S1 motif domain-containing protein

Overview
NameS1 motif domain-containing protein
Smed IDSMED30032283
Length (bp)976
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of S1 motif domain-containing protein (SMED30032283) t-SNE clustered cells

Violin plots show distribution of expression levels for S1 motif domain-containing protein (SMED30032283) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of S1 motif domain-containing protein (SMED30032283) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for S1 motif domain-containing protein (SMED30032283) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032283

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30032283h1SMcG0004871 SmedASXL_001361SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30032283h1SMcG0004871 dd_Smed_v4_6386_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032283h1SMcG0004871 dd_Smed_v4_6386_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of S1 motif domain-containing protein vs. Ensembl Human
Match: EXOSC2 (exosome component 2 [Source:HGNC Symbol;Acc:HGNC:17097])

HSP 1 Score: 177.563 bits (449), Expect = 4.150e-53
Identity = 116/289 (40.14%), Postives = 166/289 (57.44%), Query Frame = 1
Query:   16 MNINIEIKQNPKLVRPPELCINKIYSPGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPTRSTNFK----FEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVENGYSGADLLKDECIDRI 870
            M + + + + P   R        +  PG++I T   ++ G+ T+           +E + +SV G V  V+KLI VK   + Y+G+VGD VVGR+ EV + RWK+ETNSR  S+L LS++ LPGGE RRRS EDE AMR FL EGDLI  EV+ +  D  +SL  R +  GKLGQG++++V  SL+  QK H H LP G ++ILG NG +W+ PT     +    F  +   VS    E + R+ NC+  L  + + L + SI Y YEAS+ +     D+LK E ++ I
Sbjct:    3 MEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYM---------GEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIK--DILKPEIMEEI 280          
BLAST of S1 motif domain-containing protein vs. Ensembl Human
Match: EXOSC2 (exosome component 2 [Source:HGNC Symbol;Acc:HGNC:17097])

HSP 1 Score: 159.844 bits (403), Expect = 2.273e-46
Identity = 112/289 (38.75%), Postives = 158/289 (54.67%), Query Frame = 1
Query:   16 MNINIEIKQNPKLVRPPELCINKIYSPGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPTRSTNFK----FEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVENGYSGADLLKDECIDRI 870
            M + + + + P   R        +  PG++I T   ++ G+ T+           +E + +SV G V  V+KLI VK   + Y+G+VGD VVGR+ EV + RWK+ETNSR  S+L LS++ LPGGE RRRS EDE AMR FL EGDLI  EV+ +  D  +SL  R +  G        KV  SL+  QK H H LP G ++ILG NG +W+ PT     +    F  +   VS    E + R+ NC+  L  + + L + SI Y YEAS+ +     D+LK E ++ I
Sbjct:    3 MEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYM---------GEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYG--------KVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIK--DILKPEIMEEI 272          
BLAST of S1 motif domain-containing protein vs. Ensembl Human
Match: EXOSC2 (exosome component 2 [Source:HGNC Symbol;Acc:HGNC:17097])

HSP 1 Score: 144.821 bits (364), Expect = 8.691e-41
Identity = 105/289 (36.33%), Postives = 151/289 (52.25%), Query Frame = 1
Query:   16 MNINIEIKQNPKLVRPPELCINKIYSPGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPTRSTNFK----FEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVENGYSGADLLKDECIDRI 870
            M + + + + P   R        +  PG++I T   ++ G+ T+           +E + +SV G V  V+KLI VK   + Y+G+VGD VVGR+ EV + RWK+ETNSR  S+L LS++ LPGGE RRRS EDE AMR FL EGDLI                           G++++V  SL+  QK H H LP G ++ILG NG +W+ PT     +    F  +   VS    E + R+ NC+  L  + + L + SI Y YEAS+ +     D+LK E ++ I
Sbjct:    3 MEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYM---------GEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLI--------------------------SGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIK--DILKPEIMEEI 254          
BLAST of S1 motif domain-containing protein vs. Ensembl Human
Match: EXOSC2 (exosome component 2 [Source:HGNC Symbol;Acc:HGNC:17097])

HSP 1 Score: 140.584 bits (353), Expect = 1.726e-39
Identity = 97/247 (39.27%), Postives = 135/247 (54.66%), Query Frame = 1
Query:   94 PGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPTRSTNFK----FEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVEN 822
            PG++I T   ++ G+ T+           +E + +SV G V  V+KLI VK   + Y+G+VGD VVGR+ EV + RWK+ETNSR  S+L LS++ LPGGE RRRS EDE AMR FL EGDLI                           G++++V  SL+  QK H H LP G ++ILG NG +W+ PT     +    F  +   VS    E + R+ NC+  L  + + L + SI Y YEAS+ +
Sbjct:   25 PGDTITTDTGFMRGHGTYM---------GEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLI--------------------------SGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPH 236          
BLAST of S1 motif domain-containing protein vs. Ensembl Human
Match: EXOSC2 (exosome component 2 [Source:HGNC Symbol;Acc:HGNC:17097])

HSP 1 Score: 134.42 bits (337), Expect = 7.410e-37
Identity = 97/289 (33.56%), Postives = 142/289 (49.13%), Query Frame = 1
Query:   16 MNINIEIKQNPKLVRPPELCINKIYSPGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPTRSTNFK----FEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVENGYSGADLLKDECIDRI 870
            M + + + + P   R        +  PG++I T   ++ G+ T+           +E + +SV G V  V+KLI VK   + Y+G+VGD VVGR+ E            RR S                   EDE AMR FL EGDLI  EV+ +  D  +SL  R +  GKLGQG++++V  SL+  QK H H LP G ++ILG NG +W+ PT     +    F  +   VS    E + R+ NC+  L  + + L + SI Y YEAS+ +     D+LK E ++ I
Sbjct:    3 MEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYM---------GEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITE------------RRRS------------------AEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIK--DILKPEIMEEI 250          
BLAST of S1 motif domain-containing protein vs. Ensembl Celegans
Match: exos-2 (EXOSome (Multiexonuclease complex) component [Source:UniProtKB/TrEMBL;Acc:Q95XD0])

HSP 1 Score: 129.028 bits (323), Expect = 8.476e-35
Identity = 102/272 (37.50%), Postives = 146/272 (53.68%), Query Frame = 1
Query:   79 NKIYSPGESIA-TQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPTRSTNFKFEIDQS------IVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVENGYSGADLLKDECIDRIA 873
             KI  PG S+    + ++ G+ T+          +   I SS+ G V  +++L+ VK     Y G+VGD VV RV+EV   RWK +  SR  + L L +V LPGG+ RR+  EDE+ M +FL  G+LI  EV++++HD  L L  R+   GKL QG++IKVP  LI   KKH H LP+G+ +I+GCNG VWV P+       E D S      IV  +    + RI  CV+LL    + +   S+   YE S    Y   +L + +   R+A
Sbjct:   29 TKIVIPGHSVCDAPQQFMRGHGTYV---------RDGEIVSSLSGVVQQLNRLLMVKTIKQRYAGEVGDVVVARVVEVQAKRWKCDVASRLHANLPLGSVLLPGGDFRRKDVEDEEKMSEFLKNGELICAEVQQVQHDGTLMLHTRNNKYGKLQQGILIKVPPHLIKKSKKHFHTLPYGMAVIIGCNGSVWVTPSLPET-TLEEDGSHVHEFQIVPPDVRVTMVRIAACVRLLRDYSISIYLNSLTTCYEMS--QPYEIKELAEQDTSSRLA 288          
BLAST of S1 motif domain-containing protein vs. Ensembl Fly
Match: Rrp4 (gene:FBgn0034879 transcript:FBtr0072111)

HSP 1 Score: 177.948 bits (450), Expect = 1.672e-53
Identity = 111/278 (39.93%), Postives = 170/278 (61.15%), Query Frame = 1
Query:   82 KIYSPGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPTR-------STNFKFEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVENGYSGADLLKDECIDRIAEVTEIQM 894
            ++Y+PGE +  +  ++ G+ TF       +E+  E+I SSV G +  V+KLI V+   S Y+G++GD VV RV EV + RW+++TNSR  SIL LS+V LPGGE RRRS EDE+ MR++LDEGDLI  EV+ I  +  LSL  R +  GKL QG+++KV  +L+  +K H H LP G ++ILG NG +W+ PT+          F   +++ +  ++  E + R+ N +  L+K  + + + SI YAYE S+   Y   +LL+   I  I + T+ ++
Sbjct:   28 RVYTPGEVLMPEAGFMRGHGTF-------VED--ENIKSSVAGVIQKVNKLISVRPLKSRYVGEIGDVVVARVSEVQQKRWRVDTNSRLDSILLLSSVNLPGGELRRRSAEDEQMMRRYLDEGDLISAEVQNIFEEGSLSLYTRSLKYGKLSQGILVKVFPALVKRRKMHFHNLPCGASVILGNNGYIWISPTKGQEEEGGEGGFAQNLNEHVPRAD-REVIARLRNSILALAKCKLMIYDTSIQYAYEESLR--YEAHELLQQNAIYDIGQQTQARL 293          
BLAST of S1 motif domain-containing protein vs. Ensembl Fly
Match: Rrp4 (gene:FBgn0034879 transcript:FBtr0343267)

HSP 1 Score: 177.948 bits (450), Expect = 1.672e-53
Identity = 111/278 (39.93%), Postives = 170/278 (61.15%), Query Frame = 1
Query:   82 KIYSPGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPTR-------STNFKFEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVENGYSGADLLKDECIDRIAEVTEIQM 894
            ++Y+PGE +  +  ++ G+ TF       +E+  E+I SSV G +  V+KLI V+   S Y+G++GD VV RV EV + RW+++TNSR  SIL LS+V LPGGE RRRS EDE+ MR++LDEGDLI  EV+ I  +  LSL  R +  GKL QG+++KV  +L+  +K H H LP G ++ILG NG +W+ PT+          F   +++ +  ++  E + R+ N +  L+K  + + + SI YAYE S+   Y   +LL+   I  I + T+ ++
Sbjct:   28 RVYTPGEVLMPEAGFMRGHGTF-------VED--ENIKSSVAGVIQKVNKLISVRPLKSRYVGEIGDVVVARVSEVQQKRWRVDTNSRLDSILLLSSVNLPGGELRRRSAEDEQMMRRYLDEGDLISAEVQNIFEEGSLSLYTRSLKYGKLSQGILVKVFPALVKRRKMHFHNLPCGASVILGNNGYIWISPTKGQEEEGGEGGFAQNLNEHVPRAD-REVIARLRNSILALAKCKLMIYDTSIQYAYEESLR--YEAHELLQQNAIYDIGQQTQARL 293          
BLAST of S1 motif domain-containing protein vs. Ensembl Zebrafish
Match: exosc2 (exosome component 2 [Source:ZFIN;Acc:ZDB-GENE-050417-27])

HSP 1 Score: 181.03 bits (458), Expect = 1.343e-54
Identity = 115/263 (43.73%), Postives = 157/263 (59.70%), Query Frame = 1
Query:   94 PGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPTRSTNFK----FEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVENGYSGADLLKDECIDRI 870
            PG+ I +   ++ G+ T+           ++ + +SV G+V  V+KLI VK   + Y G+VGD VVGR+ EV + RWK+ETNSR  S+L LS V LPGGE RRRS +DE AMR +L EGDLI  EV+ I  D  LSL  R +  GKLGQG+++ V  SL+  QK H H LP G +LILG NG VW+ PT +   +    F      VS    E V R+ NC+  L+ + V L + S+ Y YEAS+++     D+LK E ++ I
Sbjct:   31 PGDVITSDTGFMRGHGTYM---------DEDRLTASVAGQVERVNKLICVKPLKTRYNGEVGDVVVGRITEVQQKRWKVETNSRLDSVLLLSAVNLPGGELRRRSTQDELAMRDYLQEGDLISAEVQSIFSDGALSLHTRSLKYGKLGQGVLVYVSPSLVKRQKTHFHNLPCGASLILGNNGYVWLSPTPALQEEQAGGFYTSMEPVSLSDREVVSRLRNCLLALANQKVLLFDTSVLYCYEASLQHQIK--DILKPEIMEEI 282          
BLAST of S1 motif domain-containing protein vs. Ensembl Xenopus
Match: exosc2 (exosome component 2 [Source:NCBI gene;Acc:595050])

HSP 1 Score: 169.088 bits (427), Expect = 6.811e-50
Identity = 107/268 (39.93%), Postives = 158/268 (58.96%), Query Frame = 1
Query:   85 IYSPGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPT------RSTNFKFEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVENGYSGADLLKDECIDRI 870
            + +PG++I T   ++ G+ T+          + + + +SV G V  V+KLI V+   + Y G+VGD VVGR+ EV + RWK++TNSR  S+L LS V LPGGE RRRS +DE AMR +L EGDLI  EV+ +  D  LSL  R +  GKLGQG++++V  SLI  +K H H LP G ++IL  NG +W+  T       +  F   ++   +S    E + R+ NC+  L+ + + L + S+ Y YEAS+   +   +LLK E I+ I
Sbjct:   26 LVTPGDTITTDTGFMRGHGTY---------TEDDKLVASVAGVVERVNKLICVRALKARYNGEVGDIVVGRITEVQQKRWKVDTNSRLDSVLILSAVNLPGGELRRRSAKDELAMRDYLQEGDLISAEVQAVYSDGALSLHTRSLKYGKLGQGVLVRVSPSLIKRRKTHFHNLPCGASIILANNGFIWLCATPKEMEEEAGGFITNLEPVALSDR--EVISRLRNCILALASQKMLLYDTSVLYCYEASL--AHQIKELLKVEVIEDI 280          
BLAST of S1 motif domain-containing protein vs. Ensembl Xenopus
Match: exosc2 (exosome component 2 [Source:NCBI gene;Acc:595050])

HSP 1 Score: 166.392 bits (420), Expect = 7.295e-49
Identity = 101/252 (40.08%), Postives = 150/252 (59.52%), Query Frame = 1
Query:   85 IYSPGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPT------RSTNFKFEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVEN 822
            + +PG++I T   ++ G+ T+          + + + +SV G V  V+KLI V+   + Y G+VGD VVGR+ EV + RWK++TNSR  S+L LS V LPGGE RRRS +DE AMR +L EGDLI  EV+ +  D  LSL  R +  GKLGQG++++V  SLI  +K H H LP G ++IL  NG +W+  T       +  F   ++   +S    E + R+ NC+  L+ + + L + S+ Y YEAS+ +
Sbjct:   26 LVTPGDTITTDTGFMRGHGTY---------TEDDKLVASVAGVVERVNKLICVRALKARYNGEVGDIVVGRITEVQQKRWKVDTNSRLDSVLILSAVNLPGGELRRRSAKDELAMRDYLQEGDLISAEVQAVYSDGALSLHTRSLKYGKLGQGVLVRVSPSLIKRRKTHFHNLPCGASIILANNGFIWLCATPKEMEEEAGGFITNLEPVALSDR--EVISRLRNCILALASQKMLLYDTSVLYCYEASLAH 266          
BLAST of S1 motif domain-containing protein vs. Ensembl Xenopus
Match: exosc2 (exosome component 2 [Source:NCBI gene;Acc:595050])

HSP 1 Score: 160.229 bits (404), Expect = 7.049e-47
Identity = 101/235 (42.98%), Postives = 143/235 (60.85%), Query Frame = 1
Query:  184 ESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPT------RSTNFKFEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVENGYSGADLLKDECIDRI 870
            + + +SV G V  V+KLI V+   + Y G+VGD VVGR+ EV + RWK++TNSR  S+L LS V LPGGE RRRS +DE AMR +L EGDLI  EV+ +  D  LSL  R +  GKLGQG++++V  SLI  +K H H LP G ++IL  NG +W+  T       +  F   ++   +S    E + R+ NC+  L+ + + L + S+ Y YEAS+   +   +LLK E I+ I
Sbjct:   10 DKLVASVAGVVERVNKLICVRALKARYNGEVGDIVVGRITEVQQKRWKVDTNSRLDSVLILSAVNLPGGELRRRSAKDELAMRDYLQEGDLISAEVQAVYSDGALSLHTRSLKYGKLGQGVLVRVSPSLIKRRKTHFHNLPCGASIILANNGFIWLCATPKEMEEEAGGFITNLEPVALSDR--EVISRLRNCILALASQKMLLYDTSVLYCYEASL--AHQIKELLKVEVIEDI 240          
BLAST of S1 motif domain-containing protein vs. Ensembl Mouse
Match: Exosc2 (exosome component 2 [Source:MGI Symbol;Acc:MGI:2385133])

HSP 1 Score: 179.104 bits (453), Expect = 6.704e-54
Identity = 114/263 (43.35%), Postives = 158/263 (60.08%), Query Frame = 1
Query:   94 PGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPTRSTNFK----FEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVENGYSGADLLKDECIDRI 870
            PG++I T   ++ G+ T+           +E + +SV G V  V+KLI VK   + Y G+VGD VVGR+ EV + RWK+ETNSR  S+L LS++ LPGGE RRRS EDE AMR FL EGDLI  EV+ +  D  +SL  R +  GKLGQG++++V  SL+  QK H H LP G ++ILG NG +W+ PT     +    F  +   V+    E + R+ NCV LL  + + L + SI Y YEAS+   +   D+LK E ++ I
Sbjct:   29 PGDTITTDTGFMRGHGTYM---------GEEKLIASVAGSVERVNKLICVKALKTRYNGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKDEDAGGFIANLEPVALSDREVISRLRNCVVLLVTQRMMLFDTSILYCYEASL--AHQIKDILKPEVMEEI 280          
BLAST of S1 motif domain-containing protein vs. Ensembl Mouse
Match: Exosc2 (exosome component 2 [Source:MGI Symbol;Acc:MGI:2385133])

HSP 1 Score: 133.65 bits (335), Expect = 7.742e-37
Identity = 94/260 (36.15%), Postives = 132/260 (50.77%), Query Frame = 1
Query:   94 PGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPTRSTNFK----FEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVENGYSGADLLKDECI 861
            PG++I T   ++ G+ T+           +E + +SV G V  V+KLI VK   + Y G+VGD VVGR+ E            RR S                   EDE AMR FL EGDLI  EV+ +  D  +SL  R +  GKLGQG++++V  SL+  QK H H LP G ++ILG NG +W+ PT     +    F  +   V+    E + R+ NCV LL  + + L + SI Y YEAS+   +   D+LK E +
Sbjct:   29 PGDTITTDTGFMRGHGTYM---------GEEKLIASVAGSVERVNKLICVKALKTRYNGEVGDIVVGRITE------------RRRS------------------AEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKDEDAGGFIANLEPVALSDREVISRLRNCVVLLVTQRMMLFDTSILYCYEASL--AHQIKDILKPEVM 247          
BLAST of S1 motif domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8VBV3|EXOS2_MOUSE (Exosome complex component RRP4 OS=Mus musculus OX=10090 GN=Exosc2 PE=1 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 4.690e-53
Identity = 114/263 (43.35%), Postives = 158/263 (60.08%), Query Frame = 1
Query:   94 PGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPTRSTNFK----FEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVENGYSGADLLKDECIDRI 870
            PG++I T   ++ G+ T+           +E + +SV G V  V+KLI VK   + Y G+VGD VVGR+ EV + RWK+ETNSR  S+L LS++ LPGGE RRRS EDE AMR FL EGDLI  EV+ +  D  +SL  R +  GKLGQG++++V  SL+  QK H H LP G ++ILG NG +W+ PT     +    F  +   V+    E + R+ NCV LL  + + L + SI Y YEAS+   +   D+LK E ++ I
Sbjct:   29 PGDTITTDTGFMRGHGTYM---------GEEKLIASVAGSVERVNKLICVKALKTRYNGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKDEDAGGFIANLEPVALSDREVISRLRNCVVLLVTQRMMLFDTSILYCYEASL--AHQIKDILKPEVMEEI 280          
BLAST of S1 motif domain-containing protein vs. UniProt/SwissProt
Match: sp|Q13868|EXOS2_HUMAN (Exosome complex component RRP4 OS=Homo sapiens OX=9606 GN=EXOSC2 PE=1 SV=2)

HSP 1 Score: 177.563 bits (449), Expect = 1.993e-52
Identity = 116/289 (40.14%), Postives = 166/289 (57.44%), Query Frame = 1
Query:   16 MNINIEIKQNPKLVRPPELCINKIYSPGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPTRSTNFK----FEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVENGYSGADLLKDECIDRI 870
            M + + + + P   R        +  PG++I T   ++ G+ T+           +E + +SV G V  V+KLI VK   + Y+G+VGD VVGR+ EV + RWK+ETNSR  S+L LS++ LPGGE RRRS EDE AMR FL EGDLI  EV+ +  D  +SL  R +  GKLGQG++++V  SL+  QK H H LP G ++ILG NG +W+ PT     +    F  +   VS    E + R+ NC+  L  + + L + SI Y YEAS+ +     D+LK E ++ I
Sbjct:    3 MEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYM---------GEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIK--DILKPEIMEEI 280          
BLAST of S1 motif domain-containing protein vs. UniProt/SwissProt
Match: sp|Q2KID0|EXOS2_BOVIN (Exosome complex component RRP4 OS=Bos taurus OX=9913 GN=EXOSC2 PE=2 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 2.577e-52
Identity = 114/263 (43.35%), Postives = 157/263 (59.70%), Query Frame = 1
Query:   94 PGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPT----RSTNFKFEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVENGYSGADLLKDECIDRI 870
            PG++I T   ++ G+ T+           +E + +SV G V  V+KLI VK   + Y G+VGD VVGR+ EV + RWK+ETNSR  S+L LS++ LPGGE RRRS EDE AMR FL EGDLI  EV+ +  D  +SL  R +  GKLGQG++++V  SL+  QK H H LP G ++ILG NG +WV PT          F  +   VS    E + R+ NC+  L+ + + L + SI Y YEAS+ +     D+LK E ++ I
Sbjct:   29 PGDTITTDTGFMRGHGTYM---------GEEKLIASVAGSVERVNKLICVKALKTRYNGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWVYPTPEHKEDDAGGFIANLEPVSLTDREVISRLRNCIVSLATQRMMLYDTSILYCYEASLPHQIK--DILKPEIMEEI 280          
BLAST of S1 motif domain-containing protein vs. UniProt/SwissProt
Match: sp|Q09704|RRP4_SCHPO (Exosome complex component rrp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rrp4 PE=3 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 1.951e-40
Identity = 91/259 (35.14%), Postives = 144/259 (55.60%), Query Frame = 1
Query:   85 IYSPGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPTRS--------TNFKFEIDQSIVSSEYYEA-------VCRIGNCVKLLSKKGVPLSEASICYAYEASV 816
            + +PG+ +     ++ G+ T+          +   IY+SV G V  V+KLI VK   S Y+ ++GD ++G++ EV   RWK++  +++ ++L LS++ LPGG  RR+ E DE  MR F  EGDL+V EV++   D  +S+  R +  GKL  G+ +KVP +L+V  K H + L  GV +IL  NG VWV             T  + E  +SI S+E  E        + R+  C+K L+ + +PL++ASI   YE+S+
Sbjct:   57 LVTPGQLVTDDPQFMRGHGTY---------FEDGGIYASVAGSVQRVNKLISVKPLRSKYVPEIGDLIIGKIAEVQPKRWKVDIGAKQNAVLMLSSINLPGGIQRRKLETDELQMRSFFQEGDLLVAEVQQYFSDGSVSIHTRSLKYGKLRNGVFLKVPPALVVRSKSHAYALAGGVDIILSVNGYVWVSKHNENQHSSVSITRLEEEASESIYSNENDEIDGYTRLNISRVSICIKGLASRSLPLTQASITNFYESSL 306          
BLAST of S1 motif domain-containing protein vs. UniProt/SwissProt
Match: sp|P38792|RRP4_YEAST (Exosome complex component RRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRP4 PE=1 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 4.881e-38
Identity = 99/285 (34.74%), Postives = 144/285 (50.53%), Query Frame = 1
Query:   82 KIYSPGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWV------------------------GPTRSTN----------------FKFEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASV 816
            +I +PGE +     ++ G+ T+ L N +         YSSV G V  V++L+ V      Y  + GD VVGR+ EV   RWK++   ++ ++L L +V LPGG  RR+SE DE  MR FL EGDL+  EV+ +  D   SL  R +  GKL  G+  +VPSSLIV  K HTH LP  +T++LG NG +W+                        GPT + +                +  E D SI S+   +A+CR  N +K L+   + +++  I  AYEAS+
Sbjct:   53 QIVTPGELVTDDPIWMRGHGTYFLDNMT---------YSSVAGTVSRVNRLLSVIPLKGRYAPETGDHVVGRIAEVGNKRWKVDIGGKQHAVLMLGSVNLPGGILRRKSESDELQMRSFLKEGDLLNAEVQSLFQDGSASLHTRSLKYGKLRNGMFCQVPSSLIVRAKNHTHNLPGNITVVLGVNGYIWLRKTSQMDLARDTPSANNSSSIKSTGPTGAVSLNPSITRLEEESSWQIYSDENDPSI-SNNIRQAICRYANVIKALAFCEIGITQQRIVSAYEASM 327          
BLAST of S1 motif domain-containing protein vs. TrEMBL
Match: A0A182QT87 (S1 motif domain-containing protein OS=Anopheles farauti OX=69004 PE=4 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 4.645e-56
Identity = 120/307 (39.09%), Postives = 180/307 (58.63%), Query Frame = 1
Query:   16 MNINIEIKQNPKLVRPP----ELCINKIYSPGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGP------TRSTNFKFEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVENGYSGADLLKDECIDRIAEVTEIQMGAIQ 906
            M  N+ I+     V  P    E    ++++PGE + +Q+ ++ G+ T+          + + + SSV G +  V+KLI VK     Y+G++GD VV RV +V + RWK++TNSR  S+L LS+V LPGGE RRR  EDEK MR++L EGDLI  EV+ +  D VLSL  R +  GKLGQG+++KV  SLI  +K H H LP G ++ILG NG +W+ P           F   +D  +V+ +  + + R+ NC+  L+   + L + SI YAYE S    Y  A+LL +EC+  +A +T+ +M A++
Sbjct:    1 MTSNVSIRLASDRVNIPLITDESQSQRLFTPGEVVTSQQGFMRGHGTYM---------EDDMLKSSVAGVMVQVNKLITVKALKGRYVGEIGDVVVARVTDVQEKRWKVDTNSRLDSVLLLSSVNLPGGELRRRGVEDEKQMRKYLQEGDLISAEVQNVHSDGVLSLHTRSLKYGKLGQGILVKVFPSLIQRRKTHFHNLPCGASIILGNNGFIWIAPITNNEGGEGGGFTQNLD-DVVTKDDRKTIARLKNCILALAHCKMMLHDTSILYAYEES--QKYEIAELLHEECMTDVAFLTQHRMRALE 295          
BLAST of S1 motif domain-containing protein vs. TrEMBL
Match: A0A182PI85 (S1 motif domain-containing protein OS=Anopheles epiroticus OX=199890 PE=4 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 1.437e-55
Identity = 120/307 (39.09%), Postives = 181/307 (58.96%), Query Frame = 1
Query:   16 MNINIEIKQNPKLVRPP----ELCINKIYSPGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPTRST------NFKFEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVENGYSGADLLKDECIDRIAEVTEIQMGAIQ 906
            MN N+ I+   + V  P    E    ++++PGE + +Q+ ++ G+ T+          + ++I SSV G +  V+KLI VK     Y+G++GD VV RV EV + RWK++TNSR  S+L LS+V LPGGE RRR  EDEK MR++L EGDLI  EV+ +  D  LSL  R +  GKL QG+++KV  SLI  +K H H LP G ++ILG NG +W+ P  ++       F   +D  +V+ E  + + R+ NC+  L+   + L + SI YAYE S    Y  A+LL  EC+  +A +T+ ++  ++
Sbjct:    1 MNSNVSIRLASERVNIPLISDEEKNQRLFTPGEVVTSQQGFMRGHGTYM---------EDDTIKSSVAGVMVQVNKLITVKALKGRYVGEIGDVVVARVTEVQEKRWKVDTNSRLDSMLLLSSVNLPGGELRRRGVEDEKQMRKYLQEGDLISAEVQNVHSDGTLSLHTRSLKYGKLSQGILVKVFPSLIQRRKTHFHNLPCGASIILGNNGFIWISPMMNSEGGEGGGFTQNLD-DVVTKEDRQTIARLRNCILALAHCKMMLYDTSILYAYEES--QKYEVAELLHQECMTDVAFLTQHRLRVLE 295          
BLAST of S1 motif domain-containing protein vs. TrEMBL
Match: A0A182HFY7 (S1 motif domain-containing protein OS=Anopheles arabiensis OX=7173 PE=4 SV=2)

HSP 1 Score: 191.045 bits (484), Expect = 4.121e-55
Identity = 120/307 (39.09%), Postives = 180/307 (58.63%), Query Frame = 1
Query:   16 MNINIEIKQNPKLVRPP----ELCINKIYSPGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPTRST------NFKFEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVENGYSGADLLKDECIDRIAEVTEIQMGAIQ 906
            MN N+ I+     V  P    E    ++++PGE + +Q+ ++ G+ T+          + ++I SSV G +  V+KLI VK     Y+G++GD VV RV EV + RWK++TNSR  S+L LS+V LPGGE RRR  EDEK MR++L EGDLI  EV+ +  D  LSL  R +  GKL QG+++KV  SLI  +K H H LP G ++ILG NG +W+ P  ++       F   +D  +V+ E  + + R+ NC+  L+   + L + SI YAYE S    Y  ++LL  EC+  IA +T+ ++  ++
Sbjct:    1 MNSNVSIRLACDRVNIPLISDESKSQRLFTPGEVVTSQQGFMRGHGTYM---------EDDTIKSSVAGVMVQVNKLITVKALKGRYVGEIGDVVVARVTEVQEKRWKVDTNSRLDSMLLLSSVNLPGGELRRRGVEDEKQMRKYLQEGDLISAEVQNVHSDGTLSLHTRSLKYGKLAQGILVKVFPSLIQRRKTHFHNLPCGASIILGNNGFIWISPMMNSEGGEGGGFTQNLD-DVVTKEDRQTIARLRNCILALAHCKMMLYDTSILYAYEES--QKYEVSELLHQECMTDIAFLTQHRLRVLE 295          
BLAST of S1 motif domain-containing protein vs. TrEMBL
Match: A0A182UCP1 (S1 motif domain-containing protein OS=Anopheles melas OX=34690 PE=4 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 4.121e-55
Identity = 120/307 (39.09%), Postives = 180/307 (58.63%), Query Frame = 1
Query:   16 MNINIEIKQNPKLVRPP----ELCINKIYSPGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPTRST------NFKFEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVENGYSGADLLKDECIDRIAEVTEIQMGAIQ 906
            MN N+ I+     V  P    E    ++++PGE + +Q+ ++ G+ T+          + ++I SSV G +  V+KLI VK     Y+G++GD VV RV EV + RWK++TNSR  S+L LS+V LPGGE RRR  EDEK MR++L EGDLI  EV+ +  D  LSL  R +  GKL QG+++KV  SLI  +K H H LP G ++ILG NG +W+ P  ++       F   +D  +V+ E  + + R+ NC+  L+   + L + SI YAYE S    Y  ++LL  EC+  IA +T+ ++  ++
Sbjct:    1 MNSNVSIRLACDRVNIPLISDESKSQRLFTPGEVVTSQQGFMRGHGTYM---------EDDTIKSSVAGVMVQVNKLITVKALKGRYVGEIGDVVVARVTEVQEKRWKVDTNSRLDSMLLLSSVNLPGGELRRRGVEDEKQMRKYLQEGDLISAEVQNVHSDGTLSLHTRSLKYGKLAQGILVKVFPSLIQRRKTHFHNLPCGASIILGNNGFIWISPMMNSEGGEGGGFTQNLD-DVVTKEDRQTIARLRNCILALAHCKMMLYDTSILYAYEES--QKYEVSELLHQECMTDIAFLTQHRLRVLE 295          
BLAST of S1 motif domain-containing protein vs. TrEMBL
Match: Q7QHJ5 (AGAP011211-PA OS=Anopheles gambiae OX=7165 GN=1270713 PE=4 SV=3)

HSP 1 Score: 191.045 bits (484), Expect = 4.121e-55
Identity = 120/307 (39.09%), Postives = 180/307 (58.63%), Query Frame = 1
Query:   16 MNINIEIKQNPKLVRPP----ELCINKIYSPGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPTRST------NFKFEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVENGYSGADLLKDECIDRIAEVTEIQMGAIQ 906
            MN N+ I+     V  P    E    ++++PGE + +Q+ ++ G+ T+          + ++I SSV G +  V+KLI VK     Y+G++GD VV RV EV + RWK++TNSR  S+L LS+V LPGGE RRR  EDEK MR++L EGDLI  EV+ +  D  LSL  R +  GKL QG+++KV  SLI  +K H H LP G ++ILG NG +W+ P  ++       F   +D  +V+ E  + + R+ NC+  L+   + L + SI YAYE S    Y  ++LL  EC+  IA +T+ ++  ++
Sbjct:    1 MNSNVSIRLACDRVNIPLISDESKSQRLFTPGEVVTSQQGFMRGHGTYM---------EDDTIKSSVAGVMVQVNKLITVKALKGRYVGEIGDVVVARVTEVQEKRWKVDTNSRLDSMLLLSSVNLPGGELRRRGVEDEKQMRKYLQEGDLISAEVQNVHSDGTLSLHTRSLKYGKLAQGILVKVFPSLIQRRKTHFHNLPCGASIILGNNGFIWISPMMNSEGGEGGGFTQNLD-DVVTKEDRQTIARLRNCILALAHCKMMLYDTSILYAYEES--QKYEVSELLHQECMTDIAFLTQHRLRVLE 295          
BLAST of S1 motif domain-containing protein vs. Ensembl Cavefish
Match: exosc2 (exosome component 2 [Source:NCBI gene;Acc:103045582])

HSP 1 Score: 175.252 bits (443), Expect = 1.752e-52
Identity = 115/295 (38.98%), Postives = 168/295 (56.95%), Query Frame = 1
Query:   16 MNINIEIKQNPKLVRPPELCIN----KIYSPGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPT------RSTNFKFEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVENGYSGADLLKDECIDRI 870
            M +++ +    KL+  P    N     +  PG+ I +   ++ G+ T+            E + +SV GEV  V+KLI VK   + + G+VGD VVGR+ EV + RWK+ETNSR  S+L LS+V LPGGE RRRS EDE +MR +L EGDLI  EV+ +  D  LSL  R +  GKLGQG++++V  SL+  QK H H LP G ++ILG NG +W+ PT       +  +   ++   +S    E + R+ NC+  L+   V L + S+ Y YE+S+ +     D+LK E +D I
Sbjct:    1 MAVDMRLPTARKLISLPGSLSNAEGKHLVVPGDVITSDTGFMRGHGTYM---------DDEKLTASVAGEVERVNKLICVKPLKTRFNGEVGDVVVGRITEVQQKRWKVETNSRLDSVLLLSSVNLPGGELRRRSAEDELSMRDYLQEGDLISAEVQSVFSDGALSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHNLPCGASIILGNNGFLWLYPTPGHQDEEAGGYYTSLEPVALSDR--EVISRLRNCLLALAAHKVLLYDTSVLYCYESSLSHQIK--DILKPETMDEI 282          
BLAST of S1 motif domain-containing protein vs. Ensembl Sea Lamprey
Match: exosc2 (exosome component 2 [Source:ZFIN;Acc:ZDB-GENE-050417-27])

HSP 1 Score: 174.481 bits (441), Expect = 7.598e-53
Identity = 104/250 (41.60%), Postives = 152/250 (60.80%), Query Frame = 1
Query:   85 IYSPGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPTRSTNFK----FEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVEN 822
            + +PG+ I     ++ G+ T+          + + + +SV G V  V+KLI V+   + Y G++GD VVGR+ EV + RWK++TNSR  S+L LS+V LPGGE RRRS EDE AMR +L EGDLI  EV+ +  D  LSL  R +  GKLGQG++++V  SL+  +K H H LP G ++ILG NG VW+ PT  ++ +    F  D    +    E + R+ NCV  LS + + L + S+ Y YEAS+++
Sbjct:   28 LVAPGDVITGDAGFMRGHGTY---------TEDDKLIASVAGVVERVNKLICVRPLKTRYNGEIGDVVVGRITEVQQKRWKVDTNSRLDSVLLLSSVNLPGGELRRRSAEDELAMRDYLQEGDLISAEVQAVFSDGALSLHTRSLKYGKLGQGVLVRVSPSLVKRRKTHFHALPCGASIILGNNGFVWIYPTSDSHAEESGGFYTDLEPTALSEREVIARLRNCVTGLSWQRMMLYDTSVLYCYEASMQH 268          
BLAST of S1 motif domain-containing protein vs. Ensembl Yeast
Match: RRP4 (Exosome non-catalytic core component; involved in 3'-5' RNA processing and degradation in both the nucleus and the cytoplasm; predicted to contain RNA binding domains; has similarity to human hRrp4p (EXOSC2) [Source:SGD;Acc:S000001111])

HSP 1 Score: 141.739 bits (356), Expect = 7.030e-40
Identity = 99/285 (34.74%), Postives = 144/285 (50.53%), Query Frame = 1
Query:   82 KIYSPGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWV------------------------GPTRSTN----------------FKFEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASV 816
            +I +PGE +     ++ G+ T+ L N +         YSSV G V  V++L+ V      Y  + GD VVGR+ EV   RWK++   ++ ++L L +V LPGG  RR+SE DE  MR FL EGDL+  EV+ +  D   SL  R +  GKL  G+  +VPSSLIV  K HTH LP  +T++LG NG +W+                        GPT + +                +  E D SI S+   +A+CR  N +K L+   + +++  I  AYEAS+
Sbjct:   53 QIVTPGELVTDDPIWMRGHGTYFLDNMT---------YSSVAGTVSRVNRLLSVIPLKGRYAPETGDHVVGRIAEVGNKRWKVDIGGKQHAVLMLGSVNLPGGILRRKSESDELQMRSFLKEGDLLNAEVQSLFQDGSASLHTRSLKYGKLRNGMFCQVPSSLIVRAKNHTHNLPGNITVVLGVNGYIWLRKTSQMDLARDTPSANNSSSIKSTGPTGAVSLNPSITRLEEESSWQIYSDENDPSI-SNNIRQAICRYANVIKALAFCEIGITQQRIVSAYEASM 327          
BLAST of S1 motif domain-containing protein vs. Ensembl Nematostella
Match: EDO36519 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIE5])

HSP 1 Score: 88.5817 bits (218), Expect = 6.450e-21
Identity = 72/252 (28.57%), Postives = 118/252 (46.83%), Query Frame = 1
Query:  151 LSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYM---GKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGP-----TRSTNFKFEIDQSIVS---SEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVENGYSGADLLKDECIDRIA 873
            +S ++ +  K++S+ S  V E   +     V   ++ YM   G++GD VVGR+ EV + RWK+ET S+  S+L LS+V LP                                             G   L  G ++K+P +++   K H H LP G T+I+G NG +++          T+   E DQ  +S   +   E + R+ NCV LL+ + + L ++S+ YAY+ S++  +S  +LLK E I+ I 
Sbjct:    1 MSVDARLPCKRKSVASISVSEPKHIVTPGDVITEDTGYMRYNGEIGDVVVGRITEVGQKRWKVETFSKLDSVLMLSSVNLP---------------------------------------------GGELLKHGTLVKIPPTMVKRCKTHFHNLPCGATVIIGNNGYIFLSTIITPEALGTDGMAEPDQPDISEIRAADREMLARLRNCVVLLAHESILLFDSSLMYAYDESLK--FSVKELLKPEVIEEIG 205          
BLAST of S1 motif domain-containing protein vs. Ensembl Medaka
Match: exosc2 (exosome component 2 [Source:NCBI gene;Acc:101162770])

HSP 1 Score: 179.489 bits (454), Expect = 3.917e-54
Identity = 113/271 (41.70%), Postives = 162/271 (59.78%), Query Frame = 1
Query:   94 PGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPTRSTNFK----FEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVENGYSGADLLKDECIDRIAEVTEIQM 894
            PG+ I +   ++ G+ T+           +E + +SV GEV  V KLI V+   + + G+VGD VVGR+ EV + RWK+ETNSR  S+L LS+V LPGGE RRRS EDE  MR++L EGDLI  EV+ +  D  LSL  R +  GKLGQG+++++  SLI  QK H H LP G ++ILG NG VW+ PT     +    F      VS    E + R+ NC+  L+   V L + S+ Y YE+S++  +S  D+LK E ++ I  +T+ ++
Sbjct:   29 PGDIITSDTGFMRGHGTYV---------DEEKLTASVAGEVQRVDKLICVRPLKTRFNGEVGDVVVGRITEVQQKRWKVETNSRLDSVLLLSSVNLPGGELRRRSAEDELTMREYLQEGDLISAEVQSVFSDGALSLHTRSLKYGKLGQGVLVQISPSLIKRQKSHFHNLPCGASVILGNNGFVWLYPTLGQQEEEAGGFYTSLEPVSLSDREVISRLRNCLLALAAHKVLLYDTSVLYCYESSLQ--HSVKDILKPEVMEEIVMLTQQKL 288          
BLAST of S1 motif domain-containing protein vs. Ensembl Medaka
Match: exosc2 (exosome component 2 [Source:NCBI gene;Acc:101162770])

HSP 1 Score: 147.517 bits (371), Expect = 4.450e-42
Identity = 103/271 (38.01%), Postives = 148/271 (54.61%), Query Frame = 1
Query:   94 PGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPTRSTNFK----FEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVENGYSGADLLKDECIDRIAEVTEIQM 894
            PG+ I +   ++ G+ T+           +E + +SV GEV  V KLI V+                      + RWK+ETNSR  S+L LS+V LPGGE RRRS EDE  MR++L EGDLI  EV+ +  D  LSL  R +  GKLGQG+++++  SLI  QK H H LP G ++ILG NG VW+ PT     +    F      VS    E + R+ NC+  L+   V L + S+ Y YE+S++  +S  D+LK E ++ I  +T+ ++
Sbjct:   29 PGDIITSDTGFMRGHGTYV---------DEEKLTASVAGEVQRVDKLICVQ----------------------QKRWKVETNSRLDSVLLLSSVNLPGGELRRRSAEDELTMREYLQEGDLISAEVQSVFSDGALSLHTRSLKYGKLGQGVLVQISPSLIKRQKSHFHNLPCGASVILGNNGFVWLYPTLGQQEEEAGGFYTSLEPVSLSDREVISRLRNCLLALAAHKVLLYDTSVLYCYESSLQ--HSVKDILKPEVMEEIVMLTQQKL 266          
BLAST of S1 motif domain-containing protein vs. Planmine SMEST
Match: SMESG000005153.1 (SMESG000005153.1)

HSP 1 Score: 579.711 bits (1493), Expect = 0.000e+0
Identity = 297/297 (100.00%), Postives = 297/297 (100.00%), Query Frame = 1
Query:   16 MNINIEIKQNPKLVRPPELCINKIYSPGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPTRSTNFKFEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVENGYSGADLLKDECIDRIAEVTEIQMGAIQ 906
            MNINIEIKQNPKLVRPPELCINKIYSPGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPGGESRRRSEEDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPTRSTNFKFEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVENGYSGADLLKDECIDRIAEVTEIQMGAIQ
Sbjct:    1 MNINIEIKQNPKLVRPPELCINKIYSPGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPGGESRRRSEEDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGVTLILGCNGLVWVGPTRSTNFKFEIDQSIVSSEYYEAVCRIGNCVKLLSKKGVPLSEASICYAYEASVENGYSGADLLKDECIDRIAEVTEIQMGAIQ 297          
BLAST of S1 motif domain-containing protein vs. Planmine SMEST
Match: SMESG000005153.1 (SMESG000005153.1)

HSP 1 Score: 330.102 bits (845), Expect = 1.968e-114
Identity = 175/175 (100.00%), Postives = 175/175 (100.00%), Query Frame = 1
Query:   16 MNINIEIKQNPKLVRPPELCINKIYSPGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPXXXXXXXXXXDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQ 540
            MNINIEIKQNPKLVRPPELCINKIYSPGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPGGESRRRSEEDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQ
Sbjct:    1 MNINIEIKQNPKLVRPPELCINKIYSPGESIATQETYIFGNNTFKLSNNSDIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHKNRWKIETNSRRISILTLSNVKLPGGESRRRSEEDEKAMRQFLDEGDLIVGEVREIRHDNVLSLMVRDVGQGKLGQ 175          

HSP 2 Score: 67.3958 bits (163), Expect = 4.686e-13
Identity = 30/31 (96.77%), Postives = 30/31 (96.77%), Query Frame = 3
Query:  582 EEAYSYSAIWGNSDSWMQWFSMGWTDPIYQF 674
            EEAYSYSAIWGNSDSWMQWFSMGWTD IYQF
Sbjct:  176 EEAYSYSAIWGNSDSWMQWFSMGWTDQIYQF 206          
The following BLAST results are available for this feature:
BLAST of S1 motif domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EXOSC24.150e-5340.14exosome component 2 [Source:HGNC Symbol;Acc:HGNC:1... [more]
EXOSC22.273e-4638.75exosome component 2 [Source:HGNC Symbol;Acc:HGNC:1... [more]
EXOSC28.691e-4136.33exosome component 2 [Source:HGNC Symbol;Acc:HGNC:1... [more]
EXOSC21.726e-3939.27exosome component 2 [Source:HGNC Symbol;Acc:HGNC:1... [more]
EXOSC27.410e-3733.56exosome component 2 [Source:HGNC Symbol;Acc:HGNC:1... [more]
back to top
BLAST of S1 motif domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
exos-28.476e-3537.50EXOSome (Multiexonuclease complex) component [Sou... [more]
back to top
BLAST of S1 motif domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Rrp41.672e-5339.93gene:FBgn0034879 transcript:FBtr0072111[more]
Rrp41.672e-5339.93gene:FBgn0034879 transcript:FBtr0343267[more]
back to top
BLAST of S1 motif domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
exosc21.343e-5443.73exosome component 2 [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
back to top
BLAST of S1 motif domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
exosc26.811e-5039.93exosome component 2 [Source:NCBI gene;Acc:595050][more]
exosc27.295e-4940.08exosome component 2 [Source:NCBI gene;Acc:595050][more]
exosc27.049e-4742.98exosome component 2 [Source:NCBI gene;Acc:595050][more]
back to top
BLAST of S1 motif domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Exosc26.704e-5443.35exosome component 2 [Source:MGI Symbol;Acc:MGI:238... [more]
Exosc27.742e-3736.15exosome component 2 [Source:MGI Symbol;Acc:MGI:238... [more]
back to top
BLAST of S1 motif domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8VBV3|EXOS2_MOUSE4.690e-5343.35Exosome complex component RRP4 OS=Mus musculus OX=... [more]
sp|Q13868|EXOS2_HUMAN1.993e-5240.14Exosome complex component RRP4 OS=Homo sapiens OX=... [more]
sp|Q2KID0|EXOS2_BOVIN2.577e-5243.35Exosome complex component RRP4 OS=Bos taurus OX=99... [more]
sp|Q09704|RRP4_SCHPO1.951e-4035.14Exosome complex component rrp4 OS=Schizosaccharomy... [more]
sp|P38792|RRP4_YEAST4.881e-3834.74Exosome complex component RRP4 OS=Saccharomyces ce... [more]
back to top
BLAST of S1 motif domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A182QT874.645e-5639.09S1 motif domain-containing protein OS=Anopheles fa... [more]
A0A182PI851.437e-5539.09S1 motif domain-containing protein OS=Anopheles ep... [more]
A0A182HFY74.121e-5539.09S1 motif domain-containing protein OS=Anopheles ar... [more]
A0A182UCP14.121e-5539.09S1 motif domain-containing protein OS=Anopheles me... [more]
Q7QHJ54.121e-5539.09AGAP011211-PA OS=Anopheles gambiae OX=7165 GN=1270... [more]
back to top
BLAST of S1 motif domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
exosc21.752e-5238.98exosome component 2 [Source:NCBI gene;Acc:10304558... [more]
back to top
BLAST of S1 motif domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
exosc27.598e-5341.60exosome component 2 [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
back to top
BLAST of S1 motif domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RRP47.030e-4034.74Exosome non-catalytic core component; involved in ... [more]
back to top
BLAST of S1 motif domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO365196.450e-2128.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of S1 motif domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
exosc23.917e-5441.70exosome component 2 [Source:NCBI gene;Acc:10116277... [more]
exosc24.450e-4238.01exosome component 2 [Source:NCBI gene;Acc:10116277... [more]
back to top
BLAST of S1 motif domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000005153.10.000e+0100.00SMESG000005153.1[more]
SMESG000005153.11.968e-114100.00SMESG000005153.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032283 ID=SMED30032283|Name=S1 motif domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=976bp
ATTTGAAAATATTAAATGAATATTAACATTGAAATTAAACAGAATCCTAA
GCTTGTTAGGCCTCCTGAATTATGTATTAATAAAATTTATTCTCCTGGTG
AAAGTATTGCCACGCAGGAAACATACATTTTTGGAAATAACACATTTAAA
CTTTCAAATAATAGTGATATTGAAAATAAAAAGGAATCTATATATTCATC
TGTTGTTGGAGAGGTTGGAATTGTGAGTAAATTGATATATGTAAAAAATC
CAAACTCCACTTATATGGGCAAAGTAGGAGATACTGTTGTTGGAAGAGTT
ATTGAGGTTCATAAAAATCGTTGGAAAATAGAAACAAATTCTAGAAGAAT
CAGTATTTTAACTTTGTCAAATGTAAAGTTGCCTGGTGGAGAATCTCGAC
GTCGTTCTGAAGAAGATGAAAAAGCTATGAGACAATTTCTTGATGAAGGT
GACTTGATCGTTGGGGAAGTTCGTGAAATTAGACATGACAATGTTTTATC
ATTAATGGTAAGAGATGTTGGTCAAGGTAAACTTGGACAAGGTTTGGTTA
TTAAAGTACCCTCGAGTTTGATTGTACCGCAGAAGAAGCATACTCATATT
CTGCCATTTGGGGTAACTCTGATTCTTGGATGCAATGGTTTAGTATGGGT
TGGACCGACCCGATCTACCAATTTTAAATTCGAAATCGATCAAAGTATAG
TGTCATCCGAATATTATGAGGCCGTCTGTCGAATTGGAAATTGTGTGAAA
TTATTGTCAAAAAAAGGAGTACCGCTATCAGAAGCGAGCATTTGTTACGC
ATATGAAGCATCGGTAGAAAATGGATATAGTGGTGCCGACTTGTTGAAAG
ACGAGTGTATAGATCGAATAGCAGAAGTCACTGAGATACAGATGGGAGCT
ATTCAATAAATATTGTGTTTTTGACTTAATTTTTTGTTTAAAAAATATAT
GCTTGAATTTGTGTTCAAAAATTTCC
back to top

protein sequence of SMED30032283-orf-1

>SMED30032283-orf-1 ID=SMED30032283-orf-1|Name=SMED30032283-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=298bp
MNINIEIKQNPKLVRPPELCINKIYSPGESIATQETYIFGNNTFKLSNNS
DIENKKESIYSSVVGEVGIVSKLIYVKNPNSTYMGKVGDTVVGRVIEVHK
NRWKIETNSRRISILTLSNVKLPGGESRRRSEEDEKAMRQFLDEGDLIVG
EVREIRHDNVLSLMVRDVGQGKLGQGLVIKVPSSLIVPQKKHTHILPFGV
TLILGCNGLVWVGPTRSTNFKFEIDQSIVSSEYYEAVCRIGNCVKLLSKK
GVPLSEASICYAYEASVENGYSGADLLKDECIDRIAEVTEIQMGAIQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003723RNA binding
GO:00001753'-5'-exoribonuclease activity
GO:0005515protein binding
GO:00083127S RNA binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR026699Exosome_RNA_bind1/RRP40/RRP4
IPR036612KH_dom_type_1_sf
IPR004088KH_dom_type_1
IPR012340NA-bd_OB-fold
Vocabulary: cellular component
TermDefinition
GO:0000176nuclear exosome (RNase complex)
GO:0000177cytoplasmic exosome (RNase complex)
GO:0000178exosome (RNase complex)
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0005829cytosol
Vocabulary: biological process
TermDefinition
GO:0000467exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364rRNA processing
GO:0030307positive regulation of cell growth
GO:0034427nuclear-transcribed mRNA catabolic process, exonucleolytic, 3'-5'
GO:0034475U4 snRNA 3'-end processing
GO:0043488regulation of mRNA stability
GO:0043928exonucleolytic nuclear-transcribed mRNA catabolic process involved in deadenylation-dependent decay
GO:0071034CUT catabolic process
GO:0071035nuclear polyadenylation-dependent rRNA catabolic process
GO:0071038nuclear polyadenylation-dependent tRNA catabolic process
GO:0071049nuclear retention of pre-mRNA with aberrant 3'-ends at the site of transcription
GO:0071051polyadenylation-dependent snoRNA 3'-end processing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:2.40.50.100coord: 23..82
e-value: 6.3E-10
score: 40.5
NoneNo IPR availableGENE3DG3DSA:2.40.50.140coord: 83..174
e-value: 5.9E-18
score: 66.7
NoneNo IPR availablePANTHERPTHR21321:SF4EXOSOME COMPLEX COMPONENT RRP4coord: 23..289
NoneNo IPR availableCDDcd05789S1_Rrp4coord: 82..173
e-value: 2.77518E-25
score: 94.5385
IPR004088K Homology domain, type 1PFAMPF15985KH_6coord: 176..215
e-value: 8.5E-7
score: 29.2
IPR026699Exosome complex RNA-binding protein 1/RRP40/RRP4PANTHERPTHR21321PNAS-3 RELATEDcoord: 23..289
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 81..173
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 175..288