source:NCBI gene;Acc:101174330])

HSP 1 Score: 71.633 bits (174), Expect = 5.404e-13
Identity = 78/359 (21.73%), Postives = 159/359 (44.29%), Query Frame = 1
Query:  301 LLTYIR---SAVTRNYSEKSINSILDY-----VSTSKQMTMLQKFYTTTLEALKEARNERLWF---KTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAI--PHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNML--TKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVI-DEPRKEAKYKSLDKLISEIDKLHHNL 1329
            LL Y+R   +++++  + + + S+LD       +T +++ +        LE +  A+ E+  F       +L  LY +   +   L++  +L Q  +  D +        L+E+  LE + Y    N  K +     +    +AI  P  L   +  + G      + ++  A++ FFEAF+ YD   S +    LKY++L  ++      +    S ++       +  ++  +  A +   +  FE TLTE +  +  D  I  H+ +L   +    LI +++P+  V+I  ++  +++   +VE  L   I D    G +DQ   +L++ DEP  +  Y++  + I  + K+  +L
Sbjct:  115 LLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVEL-------CLECIDWAKAEKRTFLRQALEARLVSLYFDTKSYQEALQLGSQLLQELKKMDDK------ALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQAALDMQSGIIHAAEEKDWKTAYSYFFEAFEGYDSIDSPKAITALKYMLLCKIMLNLPDEVQSLISGKLALRYAGRQTESLKCVAQASKKRSLADFEETLTEYKTELRDDTIISTHLTKLYDKLLEQNLIRVIEPFSRVQIAHISSLIHLPKGDVERKLSQMILDKKFHGILDQGEGVLIVFDEPAVDKTYETALETIQNMSKVVDSL 460          
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Medaka
Match: psmd11b (26S proteasome non-ATPase regulatory subunit 11B [Source:NCBI gene;Acc:101174707])

HSP 1 Score: 65.855 bits (159), Expect = 4.062e-11
Identity = 79/359 (22.01%), Postives = 155/359 (43.18%), Query Frame = 1
Query:  301 LLTYIRS---AVTRNYSEKSINSILDY-----VSTSKQMTMLQKFYTTTLEALKEARNERLWF---KTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAI--PHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLT--KSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVI-DEPRKEAKYKSLDKLISEIDKLHHNL 1329
            LL ++R    ++++  + + + S+LD       +T +++ +        LE ++ A+ E+  F       +L  LY +  ++   L +  +L Q  +  D +        L+E+  LE + Y    N  K +     +    +AI  P  L   +  + G      + ++  A++ FFEAF+ YD   S R    LKY++L  ++      +    S ++       +  A+  +  A +   +  FE  LTE +  +  DP I  H+ +L  N+    LI +++P+  V++            +VE  L   I D    G +DQ   +L+I +EP  +  Y++  + I  + K+  +L
Sbjct:   69 LLKFVRPFLISISKAKAARLVRSLLDLFLDMEAATGQEVEL-------CLECIEWAKAEKRTFLRQALEARLISLYFDTKRYQEALALGTQLLQELKKMDDK------ALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQAALDMQSGIIHAAEEKDWKTAYSYFFEAFEGYDSIDSPRAITALKYMLLCKIVLNLPEEVQALISGKLALRYAGRQTDALKCVAQASKNRSLADFEKVLTEYKAELKDDPIINTHLAKLYDNLLEQNLIRVIEPFSRVQV-------RTYFGDVERKLSQMILDKKFHGILDQGEGVLIIFEEPPVDKTYEAALETIQNMSKVVDSL 407          
BLAST of COP9 signalosome complex subunit 2 vs. Planmine SMEST
Match: SMESG000023422.1 (SMESG000023422.1)

HSP 1 Score: 877.085 bits (2265), Expect = 0.000e+0
Identity = 426/426 (100.00%), Postives = 426/426 (100.00%), Query Frame = 1
Query:   52 GELSIEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVIDEPRKEAKYKSLDKLISEIDKLHHNL 1329
            GELSIEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVIDEPRKEAKYKSLDKLISEIDKLHHNL
Sbjct:   11 GELSIEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEEFKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKTNTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVIDEPRKEAKYKSLDKLISEIDKLHHNL 436          
BLAST of COP9 signalosome complex subunit 2 vs. Planmine SMEST
Match: SMESG000048466.1 (SMESG000048466.1)

HSP 1 Score: 75.485 bits (184), Expect = 1.986e-14
Identity = 83/355 (23.38%), Postives = 165/355 (46.48%), Query Frame = 1
Query:  253 HFRLNNSDEMMRNYVQLLTYIRSAVTRNYSEKSINSILDY-----VSTSKQMTMLQKFYTTTLEALKEARNERLWFKTN--TKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALEIQMYTIQRNNKKLKNLYEQSLHIKSAI--PHPLIMGIIRECGGKMHLRQGEFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSA--INPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVI-DEPRKEAKYK 1281
            H+  NN    + N +       + V++  S K + S++D+     VST  ++ + ++    T+    E RN   + + N   KL  +Y   +Q+   L I   L +  +  D      KG  L+E+  LE ++Y    N ++ K     +    + I  P  L   +  + G      + +F  A++ F+EAF+ +D   +++    LKY+++S ++   +  +    + ++       +I AM  + SA     + ++   L + +D +  DP I +H+  L  N+    LI L++PY  V+I++LA  +++  + VE  L   I D  + G ++Q+S +L++ D+   +  YK
Sbjct:   36 HYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTI---NERRN---YLRQNLEAKLMGIYYLKSQFEAALNIGSALLKELKKLDD-----KGL-LVEVQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKYTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYK 378          
The following BLAST results are available for this feature:
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
COPS20.000e+070.55COP9 signalosome subunit 2 [Source:HGNC Symbol;Acc... [more]
COPS20.000e+069.39COP9 signalosome subunit 2 [Source:HGNC Symbol;Acc... [more]
COPS20.000e+071.63COP9 signalosome subunit 2 [Source:HGNC Symbol;Acc... [more]
COPS23.199e-13976.61COP9 signalosome subunit 2 [Source:HGNC Symbol;Acc... [more]
COPS21.700e-9279.76COP9 signalosome subunit 2 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csn-20.000e+061.74COP9 signalosome complex subunit 2 [Source:UniPro... [more]
csn-20.000e+061.74COP9 signalosome complex subunit 2 [Source:UniPro... [more]
rpn-6.23.734e-1524.28Probable 26S proteasome regulatory subunit rpn-6.2... [more]
rpn-6.21.004e-1421.55Probable 26S proteasome regulatory subunit rpn-6.2... [more]
rpn-6.12.087e-926.35Probable 26S proteasome regulatory subunit rpn-6.1... [more]
back to top
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alien0.000e+069.12gene:FBgn0013746 transcript:FBtr0339550[more]
alien0.000e+069.12gene:FBgn0013746 transcript:FBtr0343095[more]
alien0.000e+069.12gene:FBgn0013746 transcript:FBtr0079780[more]
alien0.000e+069.12gene:FBgn0013746 transcript:FBtr0079781[more]
Rpn67.271e-1223.21gene:FBgn0028689 transcript:FBtr0087475[more]
back to top
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cops20.000e+070.55COP9 signalosome subunit 2 [Source:NCBI gene;Acc:4... [more]
cops22.789e-14976.78COP9 signalosome subunit 2 [Source:NCBI gene;Acc:4... [more]
psmd11a5.252e-1723.12proteasome 26S subunit, non-ATPase 11a [Source:NCB... [more]
psmd11a5.252e-1723.12proteasome 26S subunit, non-ATPase 11a [Source:NCB... [more]
psmd11b1.378e-1623.40proteasome 26S subunit, non-ATPase 11b [Source:NCB... [more]
back to top
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cops20.000e+070.55COP9 signalosome subunit 2 [Source:NCBI gene;Acc:5... [more]
cops20.000e+071.77COP9 signalosome subunit 2 [Source:NCBI gene;Acc:5... [more]
psmd112.053e-1322.01proteasome 26S subunit, non-ATPase 11 [Source:NCBI... [more]
psmd111.217e-1122.56proteasome 26S subunit, non-ATPase 11 [Source:NCBI... [more]
psmd118.809e-1122.04proteasome 26S subunit, non-ATPase 11 [Source:NCBI... [more]
back to top
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cops20.000e+070.55COP9 signalosome subunit 2 [Source:MGI Symbol;Acc:... [more]
Cops20.000e+069.39COP9 signalosome subunit 2 [Source:MGI Symbol;Acc:... [more]
Cops21.171e-17359.11COP9 signalosome subunit 2 [Source:MGI Symbol;Acc:... [more]
Psmd114.682e-1522.56proteasome (prosome, macropain) 26S subunit, non-A... [more]
Psmd114.682e-1522.56proteasome (prosome, macropain) 26S subunit, non-A... [more]
back to top
BLAST of COP9 signalosome complex subunit 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P61203|CSN2_RAT0.000e+070.55COP9 signalosome complex subunit 2 OS=Rattus norve... [more]
sp|P61202|CSN2_MOUSE0.000e+070.55COP9 signalosome complex subunit 2 OS=Mus musculus... [more]
sp|P61201|CSN2_HUMAN0.000e+070.55COP9 signalosome complex subunit 2 OS=Homo sapiens... [more]
sp|Q6IQT4|CSN2_DANRE0.000e+070.55COP9 signalosome complex subunit 2 OS=Danio rerio ... [more]
sp|Q6IR75|CSN2_XENLA0.000e+070.31COP9 signalosome complex subunit 2 (Fragment) OS=X... [more]
back to top
BLAST of COP9 signalosome complex subunit 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YDG30.000e+074.28COP9 constitutive photomorphogenic subunit 2 OS=Fa... [more]
A0A2H1CKI70.000e+074.28COP9 constitutive photomorphogenic subunit 2 OS=Fa... [more]
A0A183AYY60.000e+074.04PCI domain-containing protein OS=Echinostoma capro... [more]
A0A074ZXY00.000e+072.60PCI domain protein OS=Opisthorchis viverrini OX=61... [more]
A0A4V3SEB60.000e+072.37PCI domain-containing protein OS=Opisthorchis feli... [more]
back to top
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cops20.000e+070.55COP9 signalosome subunit 2 [Source:NCBI gene;Acc:1... [more]
psmd11b2.375e-1422.5626S proteasome non-ATPase regulatory subunit 11B [... [more]
psmd11a1.900e-1321.4526S proteasome non-ATPase regulatory subunit 11A [... [more]
psmd11a3.320e-720.5426S proteasome non-ATPase regulatory subunit 11A [... [more]
back to top
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000001532.10.000e+068.62pep scaffold:Pmarinus_7.0:GL477608:3889:17671:-1 g... [more]
psmd11b3.478e-1522.63proteasome 26S subunit, non-ATPase 11b [Source:NCB... [more]
back to top
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO476540.000e+064.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316012.253e-1427.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of COP9 signalosome complex subunit 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cops20.000e+070.71COP9 signalosome subunit 2 [Source:NCBI gene;Acc:1... [more]
psmd11b4.533e-1522.8426S proteasome non-ATPase regulatory subunit 11B [... [more]
ENSORLT00000023519.25.404e-1321.7326S proteasome non-ATPase regulatory subunit 11A [... [more]
psmd11b4.062e-1122.0126S proteasome non-ATPase regulatory subunit 11B [... [more]
back to top
BLAST of COP9 signalosome complex subunit 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000023422.10.000e+0100.00SMESG000023422.1[more]
SMESG000048466.11.986e-1423.38SMESG000048466.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032295 ID=SMED30032295|Name=COP9 signalosome complex subunit 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1549bp
TCTATATAAATCTTATATGCTATGTCAGACTTTGATGATGATATGGACGA
TGGAGAATTATCCATTGAATATTCATCTGAAGACAACTCTGAACCAGATG
TTGATTTAGAAAATCAATATTATCATGCAAAATCATTAAAAGAAGCAAAT
CCTCTTTCAGCTATAGAAGAATTTAAAAAGGTGTTACAAATAGAATCATC
GGGAGAACGTGGTGAATGGGGATTTAAGGCGTTAAAACAGATTATTAAAA
TACATTTTCGTTTGAATAATTCCGATGAAATGATGAGAAATTATGTTCAA
CTGTTAACATATATCAGATCAGCAGTAACTAGGAATTATTCTGAAAAGTC
TATTAATTCTATTTTGGATTATGTCTCAACATCTAAACAAATGACTATGC
TTCAGAAATTCTATACAACAACATTAGAAGCTTTGAAGGAAGCTCGAAAT
GAACGATTGTGGTTTAAGACTAATACGAAGTTAGGAAAATTGTATCTGGA
AATGAATCAATGGGTTTTGCTTTTAAGAATAATTAAAGAGCTTCGGCAAT
CATGTCAAACAAATGACGGGGAAGATGATTTACGAAAAGGAACTCAATTA
TTAGAAATATATGCATTAGAAATACAAATGTATACCATTCAAAGAAACAA
TAAAAAACTTAAAAATCTTTATGAGCAATCTCTTCATATTAAATCAGCTA
TTCCTCATCCGTTAATTATGGGAATTATTCGCGAATGTGGAGGTAAAATG
CATTTACGACAGGGTGAATTTGATAAGGCTCATACTGATTTCTTTGAAGC
ATTTAAAAATTATGATGAATCTGGAAGTCAGCGTCGAACTCAATGCTTGA
AATATTTGGTGTTGTCGAATATGCTAACAAAATCTGCTATCAATCCATTC
GATTCACAAGAAATAAAACCCTATCGAGACAATCCAGAAATCGTAGCAAT
GACAAATCTCGTTTCAGCCTATCAAATAAATGACATCAAAACATTTGAAA
GTACTCTAACGGAAAACGAGGATACCATTATGCAAGATCCATTCATTCGA
GAACACATCGAAGAGCTACTGCGAAACATTCGAATTGATGTGTTGATTGG
ACTTGTCAAGCCTTATAAAACAGTTCGAATTGAATTTCTCGCTCAGCGGT
TGAATATCAGCACAAACGAAGTTGAAAGTCTGCTCGTTTCGTGCATTGCA
GACAACGTGATCAAGGGCAAAATCGATCAAAAATCCGACATTCTTGTGAT
CGATGAACCAAGAAAAGAAGCCAAATACAAATCGCTAGATAAATTGATTA
GTGAGATTGACAAGTTGCATCATAATCTTGTATCTCGAGTTGTCGATCAT
TCGTCTTGATCAGTTTATATTGTGTTATTTTTGCTTTCCGATTGAGATGA
GGGATTGAATAGTGTTGTGATGAATAAATACGGGCAATTGTAGTTTTTTA
TATAATCAATTCTGTCCCAGACAGATTTATGATCTGTGTTCATTAAATTG
ATTTCTTGCGATTGTAAACTGTCAATTCAATTACAAATTTTTCTATGTC
back to top

protein sequence of SMED30032295-orf-1

>SMED30032295-orf-1 ID=SMED30032295-orf-1|Name=SMED30032295-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=446bp
MSDFDDDMDDGELSIEYSSEDNSEPDVDLENQYYHAKSLKEANPLSAIEE
FKKVLQIESSGERGEWGFKALKQIIKIHFRLNNSDEMMRNYVQLLTYIRS
AVTRNYSEKSINSILDYVSTSKQMTMLQKFYTTTLEALKEARNERLWFKT
NTKLGKLYLEMNQWVLLLRIIKELRQSCQTNDGEDDLRKGTQLLEIYALE
IQMYTIQRNNKKLKNLYEQSLHIKSAIPHPLIMGIIRECGGKMHLRQGEF
DKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSAINPFDSQEIKP
YRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELL
RNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGK
IDQKSDILVIDEPRKEAKYKSLDKLISEIDKLHHNLVSRVVDHSS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR037750COPS2
IPR036390WH_DNA-bd_sf
IPR000717PCI_dom
IPR011990TPR-like_helical_dom_sf
IPR011991WHTH_DNA-bd_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003714transcription corepressor activity
Vocabulary: biological process
TermDefinition
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0000338protein deneddylation
GO:0008283cell proliferation
GO:0030182neuron differentiation
GO:0035914skeletal muscle cell differentiation
GO:0045892negative regulation of transcription, DNA-templated
GO:1903507negative regulation of nucleic acid-templated transcription
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0008180COP9 signalosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM00753PINTcoord: 344..425
e-value: 2.1E-19
score: 80.4
NoneNo IPR availableGENE3DG3DSA:1.25.40.570coord: 59..412
e-value: 1.9E-103
score: 348.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..27
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..29
NoneNo IPR availablePANTHERPTHR1067826S PROTEASOME NON-ATPASE REGULATORY SUBUNIT 11/COP9 SIGNALOSOME COMPLEX SUBUNIT 2coord: 7..439
IPR000717Proteasome component (PCI) domainSMARTSM00088PINT_4coord: 344..425
e-value: 2.1E-19
score: 80.4
IPR000717Proteasome component (PCI) domainPFAMPF01399PCIcoord: 309..411
e-value: 2.2E-24
score: 86.0
IPR000717Proteasome component (PCI) domainPROSITEPS50250PCIcoord: 253..415
score: 28.582
IPR037750COP9 signalosome complex subunit 2PANTHERPTHR10678:SF3COP9 SIGNALOSOME COMPLEX SUBUNIT 2coord: 7..439
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 338..415