Histone acetyltransferase

NameHistone acetyltransferase
Smed IDSMED30032280
Length (bp)5162
Neoblast Clusters

Zeng et. al., 2018

▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population





Single cell RNA-seq of pluripotent neoblasts and its early progenies

We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)

Explore this single cell expression dataset with our NB Cluster Shiny App


Neoblast Population


t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.

Expression of Histone acetyltransferase (SMED30032280) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone acetyltransferase (SMED30032280) in cells (dots) of each of the 12 neoblast clusters.


back to top


Sub-lethal Irradiated Surviving X1 and X2 Cell Population


t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone acetyltransferase (SMED30032280) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone acetyltransferase (SMED30032280) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.


back to top


Embryonic Expression

Davies et. al., 2017

Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods


back to top
Anatomical Expression

PAGE et. al., 2020


has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE

PAGE Curations: 7

Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30032280SMESG000062900.1 SmedASXL_010714SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30032280SMESG000062900.1 dd_Smed_v4_5797_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30032280SMESG000062900.1 dd_Smed_v4_5797_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30032280SMESG000062900.1 SMESG000017088.1 dd_Smed_v6_491_1_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30032280SMESG000062900.1 SMESG000017088.1 dd_Smed_v4_491_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30032280SMESG000062900.1 SMESG000017088.1 dd_Smed_v4_491_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30032280SMESG000062900.1 SMESG000017088.1 dd_Smed_v4_491_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
BLAST of Histone acetyltransferase vs. Ensembl Human
Match: KAT6B (lysine acetyltransferase 6B [Source:HGNC Symbol;Acc:HGNC:17582])

HSP 1 Score: 311.227 bits (796), Expect = 5.866e-90
Identity = 155/300 (51.67%), Postives = 200/300 (66.67%), Query Frame = 3
            R+P  I+ G++ I TWYS+PYP EYARL  LY+CE+CLK +KS ++ + H +KC ++ PP NEIYR  DLSVFEVDG +SK+YCQ LCLLAKLFLDHKTLYYDVEPFLFYV   +  K  H++GYFSKEK    KYN+SCIM++P +Q+  +GRFLIDFSYLLSR+EGQ GSPEKPLS LGR+SY +YWKS IL Y+ +  +                   ++I  +S  TG+ PHD+A+T+Q L     +D  D   +    EKL     E  K  SR  +   +D + LRW P++  N

HSP 2 Score: 126.331 bits (316), Expect = 1.253e-28
Identity = 76/233 (32.62%), Postives = 121/233 (51.93%), Query Frame = 3
            G F ++  GS   C + + +  N+   + I  L++ N  + +  +  LRS     S T   A+     +G + R     + LK   +  ++  S   K   Q  +      A P    PV +   +  ++    PIPIC+FCLG +  N R K+ E +++C DCG+  HP+CL++   L   V+ +RWQC++CK CS C +  R  D+ML CD+CD+GFH+ CCDPP+  +PK
BLAST of Histone acetyltransferase vs. Ensembl Human
Match: KAT6B (lysine acetyltransferase 6B [Source:HGNC Symbol;Acc:HGNC:17582])

HSP 1 Score: 311.227 bits (796), Expect = 5.866e-90
Identity = 155/300 (51.67%), Postives = 200/300 (66.67%), Query Frame = 3
            R+P  I+ G++ I TWYS+PYP EYARL  LY+CE+CLK +KS ++ + H +KC ++ PP NEIYR  DLSVFEVDG +SK+YCQ LCLLAKLFLDHKTLYYDVEPFLFYV   +  K  H++GYFSKEK    KYN+SCIM++P +Q+  +GRFLIDFSYLLSR+EGQ GSPEKPLS LGR+SY +YWKS IL Y+ +  +                   ++I  +S  TG+ PHD+A+T+Q L     +D  D   +    EKL     E  K  SR  +   +D + LRW P++  N

HSP 2 Score: 126.331 bits (316), Expect = 1.253e-28
Identity = 76/233 (32.62%), Postives = 121/233 (51.93%), Query Frame = 3
            G F ++  GS   C + + +  N+   + I  L++ N  + +  +  LRS     S T   A+     +G + R     + LK   +  ++  S   K   Q  +      A P    PV +   +  ++    PIPIC+FCLG +  N R K+ E +++C DCG+  HP+CL++   L   V+ +RWQC++CK CS C +  R  D+ML CD+CD+GFH+ CCDPP+  +PK
BLAST of Histone acetyltransferase vs. Ensembl Human
Match: KAT6B (lysine acetyltransferase 6B [Source:HGNC Symbol;Acc:HGNC:17582])

HSP 1 Score: 311.612 bits (797), Expect = 2.337e-89
Identity = 155/300 (51.67%), Postives = 200/300 (66.67%), Query Frame = 3
            R+P  I+ G++ I TWYS+PYP EYARL  LY+CE+CLK +KS ++ + H +KC ++ PP NEIYR  DLSVFEVDG +SK+YCQ LCLLAKLFLDHKTLYYDVEPFLFYV   +  K  H++GYFSKEK    KYN+SCIM++P +Q+  +GRFLIDFSYLLSR+EGQ GSPEKPLS LGR+SY +YWKS IL Y+ +  +                   ++I  +S  TG+ PHD+A+T+Q L     +D  D   +    EKL     E  K  SR  +   +D + LRW P++  N

HSP 2 Score: 146.747 bits (369), Expect = 6.174e-35
Identity = 85/252 (33.73%), Postives = 135/252 (53.57%), Query Frame = 3
            ++ G F ++  GS   C + + +  N+   + I  L++ N  + +  +  LRS     S T   A+     +G + R     + LK   +  ++  S   K   Q  +      A P    PV +   +  ++    PIPIC+FCLG +  N R K+ E +++C DCG+  HP+CL++   L   V+ +RWQC++CK CS C +  R  D+ML CD+CD+GFH+ CCDPP+  +PKG W+C++CRP   GRK
BLAST of Histone acetyltransferase vs. Ensembl Human
Match: KAT6B (lysine acetyltransferase 6B [Source:HGNC Symbol;Acc:HGNC:17582])

HSP 1 Score: 311.612 bits (797), Expect = 2.337e-89
Identity = 155/300 (51.67%), Postives = 200/300 (66.67%), Query Frame = 3
            R+P  I+ G++ I TWYS+PYP EYARL  LY+CE+CLK +KS ++ + H +KC ++ PP NEIYR  DLSVFEVDG +SK+YCQ LCLLAKLFLDHKTLYYDVEPFLFYV   +  K  H++GYFSKEK    KYN+SCIM++P +Q+  +GRFLIDFSYLLSR+EGQ GSPEKPLS LGR+SY +YWKS IL Y+ +  +                   ++I  +S  TG+ PHD+A+T+Q L     +D  D   +    EKL     E  K  SR  +   +D + LRW P++  N

HSP 2 Score: 146.747 bits (369), Expect = 6.174e-35
Identity = 85/252 (33.73%), Postives = 135/252 (53.57%), Query Frame = 3
            ++ G F ++  GS   C + + +  N+   + I  L++ N  + +  +  LRS     S T   A+     +G + R     + LK   +  ++  S   K   Q  +      A P    PV +   +  ++    PIPIC+FCLG +  N R K+ E +++C DCG+  HP+CL++   L   V+ +RWQC++CK CS C +  R  D+ML CD+CD+GFH+ CCDPP+  +PKG W+C++CRP   GRK
BLAST of Histone acetyltransferase vs. Ensembl Human
Match: KAT6B (lysine acetyltransferase 6B [Source:HGNC Symbol;Acc:HGNC:17582])

HSP 1 Score: 311.612 bits (797), Expect = 2.467e-89
Identity = 155/300 (51.67%), Postives = 200/300 (66.67%), Query Frame = 3
            R+P  I+ G++ I TWYS+PYP EYARL  LY+CE+CLK +KS ++ + H +KC ++ PP NEIYR  DLSVFEVDG +SK+YCQ LCLLAKLFLDHKTLYYDVEPFLFYV   +  K  H++GYFSKEK    KYN+SCIM++P +Q+  +GRFLIDFSYLLSR+EGQ GSPEKPLS LGR+SY +YWKS IL Y+ +  +                   ++I  +S  TG+ PHD+A+T+Q L     +D  D   +    EKL     E  K  SR  +   +D + LRW P++  N

HSP 2 Score: 146.747 bits (369), Expect = 5.891e-35
Identity = 59/115 (51.30%), Postives = 83/115 (72.17%), Query Frame = 3
            PIPIC+FCLG +  N R K+ E +++C DCG+  HP+CL++   L   V+ +RWQC++CK CS C +  R  D+ML CD+CD+GFH+ CCDPP+  +PKG W+C++CRP   GRK
BLAST of Histone acetyltransferase vs. Ensembl Celegans
Match: lsy-12 (Histone acetyltransferase [Source:UniProtKB/TrEMBL;Acc:L8E6K3])

HSP 1 Score: 249.21 bits (635), Expect = 1.254e-70
Identity = 125/301 (41.53%), Postives = 176/301 (58.47%), Query Frame = 3
            R P RI  G  ++ TWY +P+P+E+  +  L+ICE+C    +S ++   H +KC    PPG EIYR GD+SVFEVDG + K YCQ LCL++++FL+ KT++YD EPF FY+  I+ +   H  GYFSKEK      NLSCIM LP YQ+   GRFLID SY LSRKE   G PE+PLS LGR +Y  YW++ I   +    D  ++F           G  ++I  ++ +TG++ HD+   +  L  +K VD D  +   +++  DW+ +     +SEA K        +  D ECL WVP
BLAST of Histone acetyltransferase vs. Ensembl Celegans
Match: lsy-12 (Histone acetyltransferase [Source:UniProtKB/TrEMBL;Acc:L8E6K3])

HSP 1 Score: 249.21 bits (635), Expect = 1.254e-70
Identity = 125/301 (41.53%), Postives = 176/301 (58.47%), Query Frame = 3
            R P RI  G  ++ TWY +P+P+E+  +  L+ICE+C    +S ++   H +KC    PPG EIYR GD+SVFEVDG + K YCQ LCL++++FL+ KT++YD EPF FY+  I+ +   H  GYFSKEK      NLSCIM LP YQ+   GRFLID SY LSRKE   G PE+PLS LGR +Y  YW++ I   +    D  ++F           G  ++I  ++ +TG++ HD+   +  L  +K VD D  +   +++  DW+ +     +SEA K        +  D ECL WVP
BLAST of Histone acetyltransferase vs. Ensembl Celegans
Match: mys-1 (Histone acetyltransferase Tip60 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q9TYU5])

HSP 1 Score: 245.358 bits (625), Expect = 1.505e-70
Identity = 121/240 (50.42%), Postives = 154/240 (64.17%), Query Frame = 3
            I++GR  I  WY APYP +   L+ +YICE+CLK +KS      HM+KC    PPGN+IY +  LS FE+DG  +K Y Q LCLLAKLFLDHKTLYYD +PFLFYV      K  HI+GYFSKEK S  +YN++CI+VLPP+QK  YG  LI+FSY LS+ E + GSPEKPLS LG +SY SYW   I+           + +A ++ +    G  +T+  +S  T I   DV ST+Q L
BLAST of Histone acetyltransferase vs. Ensembl Celegans
Match: lsy-12 (Histone acetyltransferase [Source:UniProtKB/TrEMBL;Acc:L8E6K3])

HSP 1 Score: 240.35 bits (612), Expect = 3.275e-68
Identity = 122/297 (41.08%), Postives = 173/297 (58.25%), Query Frame = 3
            R P RI  G  ++ TWY +P+P+E+  +  L+ICE+C    +S ++   H +KC    PPG EIYR GD+SVFEVDG + K YCQ LCL++++FL+ KT++YD EPF FY+  I+ +   H  GYFSKEK      NLSCIM LP YQ+   GRFLID SY LSRKE   G PE+PLS LGR +Y  YW++ I   +    D  ++F           G  ++I  ++ +TG++ HD+   +  L  +K VD D  +   +++  DW+ +     +SEA K        +  D ECL
BLAST of Histone acetyltransferase vs. Ensembl Celegans
Match: lsy-12 (Histone acetyltransferase [Source:UniProtKB/TrEMBL;Acc:L8E6K3])

HSP 1 Score: 240.35 bits (612), Expect = 3.275e-68
Identity = 122/297 (41.08%), Postives = 173/297 (58.25%), Query Frame = 3
            R P RI  G  ++ TWY +P+P+E+  +  L+ICE+C    +S ++   H +KC    PPG EIYR GD+SVFEVDG + K YCQ LCL++++FL+ KT++YD EPF FY+  I+ +   H  GYFSKEK      NLSCIM LP YQ+   GRFLID SY LSRKE   G PE+PLS LGR +Y  YW++ I   +    D  ++F           G  ++I  ++ +TG++ HD+   +  L  +K VD D  +   +++  DW+ +     +SEA K        +  D ECL
BLAST of Histone acetyltransferase vs. Ensembl Fly
Match: enok (gene:FBgn0034975 transcript:FBtr0343339)

HSP 1 Score: 322.013 bits (824), Expect = 2.236e-88
Identity = 172/371 (46.36%), Postives = 235/371 (63.34%), Query Frame = 3
            + S  N + P  IQIG+  I+TWYS+P+P EYARL  L++CE+CLK  KS  V   H  KC +  PPG EI+R G++SVFEVDG V+K+YCQ LCLLAK FLDHKTLYYDVEPFLFY+   +     H++GYFSKEK  T KYN+SCI+ +P YQ+  YGRFLIDFSYLLSR+EGQ G+PEKPLS LGR+SY SYWKS +L Y                +YK      +T   ++ +TG++  D+A   +LL+    +K D D   +I+++ +W+K+ +   K A+   + I I+ +CLRW PL++ + K  N+++  S  + +S Q +    F  I+E DKI  K+ V       T+ K N  S E+S K
BLAST of Histone acetyltransferase vs. Ensembl Fly
Match: enok (gene:FBgn0034975 transcript:FBtr0072250)

HSP 1 Score: 322.013 bits (824), Expect = 2.236e-88
Identity = 172/371 (46.36%), Postives = 235/371 (63.34%), Query Frame = 3
            + S  N + P  IQIG+  I+TWYS+P+P EYARL  L++CE+CLK  KS  V   H  KC +  PPG EI+R G++SVFEVDG V+K+YCQ LCLLAK FLDHKTLYYDVEPFLFY+   +     H++GYFSKEK  T KYN+SCI+ +P YQ+  YGRFLIDFSYLLSR+EGQ G+PEKPLS LGR+SY SYWKS +L Y                +YK      +T   ++ +TG++  D+A   +LL+    +K D D   +I+++ +W+K+ +   K A+   + I I+ +CLRW PL++ + K  N+++  S  + +S Q +    F  I+E DKI  K+ V       T+ K N  S E+S K
BLAST of Histone acetyltransferase vs. Ensembl Fly
Match: chm (gene:FBgn0028387 transcript:FBtr0079443)

HSP 1 Score: 272.707 bits (696), Expect = 2.176e-76
Identity = 140/296 (47.30%), Postives = 176/296 (59.46%), Query Frame = 3
            I +G++ +  WY +PYP + ARL  +YICE+CL+  KS      H +KC +  PPG+EIYR G L V++VDG   K YCQ LCLLAK FLDHKTLYYDVEPFLFY+  ++     HI+GYFSK      EK S   YN+SCI+ LPPYQ+  YGR LIDFSYLL+R EG+ GSPEKPLS LG ISY SYWK  +L Y+ N+                  G  + I  VS ET I  +D+ ST+Q L     +       I    + +  E E+   R   +  ID+ CLRW P IN
BLAST of Histone acetyltransferase vs. Ensembl Fly
Match: chm (gene:FBgn0028387 transcript:FBtr0332523)

HSP 1 Score: 272.707 bits (696), Expect = 2.176e-76
Identity = 140/296 (47.30%), Postives = 176/296 (59.46%), Query Frame = 3
            I +G++ +  WY +PYP + ARL  +YICE+CL+  KS      H +KC +  PPG+EIYR G L V++VDG   K YCQ LCLLAK FLDHKTLYYDVEPFLFY+  ++     HI+GYFSK      EK S   YN+SCI+ LPPYQ+  YGR LIDFSYLL+R EG+ GSPEKPLS LG ISY SYWK  +L Y+ N+                  G  + I  VS ET I  +D+ ST+Q L     +       I    + +  E E+   R   +  ID+ CLRW P IN
BLAST of Histone acetyltransferase vs. Ensembl Fly
Match: Tip60 (gene:FBgn0026080 transcript:FBtr0070668)

HSP 1 Score: 252.292 bits (643), Expect = 7.379e-72
Identity = 134/287 (46.69%), Postives = 175/287 (60.98%), Query Frame = 3
            I++GRH I  WY +PYP E  ++  +YICE+CLK  KS      H+ KC    PPGNEIYR   +S FE+DG  +K+Y Q LCLLAKLFLDHKTLYYD +PFLFYV     ++  HI+GYFSKEK ST  YN++CI+ +PPYQ+  YG+ LI+FSY LS+ EG+ GSPEKPLS LG +SY SYW   IL   ++++  T          KP+    +TI+ +   T I   DV ST+Q L    +L N  +        ++  E  + A    K I ID +CL W P
BLAST of Histone acetyltransferase vs. Ensembl Zebrafish
Match: kat6b (K(lysine) acetyltransferase 6B [Source:ZFIN;Acc:ZDB-GENE-000607-52])

HSP 1 Score: 318.546 bits (815), Expect = 2.647e-88
Identity = 158/318 (49.69%), Postives = 205/318 (64.47%), Query Frame = 3
            +L +  HV E  +  N  D     + PP I+ G++ I TWYS+PYP EY RL  LY+CE+CLK +KS D+   H +KC ++ PP NEIYR  +LSVFEVDG +SK++CQ LCLLAKLFLDHKTLYYDVEPFLFYV   +  K  H++GYFSKEK    KYN+SCIM++P +Q+  +GRFLIDFSYLLSR EGQ GSPEKPLS LGR+SY +YWKS IL Y+ N  D +                 V+I  +S  TG+ PHD+A+T+Q L+  +D  +   + IQ    +L  E        P+   +D +CL W P +
BLAST of Histone acetyltransferase vs. Ensembl Zebrafish
Match: kat6a (K(lysine) acetyltransferase 6A [Source:ZFIN;Acc:ZDB-GENE-021022-3])

HSP 1 Score: 313.153 bits (801), Expect = 1.565e-85
Identity = 151/294 (51.36%), Postives = 195/294 (66.33%), Query Frame = 3
            R P  I+ G++ I TWYS+PYP EY+RL  LY+CE+CL+ +KS  +   HM+KC ++ PP NEIYR  D+SVFEVDG VS +YCQ LCLLAKLFLDHKTLYYDVEPFLFYV   + NK  H++GYFSKEK    KYN+SCIM+LP YQ+  YGRFLIDFSYLLS++EGQ GSPEKPLS LGR+SY +YW+S +L       +   +   RQ          ++I ++S  TGI P D+ +T+  L+    L+      I    EKL +         P+ + +D +CLRW P+I

HSP 2 Score: 149.058 bits (375), Expect = 3.299e-35
Identity = 60/121 (49.59%), Postives = 84/121 (69.42%), Query Frame = 3
            +R +  PIPIC+FCLG +  N R K+ E +I+C DCG   HP+CL++   L  +V+ + WQC++CK CS C    +  D+ML CD+CD+GFH+ CCDPP+  +PKG W+C+ICRP   GRK
BLAST of Histone acetyltransferase vs. Ensembl Zebrafish
Match: kat7a (K(lysine) acetyltransferase 7a [Source:ZFIN;Acc:ZDB-GENE-060929-168])

HSP 1 Score: 279.641 bits (714), Expect = 1.576e-82
Identity = 144/294 (48.98%), Postives = 185/294 (62.93%), Query Frame = 3
            I  GR+ +DTWY +PYP EYARL  LY+CE+CLK +KS  +   HM KC +  PPG+EIYR G +SVFEVDG  +K+YCQ LCLLAKLFLDHKTLYYDVEPFLFYV   + N   H++GYFSKEK S   YN+SCI+ +P Y +  YG+ LIDFSYLLS+ E + GSPE+PLS LG ISY SYWK  +L Y+ N                  +G  ++I  +S ET ++P D+ ST+Q L        K + L   D I    DW+    EA++ +++      ID   L+W P
BLAST of Histone acetyltransferase vs. Ensembl Zebrafish
Match: kat7a (K(lysine) acetyltransferase 7a [Source:ZFIN;Acc:ZDB-GENE-060929-168])

HSP 1 Score: 283.108 bits (723), Expect = 1.184e-81
Identity = 144/294 (48.98%), Postives = 185/294 (62.93%), Query Frame = 3
            I  GR+ +DTWY +PYP EYARL  LY+CE+CLK +KS  +   HM KC +  PPG+EIYR G +SVFEVDG  +K+YCQ LCLLAKLFLDHKTLYYDVEPFLFYV   + N   H++GYFSKEK S   YN+SCI+ +P Y +  YG+ LIDFSYLLS+ E + GSPE+PLS LG ISY SYWK  +L Y+ N                  +G  ++I  +S ET ++P D+ ST+Q L        K + L   D I    DW+    EA++ +++      ID   L+W P
BLAST of Histone acetyltransferase vs. Ensembl Zebrafish
Match: kat7b (K(lysine) acetyltransferase 7b [Source:ZFIN;Acc:ZDB-GENE-030131-1901])

HSP 1 Score: 280.411 bits (716), Expect = 3.476e-81
Identity = 143/294 (48.64%), Postives = 182/294 (61.90%), Query Frame = 3
            I  GR+ ++TWY +PYP EYARL  LY+CE+CLK +KS  +   HM KC +  PPG+E+YR G  SVFEVDG  +K+YCQ LCLLAKLFLDHKTLYYDVEPFLFYV   + N   H++GYFSKEK S   YN+SCI+ +P Y +  YG+ LIDFSYLLS+ E + GSPE+PLS LG ISY SYWK  +L Y+ N                  KG  ++I  +S ET ++P D+ ST+Q L        K + L   D I    DW+    E ++  S+      ID   L+W P
BLAST of Histone acetyltransferase vs. Ensembl Xenopus
Match: kat7 (lysine acetyltransferase 7 [Source:NCBI gene;Acc:548673])

HSP 1 Score: 286.96 bits (733), Expect = 1.947e-83
Identity = 146/294 (49.66%), Postives = 181/294 (61.56%), Query Frame = 3
            I  GR+ +DTWY +PYP EYARL  LY+CE+CLK +KS  +   HM KC +  PPG+EIYR G +SVFEVDG  +K+YCQ LCLLAKLFLDHKTLYYDVEPFLFYV     N   H+IGYFSKEK S   YN+SCI+ +P Y +  YG+ LIDFSYLLS+ E + GSPE+PLS LG ISY SYWK  +L Y+ N                  +G  ++I  +S ET ++P D+ ST+Q L        K + L   D I    +W      A K A R      +D  CL+W P
BLAST of Histone acetyltransferase vs. Ensembl Xenopus
Match: kat7 (lysine acetyltransferase 7 [Source:NCBI gene;Acc:548673])

HSP 1 Score: 285.804 bits (730), Expect = 2.933e-83
Identity = 146/294 (49.66%), Postives = 181/294 (61.56%), Query Frame = 3
            I  GR+ +DTWY +PYP EYARL  LY+CE+CLK +KS  +   HM KC +  PPG+EIYR G +SVFEVDG  +K+YCQ LCLLAKLFLDHKTLYYDVEPFLFYV     N   H+IGYFSKEK S   YN+SCI+ +P Y +  YG+ LIDFSYLLS+ E + GSPE+PLS LG ISY SYWK  +L Y+ N                  +G  ++I  +S ET ++P D+ ST+Q L        K + L   D I    +W      A K A R      +D  CL+W P
BLAST of Histone acetyltransferase vs. Ensembl Xenopus
Match: kat7 (lysine acetyltransferase 7 [Source:NCBI gene;Acc:548673])

HSP 1 Score: 287.73 bits (735), Expect = 5.825e-83
Identity = 146/294 (49.66%), Postives = 181/294 (61.56%), Query Frame = 3
            I  GR+ +DTWY +PYP EYARL  LY+CE+CLK +KS  +   HM KC +  PPG+EIYR G +SVFEVDG  +K+YCQ LCLLAKLFLDHKTLYYDVEPFLFYV     N   H+IGYFSKEK S   YN+SCI+ +P Y +  YG+ LIDFSYLLS+ E + GSPE+PLS LG ISY SYWK  +L Y+ N                  +G  ++I  +S ET ++P D+ ST+Q L        K + L   D I    +W      A K A R      +D  CL+W P
BLAST of Histone acetyltransferase vs. Ensembl Xenopus
Match: kat7 (lysine acetyltransferase 7 [Source:NCBI gene;Acc:548673])

HSP 1 Score: 287.345 bits (734), Expect = 6.436e-83
Identity = 146/294 (49.66%), Postives = 181/294 (61.56%), Query Frame = 3
            I  GR+ +DTWY +PYP EYARL  LY+CE+CLK +KS  +   HM KC +  PPG+EIYR G +SVFEVDG  +K+YCQ LCLLAKLFLDHKTLYYDVEPFLFYV     N   H+IGYFSKEK S   YN+SCI+ +P Y +  YG+ LIDFSYLLS+ E + GSPE+PLS LG ISY SYWK  +L Y+ N                  +G  ++I  +S ET ++P D+ ST+Q L        K + L   D I    +W      A K A R      +D  CL+W P
BLAST of Histone acetyltransferase vs. Ensembl Xenopus
Match: kat7 (lysine acetyltransferase 7 [Source:NCBI gene;Acc:548673])

HSP 1 Score: 287.345 bits (734), Expect = 6.858e-83
Identity = 146/294 (49.66%), Postives = 181/294 (61.56%), Query Frame = 3
            I  GR+ +DTWY +PYP EYARL  LY+CE+CLK +KS  +   HM KC +  PPG+EIYR G +SVFEVDG  +K+YCQ LCLLAKLFLDHKTLYYDVEPFLFYV     N   H+IGYFSKEK S   YN+SCI+ +P Y +  YG+ LIDFSYLLS+ E + GSPE+PLS LG ISY SYWK  +L Y+ N                  +G  ++I  +S ET ++P D+ ST+Q L        K + L   D I    +W      A K A R      +D  CL+W P
BLAST of Histone acetyltransferase vs. Ensembl Mouse
Match: Kat6b (K(lysine) acetyltransferase 6B [Source:MGI Symbol;Acc:MGI:1858746])

HSP 1 Score: 317.39 bits (812), Expect = 4.914e-87
Identity = 157/300 (52.33%), Postives = 201/300 (67.00%), Query Frame = 3

HSP 2 Score: 150.214 bits (378), Expect = 1.162e-35
Identity = 58/115 (50.43%), Postives = 83/115 (72.17%), Query Frame = 3
            PIPIC+FCLG +  N R K+ E +++C DCG+  HP+CL++   L   V+ +RWQC++CK CS C +  +  D+ML CD+CD+GFH+ CCDPP+  +PKG W+C++CRP   GRK
BLAST of Histone acetyltransferase vs. Ensembl Mouse
Match: Kat6b (K(lysine) acetyltransferase 6B [Source:MGI Symbol;Acc:MGI:1858746])

HSP 1 Score: 317.39 bits (812), Expect = 4.914e-87
Identity = 157/300 (52.33%), Postives = 201/300 (67.00%), Query Frame = 3

HSP 2 Score: 150.214 bits (378), Expect = 1.162e-35
Identity = 58/115 (50.43%), Postives = 83/115 (72.17%), Query Frame = 3
            PIPIC+FCLG +  N R K+ E +++C DCG+  HP+CL++   L   V+ +RWQC++CK CS C +  +  D+ML CD+CD+GFH+ CCDPP+  +PKG W+C++CRP   GRK
BLAST of Histone acetyltransferase vs. Ensembl Mouse
Match: Kat6b (K(lysine) acetyltransferase 6B [Source:MGI Symbol;Acc:MGI:1858746])

HSP 1 Score: 317.39 bits (812), Expect = 6.763e-87
Identity = 156/300 (52.00%), Postives = 199/300 (66.33%), Query Frame = 3
            R+P  I+ G++ I TWYS+PYP EYARL  LY+CE+CLK +KS ++ + H +KC ++ PP NEIYR  DLSVFEVDG +SK+YCQ LCLLAKLFLDHKTLYYDVEPFLFYV   +  K  H++GYFSKEK    KYN+SCIM++P +Q+  +GRFLIDFSYLLSR+EGQ GSPEKPLS LGR+SY +YWKS IL Y+    +                   ++I  +S  TG+ PHD+A+T+Q L     +D  D   +    EKL     E  K  SR  +   +D E LRW P++  N

HSP 2 Score: 150.599 bits (379), Expect = 1.049e-35
Identity = 58/115 (50.43%), Postives = 83/115 (72.17%), Query Frame = 3
            PIPIC+FCLG +  N R K+ E +++C DCG+  HP+CL++   L   V+ +RWQC++CK CS C +  +  D+ML CD+CD+GFH+ CCDPP+  +PKG W+C++CRP   GRK
BLAST of Histone acetyltransferase vs. Ensembl Mouse
Match: Kat6b (K(lysine) acetyltransferase 6B [Source:MGI Symbol;Acc:MGI:1858746])

HSP 1 Score: 316.62 bits (810), Expect = 7.146e-87
Identity = 157/300 (52.33%), Postives = 201/300 (67.00%), Query Frame = 3

HSP 2 Score: 149.828 bits (377), Expect = 1.697e-35
Identity = 58/115 (50.43%), Postives = 83/115 (72.17%), Query Frame = 3
            PIPIC+FCLG +  N R K+ E +++C DCG+  HP+CL++   L   V+ +RWQC++CK CS C +  +  D+ML CD+CD+GFH+ CCDPP+  +PKG W+C++CRP   GRK
BLAST of Histone acetyltransferase vs. Ensembl Mouse
Match: Kat6b (K(lysine) acetyltransferase 6B [Source:MGI Symbol;Acc:MGI:1858746])

HSP 1 Score: 316.62 bits (810), Expect = 7.146e-87
Identity = 157/300 (52.33%), Postives = 201/300 (67.00%), Query Frame = 3

HSP 2 Score: 149.828 bits (377), Expect = 1.697e-35
Identity = 58/115 (50.43%), Postives = 83/115 (72.17%), Query Frame = 3
            PIPIC+FCLG +  N R K+ E +++C DCG+  HP+CL++   L   V+ +RWQC++CK CS C +  +  D+ML CD+CD+GFH+ CCDPP+  +PKG W+C++CRP   GRK
BLAST of Histone acetyltransferase vs. UniProt/SwissProt
Match: sp|Q8WML3|KAT6B_MACFA (Histone acetyltransferase KAT6B OS=Macaca fascicularis OX=9541 GN=KAT6B PE=2 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 2.434e-86
Identity = 154/297 (51.85%), Postives = 199/297 (67.00%), Query Frame = 3
            R+P  I+ G++ I TWYS+PYP EYARL  LY+CE+CLK +KS ++ + H +KC ++ PP NEIYR  DLSVFEVDG +SK+YCQ LCLLAKLFLDHKTLYYDVEPFLFYV   +  K  H++GYFSKEK    KYN+SCIM++P +Q+  +GRFLIDFSYLLSR+EGQ GSPEKPLS LGR+SY +YWKS IL Y+ +  +                   ++I  +S  TG+ PHD+A+T+Q L     +D  D   +    EKL     E  K  SR  +   +D + LRW P++

HSP 2 Score: 151.754 bits (382), Expect = 2.939e-35
Identity = 59/115 (51.30%), Postives = 83/115 (72.17%), Query Frame = 3
            PIPIC+FCLG +  N R K+ E +++C DCG+  HP+CL++   L   V+ +RWQC++CK CS C +  R  D+ML CD+CD+GFH+ CCDPP+  +PKG W+C++CRP   GRK
BLAST of Histone acetyltransferase vs. UniProt/SwissProt
Match: sp|Q8WYB5|KAT6B_HUMAN (Histone acetyltransferase KAT6B OS=Homo sapiens OX=9606 GN=KAT6B PE=1 SV=3)

HSP 1 Score: 317.775 bits (813), Expect = 3.104e-86
Identity = 155/300 (51.67%), Postives = 200/300 (66.67%), Query Frame = 3
            R+P  I+ G++ I TWYS+PYP EYARL  LY+CE+CLK +KS ++ + H +KC ++ PP NEIYR  DLSVFEVDG +SK+YCQ LCLLAKLFLDHKTLYYDVEPFLFYV   +  K  H++GYFSKEK    KYN+SCIM++P +Q+  +GRFLIDFSYLLSR+EGQ GSPEKPLS LGR+SY +YWKS IL Y+ +  +                   ++I  +S  TG+ PHD+A+T+Q L     +D  D   +    EKL     E  K  SR  +   +D + LRW P++  N

HSP 2 Score: 152.14 bits (383), Expect = 2.458e-35
Identity = 59/115 (51.30%), Postives = 83/115 (72.17%), Query Frame = 3
            PIPIC+FCLG +  N R K+ E +++C DCG+  HP+CL++   L   V+ +RWQC++CK CS C +  R  D+ML CD+CD+GFH+ CCDPP+  +PKG W+C++CRP   GRK
BLAST of Histone acetyltransferase vs. UniProt/SwissProt
Match: sp|Q8BRB7|KAT6B_MOUSE (Histone acetyltransferase KAT6B OS=Mus musculus OX=10090 GN=Kat6b PE=1 SV=3)

HSP 1 Score: 317.39 bits (812), Expect = 3.438e-86
Identity = 157/300 (52.33%), Postives = 201/300 (67.00%), Query Frame = 3

HSP 2 Score: 150.214 bits (378), Expect = 8.130e-35
Identity = 58/115 (50.43%), Postives = 83/115 (72.17%), Query Frame = 3
            PIPIC+FCLG +  N R K+ E +++C DCG+  HP+CL++   L   V+ +RWQC++CK CS C +  +  D+ML CD+CD+GFH+ CCDPP+  +PKG W+C++CRP   GRK
BLAST of Histone acetyltransferase vs. UniProt/SwissProt
Match: sp|Q5TKR9|KAT6A_RAT (Histone acetyltransferase KAT6A OS=Rattus norvegicus OX=10116 GN=Kat6a PE=1 SV=2)

HSP 1 Score: 314.694 bits (805), Expect = 2.827e-85
Identity = 154/297 (51.85%), Postives = 198/297 (66.67%), Query Frame = 3
            R P  I+ G++ I TWYS+PYP EY+RL  LY+CE+CLK +KS  +   HM+KC ++ PP NEIYR  ++SVFEVDG VS +YCQ LCLLAKLFLDHKTLYYDVEPFLFYV   +  K  H++GYFSKEK    KYN+SCIM+LP YQ+  YGRFLIDFSYLLS++EGQ GSPEKPLS LGR+SY +YWKS IL  + +++D                   ++I ++S  TG+ P D+ ST+  L + +D   SD+  I    EKL  +         + + +D ECLRW P+I  N

HSP 2 Score: 153.295 bits (386), Expect = 1.157e-35
Identity = 64/126 (50.79%), Postives = 87/126 (69.05%), Query Frame = 3
            K KP+      PIPIC+FCLG +  N R K+ E++I+C DCG   HP+CL++   L  +VR +RWQC++CK CS C    +  D+ML CD+CD+GFH+ CCDPP+  +PKG W+C+ICRP   GRK
BLAST of Histone acetyltransferase vs. UniProt/SwissProt
Match: sp|Q8BZ21|KAT6A_MOUSE (Histone acetyltransferase KAT6A OS=Mus musculus OX=10090 GN=Kat6a PE=1 SV=2)

HSP 1 Score: 314.694 bits (805), Expect = 3.436e-85
Identity = 154/297 (51.85%), Postives = 198/297 (66.67%), Query Frame = 3
            R P  I+ G++ I TWYS+PYP EY+RL  LY+CE+CLK +KS  +   HM+KC ++ PP NEIYR  ++SVFEVDG VS +YCQ LCLLAKLFLDHKTLYYDVEPFLFYV   +  K  H++GYFSKEK    KYN+SCIM+LP YQ+  YGRFLIDFSYLLS++EGQ GSPEKPLS LGR+SY +YWKS IL  + +++D                   ++I ++S  TG+ P D+ ST+  L + +D   SD+  I    EKL  +         + + +D ECLRW P+I  N

HSP 2 Score: 150.214 bits (378), Expect = 8.431e-35
Identity = 62/126 (49.21%), Postives = 86/126 (68.25%), Query Frame = 3
            K KP+      PIPIC+FCLG +  N R K+ E +++C DCG   HP+CL++   L  +V+ +RWQC++CK CS C    +  D+ML CD+CD+GFH+ CCDPP+  +PKG W+C+ICRP   GRK
BLAST of Histone acetyltransferase vs. TrEMBL
Match: A0A3R7DES9 (Histone acetyltransferase (Fragment) OS=Clonorchis sinensis OX=79923 GN=KAT6B PE=3 SV=1)

HSP 1 Score: 418.698 bits (1075), Expect = 1.518e-121
Identity = 214/391 (54.73%), Postives = 261/391 (66.75%), Query Frame = 3

HSP 2 Score: 139.043 bits (349), Expect = 3.637e-29
Identity = 57/122 (46.72%), Postives = 75/122 (61.48%), Query Frame = 3
            RK    IPIC  CLG   LNK+T   E++I CW CG   HPTCL+ P  L  ++R +RW+C+ CKRC  C + SR           D D+LLCD+CD+GFH+ C +P +  LP+G W+C IC
BLAST of Histone acetyltransferase vs. TrEMBL
Match: A0A5K3ERB2 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 414.075 bits (1063), Expect = 6.522e-119
Identity = 216/403 (53.60%), Postives = 263/403 (65.26%), Query Frame = 3

HSP 2 Score: 132.109 bits (331), Expect = 6.017e-27
Identity = 64/161 (39.75%), Postives = 82/161 (50.93%), Query Frame = 3
            P+NR M   IPIC+FCLGDE  N R K  E MI CW CG   HP+CLQ   S+ Q V+ +RW C+ CKRC+ C             G +                 S KD+D+LLCD CD+G+H+ C  P +   P G W C IC      +  P++ S E
BLAST of Histone acetyltransferase vs. TrEMBL
Match: A0A5K3ERI6 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 412.92 bits (1060), Expect = 4.391e-118
Identity = 216/403 (53.60%), Postives = 263/403 (65.26%), Query Frame = 3

HSP 2 Score: 131.339 bits (329), Expect = 1.035e-26
Identity = 64/161 (39.75%), Postives = 82/161 (50.93%), Query Frame = 3
            P+NR M   IPIC+FCLGDE  N R K  E MI CW CG   HP+CLQ   S+ Q V+ +RW C+ CKRC+ C             G +                 S KD+D+LLCD CD+G+H+ C  P +   P G W C IC      +  P++ S E
BLAST of Histone acetyltransferase vs. TrEMBL
Match: A0A4S2L8M8 (Histone acetyltransferase OS=Opisthorchis felineus OX=147828 GN=CRM22_009194 PE=3 SV=1)

HSP 1 Score: 423.705 bits (1088), Expect = 5.660e-117
Identity = 218/434 (50.23%), Postives = 276/434 (63.59%), Query Frame = 3
            D CP    + E +R  +A IQ  V   LP P++++       +I  P  N       P+L I       +S    N++ +     RFPPRIQ+GRH+I TWYSAPYPSEYARLN+LYICE+CLK  K+  VY+ H++KC + FPPGNEIYR G++SVFEVDGY S+LYCQQLCLLAKLFLDHKTLYYDVEPFLFYV  + +     ++GYFSKEKRS  KYNLSCIMVLPPYQK  YGRFLIDFS+LLSR E Q GSPEKPLS LGR+SYESYW+SK+LP+IL       N DD  +DF+              TI ++ST TGI PHDV  TI+ L+  + L    R+ I+FD   L +   KY +R   WIP+DE+CLRW PLI+P E     + +  +  +P  D        +I +  S   + ++P  +

HSP 2 Score: 143.665 bits (361), Expect = 3.034e-30
Identity = 62/151 (41.06%), Postives = 89/151 (58.94%), Query Frame = 3
            +AKPI + P +   +  +N       ++M +P   IPIC  CLG   +NK+T   E++I CW CG   HPTCL+ P  L  ++R +RW+C+ CKRC  C + SR           D D+LLCD+CD+GFH+ C +P +  LP+G W+C IC
BLAST of Histone acetyltransferase vs. TrEMBL
Match: G7Y8D1 (Histone acetyltransferase OS=Clonorchis sinensis OX=79923 GN=CLF_102694 PE=3 SV=1)

HSP 1 Score: 423.32 bits (1087), Expect = 6.712e-117
Identity = 215/393 (54.71%), Postives = 262/393 (66.67%), Query Frame = 3

HSP 2 Score: 142.51 bits (358), Expect = 6.055e-30
Identity = 57/122 (46.72%), Postives = 75/122 (61.48%), Query Frame = 3
            RK    IPIC  CLG   LNK+T   E++I CW CG   HPTCL+ P  L  ++R +RW+C+ CKRC  C + SR           D D+LLCD+CD+GFH+ C +P +  LP+G W+C IC
BLAST of Histone acetyltransferase vs. Ensembl Cavefish
Match: ENSAMXT00000015644.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000039.1:1252603:1294619:1 gene:ENSAMXG00000015159.2 transcript:ENSAMXT00000015644.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 309.301 bits (791), Expect = 8.792e-89
Identity = 152/297 (51.18%), Postives = 197/297 (66.33%), Query Frame = 3
            R P  I+ G+  I TWYS+PYP EY+RL  LY+CE+CL+ +KS  +   HM+KCT++ PP NEIYR  ++SVFEVDG VS +YCQ LCLLAKLFLDHKTLYYDVEPFLFYV   + +K  H++GYFSKEK    KYN+SCIM+LP YQ+  YGRFLIDFSYLLS++EGQ GSPEKPLS LGR+SY +YW+S +L  + +  D                   +TI R+S  TGI P D+ +T+Q L+    L++     +    EKL +         P+ + +D +CLRW P+I  N

HSP 2 Score: 140.584 bits (353), Expect = 2.473e-33
Identity = 56/115 (48.70%), Postives = 81/115 (70.43%), Query Frame = 3
            +R +  PIPIC+FCLG +  N R K+ E +I+C DCG   HP+CL++   L  +V+ + WQC++CK CS C    +  ++ML CD+CD+GFH+ CCDPP+  +PKG W+C+ICRP
BLAST of Histone acetyltransferase vs. Ensembl Cavefish
Match: kat6b (lysine acetyltransferase 6B [Source:NCBI gene;Acc:103034382])

HSP 1 Score: 317.775 bits (813), Expect = 3.765e-87
Identity = 152/293 (51.88%), Postives = 198/293 (67.58%), Query Frame = 3
            ++P  I+ G + I TWYS+PYP EY RL  LY+CE+CLK +KS ++   H QKC ++ PP NEIYR   LSVFEVDG +SK++CQ LCLLAKLFLDHKTLYYDVEPFLFYV   +  K  H++GYFSKEK    KYN+SCIM++P YQ+  +GRFLIDFSYLLSR+EGQ GSPEKPLS LGR+SY +YWKS IL Y+ N  D +                 V+I  +S  TG+ PHD+A+T+Q L+  +D+ +  R  I    + ++   E+   + P+   +D ECL W P+

HSP 2 Score: 152.525 bits (384), Expect = 2.351e-36
Identity = 57/111 (51.35%), Postives = 81/111 (72.97%), Query Frame = 3
            V PIPIC+FCLG +  N R KR E +++C DCG+  HP+CL++   L   V+ +RWQC++CK CS C +  +  D+ML CD+CD+GFH+ CCDPP+  +PKG W+C++CRP
BLAST of Histone acetyltransferase vs. Ensembl Cavefish
Match: kat6b (lysine acetyltransferase 6B [Source:NCBI gene;Acc:103034382])

HSP 1 Score: 306.22 bits (783), Expect = 1.257e-83
Identity = 156/322 (48.45%), Postives = 202/322 (62.73%), Query Frame = 3
            ++P  I+ G + I TWYS+PYP EY RL  LY+CE+CLK +KS ++   H QKC ++ PP NEIYR   LSVFEVDG +SK++CQ LCLLAKLFLDHKTLYYDVEPFLFYV   +  K  H++GYFSKEK    KYN+SCIM++P YQ+  +GRFLIDFSYLLSR+EGQ GSPEKPLS LGR+SY +YWKS IL Y+ N  D +                 V+I  +S  TG+ PHD+A+T+Q L+  +D+ +   + ++     L +  +      P     D     +   I P  KC N  R  P+ +     FSS  E

HSP 2 Score: 152.525 bits (384), Expect = 2.194e-36
Identity = 57/111 (51.35%), Postives = 81/111 (72.97%), Query Frame = 3
            V PIPIC+FCLG +  N R KR E +++C DCG+  HP+CL++   L   V+ +RWQC++CK CS C +  +  D+ML CD+CD+GFH+ CCDPP+  +PKG W+C++CRP
BLAST of Histone acetyltransferase vs. Ensembl Cavefish
Match: ENSAMXT00000046538.1 (histone acetyltransferase KAT7 [Source:NCBI gene;Acc:103035053])

HSP 1 Score: 281.182 bits (718), Expect = 1.033e-81
Identity = 144/294 (48.98%), Postives = 183/294 (62.24%), Query Frame = 3
            I  GR+ +DTWY +PYP EYARL  LY+CE+CLK +KS  +   HM KC +  PPG+EIYR G +SVFEVDG  +K+YCQ LCLLAKLFLDHKTLYYDVEPFLFYV   + N   H++GYFSKEK S   YN+SCI+ +P Y +  YG+ LIDFSYLLS+ E + GSPE+PLS LG ISY SYWK  +L Y+ N                  +G  ++I  +S ET ++P D+ ST+Q L        K + L   D I    DW     E ++ +S+      ID   L+W P
BLAST of Histone acetyltransferase vs. Ensembl Cavefish
Match: ENSAMXT00000046151.1 (histone acetyltransferase KAT7 [Source:NCBI gene;Acc:103035053])

HSP 1 Score: 281.952 bits (720), Expect = 2.111e-81
Identity = 144/294 (48.98%), Postives = 183/294 (62.24%), Query Frame = 3
            I  GR+ +DTWY +PYP EYARL  LY+CE+CLK +KS  +   HM KC +  PPG+EIYR G +SVFEVDG  +K+YCQ LCLLAKLFLDHKTLYYDVEPFLFYV   + N   H++GYFSKEK S   YN+SCI+ +P Y +  YG+ LIDFSYLLS+ E + GSPE+PLS LG ISY SYWK  +L Y+ N                  +G  ++I  +S ET ++P D+ ST+Q L        K + L   D I    DW     E ++ +S+      ID   L+W P
BLAST of Histone acetyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007004.1 (pep scaffold:Pmarinus_7.0:GL480995:3484:21994:1 gene:ENSPMAG00000006332.1 transcript:ENSPMAT00000007004.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 269.626 bits (688), Expect = 5.997e-81
Identity = 129/240 (53.75%), Postives = 163/240 (67.92%), Query Frame = 3
BLAST of Histone acetyltransferase vs. Ensembl Sea Lamprey
Match: kat7b (K(lysine) acetyltransferase 7b [Source:ZFIN;Acc:ZDB-GENE-030131-1901])

HSP 1 Score: 276.174 bits (705), Expect = 8.556e-81
Identity = 144/294 (48.98%), Postives = 183/294 (62.24%), Query Frame = 3
            I  GR+ +DTWY +PYP EYARL  LY+CE+CLK +KS  +   H +KC +  PPG+EIYR G +SVFEVDG  +K+YCQ LCLLAKLFLDHKTLYYDVEPFLFYV     N   HIIGYFSKEK S   YN+SCI+ +P + +  YG+ LIDFSYLLS++E + GSPE+PLS LG ISY SYWK  +L Y+          +A Q       G  ++I  +S +T ++P D+ +T+Q L        K + L   D I      + L+ EA K  S       ID   L+W P
BLAST of Histone acetyltransferase vs. Ensembl Sea Lamprey
Match: kat5b (K(lysine) acetyltransferase 5b [Source:ZFIN;Acc:ZDB-GENE-030131-985])

HSP 1 Score: 258.84 bits (660), Expect = 2.992e-75
Identity = 135/289 (46.71%), Postives = 175/289 (60.55%), Query Frame = 3
            I++GRH +  WY +PYP E   L VLY+CE+CLK +KS      HM KC    PPGNEIYR G++S FE+DG  +K Y Q LCLLAK FLDHKTLYYD +PFLFYV      K  HI+GYFSKEK ST  YN++CI+ LPPYQ+  YG  LI+FSY LS+ EG+ G+PEKPLS LG +SY SYW   IL       ++ +D  A        +   +TI+ +S  T I   DV ST+Q L    +L N    +  +   +E ++   +  A R    + ID +CL + P
BLAST of Histone acetyltransferase vs. Ensembl Sea Lamprey
Match: dpf2 (D4, zinc and double PHD fingers family 2 [Source:ZFIN;Acc:ZDB-GENE-041024-2])

HSP 1 Score: 124.405 bits (311), Expect = 2.675e-30
Identity = 57/160 (35.62%), Postives = 92/160 (57.50%), Query Frame = 3
            T++++ + + +  + +P      +  +RK       +  P   C FCLG    NK+T + E +++C DCG   HP+CLQ+  ++   V+T RWQC++CK C+ CG  S  DD +L CD CD+G+H+YC  P +   P+G W CR+C      KEK S+++
BLAST of Histone acetyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002602.1 (pep scaffold:Pmarinus_7.0:GL477730:26567:61347:1 gene:ENSPMAG00000002341.1 transcript:ENSPMAT00000002602.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.0258 bits (188), Expect = 3.440e-14
Identity = 34/84 (40.48%), Postives = 49/84 (58.33%), Query Frame = 3
            ++ C  CG C HP C+     + + V +  W+CL+C  C  CG+ S     +LLCD CD  +HIYC +PP+  +PKG W C+ C

HSP 2 Score: 70.0922 bits (170), Expect = 4.579e-12
Identity = 35/86 (40.70%), Postives = 46/86 (53.49%), Query Frame = 3
            N + C  CG   H  CL+   S   +     WQC +CK    C M    D  ML+CDACD+GFH YC  P ++++PK  W C+ CR
BLAST of Histone acetyltransferase vs. Ensembl Yeast
Match: ESA1 (Catalytic subunit of the histone acetyltransferase complex (NuA4); acetylates four conserved internal lysines of histone H4 N-terminal tail and can acetylate histone H2A; master regulator of cellular acetylation balance; required for cell cycle progression and transcriptional silencing at the rDNA locus and regulation of autophagy; human ortholog TIP60/KAT5 is implicated in cancer and other diseases, functionally complements lethality of the esa1 null mutation [Source:SGD;Acc:S000005770])

HSP 1 Score: 217.624 bits (553), Expect = 6.134e-62
Identity = 106/242 (43.80%), Postives = 150/242 (61.98%), Query Frame = 3
            RI +G++ I+ WY +PYP E    + +YI ++ L+   S   Y  + +KCT   PPGNEIYR+  +S FE+DG   + +C+ LCLL+KLFLDHKTLYYDV+PFLFY          H++GYFSKEK S   YN++CI+ LP YQ+  YG+ LI+FSY LS+KE + GSPEKPLS LG +SY +YW   ++  ++            QK         +TID +S+ T ++  D+  T + L+
BLAST of Histone acetyltransferase vs. Ensembl Yeast
Match: SAS3 (Histone acetyltransferase catalytic subunit of NuA3 complex; acetylates histone H3, involved in transcriptional silencing; homolog of the mammalian MOZ proto-oncogene; mutant has aneuploidy tolerance; sas3gcn5 double mutation is lethal [Source:SGD;Acc:S000000148])

HSP 1 Score: 225.328 bits (573), Expect = 2.611e-61
Identity = 125/330 (37.88%), Postives = 198/330 (60.00%), Query Frame = 3
            I +  + I  WY++P+P    +  +++ICE+CLK + S   +  H  KC  + PPGNEIYR+G LSV+E+DG  + LYCQ LCLLAK F++ KTLYYDVEPF+FY+    ++  +         H +GYFSKEK +++ YNLSCI+ LP YQ+  YG+FL++FSYLLSRKE + G+PEKPLS LG ++Y ++WK K    +L   D      AR++    ++     V+++ ++  TG+ P DV   ++ L      K   L + D  +  I+ D W ++++  + ++S+ YP+   +  + L W P+I  P+     +M  +P  ++ +
BLAST of Histone acetyltransferase vs. Ensembl Yeast
Match: SAS2 (Histone acetyltransferase (HAT) catalytic subunit of the SAS complex; acetylates free histones and nucleosomes and regulates transcriptional silencing; member of the MYSTacetyltransferase family; other members are Sas4p and Sas5p [Source:SGD;Acc:S000004734])

HSP 1 Score: 137.887 bits (346), Expect = 9.452e-36
Identity = 84/261 (32.18%), Postives = 139/261 (53.26%), Query Frame = 3
            L+ L++CEYC K       +V H+  C F Y  PG   Y++ + ++  V G   +L+CQ LCL  KL+LD+K++Y+ V+ + FY+  + +  S+  +G+FSK+  S  + NL+CI++ PPYQ+   G  LI+FSY LS+ EG    PE PLS  G I Y  YW   +  +++  D    D               VT++ +S  TG+  +DV  T++ L+    +  +++I +Q    W KL      +     +++ ID+
BLAST of Histone acetyltransferase vs. Ensembl Yeast
Match: JHD2 (JmjC domain family histone demethylase; promotes global demethylation of H3K4 and repression of noncoding intergenic transcription during sporulation; removes methyl groups added by Set1p methyltransferase; negatively regulated by H3K14 acetylation; protein levels regulated by Not4p polyubiquitin-mediated degradation; regulates sporulation timing by extending period of active transcription in opposition to programmed global transcriptional quiescence; regulates rDNA silencing [Source:SGD;Acc:S000003880])

HSP 1 Score: 54.6842 bits (130), Expect = 1.167e-7
Identity = 21/49 (42.86%), Postives = 32/49 (65.31%), Query Frame = 3
            ++ RK +D    +LCD+CD+ FHIYC  PP++ +P G+W+C  C    G
BLAST of Histone acetyltransferase vs. Ensembl Nematostella
Match: EDO39884 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8T4])

HSP 1 Score: 257.684 bits (657), Expect = 5.904e-76
Identity = 133/292 (45.55%), Postives = 175/292 (59.93%), Query Frame = 3
            +F  + Q G++ IDTWY +PYP EY +LN L+ICEYC+K +K    +  H+ KC    PPG EIYR G +SV+EVDG   KLYCQ +CLLAKLFLDHKTLY+DVEPFLFY+      + +H++GYFSKEK S    N++CI+ LPPYQ+  YG+FLI+FSY LS+ E   GSPEKPLS LG++SY SYW   +L       D+  +F              ++I  +S  T I+  D+  T+Q L+          I +     KL  E  K A      + +D  CLRW P
BLAST of Histone acetyltransferase vs. Ensembl Nematostella
Match: EDO34934 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMW6])

HSP 1 Score: 253.062 bits (645), Expect = 2.794e-73
Identity = 130/289 (44.98%), Postives = 171/289 (59.17%), Query Frame = 3
            +Q+G+  I  WY +PYP E+  L ++Y+C++CLK +KS+     HM KC  + PPGNEIYRNG +S FE+DG  +K Y Q LCLLAK+FLDHKTLYYD +PFLFY+   S     HI+GYFSKEK ST  YN++CI+ LP YQ+  YG+ LI+FSY LS+ EG+ G+PEKPLS LG +SY SYW   IL  ++                K   G   ++TI+ +   T I   DV ST+Q L   +       I +    E L+      + R    I ID  CL W P
BLAST of Histone acetyltransferase vs. Ensembl Nematostella
Match: EDO39738 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S982])

HSP 1 Score: 176.022 bits (445), Expect = 7.305e-51
Identity = 83/121 (68.60%), Postives = 94/121 (77.69%), Query Frame = 3
BLAST of Histone acetyltransferase vs. Ensembl Nematostella
Match: EDO41238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z1])

HSP 1 Score: 124.79 bits (312), Expect = 4.959e-31
Identity = 52/110 (47.27%), Postives = 73/110 (66.36%), Query Frame = 3
            V P   C FCLGD + NK++ R E +++C DCG   HP+CLQ+   L   V+  RWQC++CK C+ CG  S  DD +L CD CD+G+H+YC +PP+   P+G W+C +CR
BLAST of Histone acetyltransferase vs. Ensembl Nematostella
Match: EDO39739 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S983])

HSP 1 Score: 104.375 bits (259), Expect = 2.824e-26
Identity = 46/77 (59.74%), Postives = 56/77 (72.73%), Query Frame = 3
BLAST of Histone acetyltransferase vs. Ensembl Medaka
Match: kat6b (lysine acetyltransferase 6B [Source:NCBI gene;Acc:101170471])

HSP 1 Score: 310.842 bits (795), Expect = 2.652e-85
Identity = 152/314 (48.41%), Postives = 202/314 (64.33%), Query Frame = 3
            P+   +    DSS   R P  I+ G + I TWYS+PYP EY++L  LY+CE+CLK ++S ++   H +KC ++ PP NEIYR  +LSVFEVDG VSKL+CQ LCLLAKLFLDHKTLYYDVEPFLFY+   +  K  H++GYFSKEK    KYN+SCIM++P YQ+  +GRFLIDFSYLL+R+EGQ GSPEKPLS LGR+SY +YW+S IL ++    D                   ++I  +S  TG+ PHD+A+T+Q L     +D  D  ++    E+L  E  +     P+   +D + LRW P   +NP

HSP 2 Score: 150.214 bits (378), Expect = 9.525e-36
Identity = 56/111 (50.45%), Postives = 81/111 (72.97%), Query Frame = 3
            V PIPIC+FCLG +  N R KR E +++C DCG+  HP+CL++   L   V+ +RWQC++CK CS C +  +  ++ML CD+CD+GFH+ CCDPP+  +PKG W+C++CRP
BLAST of Histone acetyltransferase vs. Ensembl Medaka
Match: kat6b (lysine acetyltransferase 6B [Source:NCBI gene;Acc:101170471])

HSP 1 Score: 310.071 bits (793), Expect = 9.199e-85
Identity = 148/298 (49.66%), Postives = 196/298 (65.77%), Query Frame = 3
            R P  I+ G + I TWYS+PYP EY++L  LY+CE+CLK ++S ++   H +KC ++ PP NEIYR  +LSVFEVDG VSKL+CQ LCLLAKLFLDHKTLYYDVEPFLFY+   +  K  H++GYFSKEK    KYN+SCIM++P YQ+  +GRFLIDFSYLL+R+EGQ GSPEKPLS LGR+SY +YW+S IL ++    D                   ++I  +S  TG+ PHD+A+T+Q L     +D  D  ++    E+L  E  +     P+   +D + LRW P   +NP

HSP 2 Score: 151.369 bits (381), Expect = 5.210e-36
Identity = 56/111 (50.45%), Postives = 81/111 (72.97%), Query Frame = 3
            V PIPIC+FCLG +  N R KR E +++C DCG+  HP+CL++   L   V+ +RWQC++CK CS C +  +  ++ML CD+CD+GFH+ CCDPP+  +PKG W+C++CRP
BLAST of Histone acetyltransferase vs. Ensembl Medaka
Match: kat6a (lysine acetyltransferase 6A [Source:NCBI gene;Acc:101165316])

HSP 1 Score: 310.457 bits (794), Expect = 9.699e-85
Identity = 151/300 (50.33%), Postives = 200/300 (66.67%), Query Frame = 3
            R P  I+ G+  I TWYS+PYP EY+RL  LY+CE+CL+ +KS  +   HM+KC+++ PP NEIYR  D+SVFEVDG VS +YCQ LCLLAKLFLDHKTLYYDVEPFLFYV   + +K  H++GYFSKEK    KYN+SCIM+LP YQ+  YGRFLIDFSYLLS++EGQ GSPEKPLS LGR+SY +YW+S +L       +   +   RQ          ++I ++S  TGI P D+ S++    +L ++ D   L   D++ +     +LK+         P+ + +D ECLRW P+I

HSP 2 Score: 146.362 bits (368), Expect = 1.734e-34
Identity = 60/128 (46.88%), Postives = 86/128 (67.19%), Query Frame = 3
            PV++    K KP+      PIPIC+FCLG +  N R K+ E +I+C DCG   HP+CL++   L  +V+ + WQC++CK CS C    +  D+ML CD+CD+GFH+ CCDPP+  +PKG W+C+IC+P
BLAST of Histone acetyltransferase vs. Ensembl Medaka
Match: kat7b (lysine acetyltransferase 7 [Source:NCBI gene;Acc:101156686])

HSP 1 Score: 280.026 bits (715), Expect = 2.892e-81
Identity = 129/240 (53.75%), Postives = 163/240 (67.92%), Query Frame = 3
BLAST of Histone acetyltransferase vs. Ensembl Medaka
Match: ENSORLT00000020927.2 (histone acetyltransferase KAT7 [Source:NCBI gene;Acc:101165809])

HSP 1 Score: 280.411 bits (716), Expect = 7.142e-81
Identity = 141/294 (47.96%), Postives = 182/294 (61.90%), Query Frame = 3
            I  GR+ +DTWY +PYP EYARL  LY+CE+CLK +KS  +   HM KC +  PPG+EIYR  ++SVFEVDG  +K+YCQ LCLLAKLFLDHKTLYYDVEPFLFYV   + N   H++GYFSKEK S   YN+SCI+ +P Y +  YG+ LIDFSYLLS+ E + GSPE+PLS LG ISY SYWK  +L Y+ N                  +G  ++I  +S ET ++P D+ ST+Q L        K + L   D I    DW+  +++     +       ID   L+W P
BLAST of Histone acetyltransferase vs. Planmine SMEST
Match: SMESG000062900.1 (SMESG000062900.1)

HSP 1 Score: 2709.48 bits (7022), Expect = 0.000e+0
Identity = 1584/1598 (99.12%), Postives = 1584/1598 (99.12%), Query Frame = 3
BLAST of Histone acetyltransferase vs. Planmine SMEST
Match: SMESG000062900.1 (SMESG000062900.1)

HSP 1 Score: 2709.48 bits (7022), Expect = 0.000e+0
Identity = 1584/1598 (99.12%), Postives = 1584/1598 (99.12%), Query Frame = 3
BLAST of Histone acetyltransferase vs. Planmine SMEST
Match: SMESG000062900.1 (SMESG000062900.1)

HSP 1 Score: 2700.23 bits (6998), Expect = 0.000e+0
Identity = 1582/1598 (99.00%), Postives = 1582/1598 (99.00%), Query Frame = 3
BLAST of Histone acetyltransferase vs. Planmine SMEST
Match: SMESG000040171.1 (SMESG000040171.1)

HSP 1 Score: 248.825 bits (634), Expect = 1.004e-71
Identity = 154/406 (37.93%), Postives = 219/406 (53.94%), Query Frame = 3
            A+I E    T ++N+   +Y     D    +  P   ID     +I+++  + LL    + +   L   Q   IN     R+    P + SI   + +++  F  +      ++   I+ G + I+TWY +PYP +Y +   LYICEYCLK +K  D ++ H  +C    PPG EIYR  +LSVFE+DG   KLYCQ LCLLAKLFLDHKTLYYDV PF+FYV      +  H++GYFSKEK S   YNL+CI+ LPP+Q+  YG+FLI FSY L++ E   GSPEKPLS LG +SY SYW+  I  Y+L+  +                    +I+ +ST T IS  D+ S ++   L K       +   +Q   + L    E + ++ P  I ID+ CL+W+P
BLAST of Histone acetyltransferase vs. Planmine SMEST
Match: SMESG000049001.1 (SMESG000049001.1)

HSP 1 Score: 230.72 bits (587), Expect = 2.067e-65
Identity = 114/244 (46.72%), Postives = 155/244 (63.52%), Query Frame = 3
            I +G+  I  WY +PYP E   L+ ++ICE+CLK  KS      H++KC    PPGNEIYR   LS FE+DG  +K Y Q LCLLAKLFLDHKTLYYD +PFLFY+      +  HI+GYFSKEK S    N++CI+ LPPYQ+  YG+ LI+FSY LS+ E + GSPEKPLS LG +SY SYW   I+  I+   N  D   +  +    + P    +++++ V  +T I+P D+ +T+  ++
The following BLAST results are available for this feature:
BLAST of Histone acetyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KAT6B5.866e-9051.67lysine acetyltransferase 6B [Source:HGNC Symbol;Ac... [more]
KAT6B5.866e-9051.67lysine acetyltransferase 6B [Source:HGNC Symbol;Ac... [more]
KAT6B2.337e-8951.67lysine acetyltransferase 6B [Source:HGNC Symbol;Ac... [more]
KAT6B2.337e-8951.67lysine acetyltransferase 6B [Source:HGNC Symbol;Ac... [more]
KAT6B2.467e-8951.67lysine acetyltransferase 6B [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lsy-121.254e-7041.53Histone acetyltransferase [Source:UniProtKB/TrEMB... [more]
lsy-121.254e-7041.53Histone acetyltransferase [Source:UniProtKB/TrEMB... [more]
mys-11.505e-7050.42Histone acetyltransferase Tip60 homolog [Source:U... [more]
lsy-123.275e-6841.08Histone acetyltransferase [Source:UniProtKB/TrEMB... [more]
lsy-123.275e-6841.08Histone acetyltransferase [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
enok2.236e-8846.36gene:FBgn0034975 transcript:FBtr0343339[more]
enok2.236e-8846.36gene:FBgn0034975 transcript:FBtr0072250[more]
chm2.176e-7647.30gene:FBgn0028387 transcript:FBtr0079443[more]
chm2.176e-7647.30gene:FBgn0028387 transcript:FBtr0332523[more]
Tip607.379e-7246.69gene:FBgn0026080 transcript:FBtr0070668[more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kat6b2.647e-8849.69K(lysine) acetyltransferase 6B [Source:ZFIN;Acc:ZD... [more]
kat6a1.565e-8551.36K(lysine) acetyltransferase 6A [Source:ZFIN;Acc:ZD... [more]
kat7a1.576e-8248.98K(lysine) acetyltransferase 7a [Source:ZFIN;Acc:ZD... [more]
kat7a1.184e-8148.98K(lysine) acetyltransferase 7a [Source:ZFIN;Acc:ZD... [more]
kat7b3.476e-8148.64K(lysine) acetyltransferase 7b [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kat71.947e-8349.66lysine acetyltransferase 7 [Source:NCBI gene;Acc:5... [more]
kat72.933e-8349.66lysine acetyltransferase 7 [Source:NCBI gene;Acc:5... [more]
kat75.825e-8349.66lysine acetyltransferase 7 [Source:NCBI gene;Acc:5... [more]
kat76.436e-8349.66lysine acetyltransferase 7 [Source:NCBI gene;Acc:5... [more]
kat76.858e-8349.66lysine acetyltransferase 7 [Source:NCBI gene;Acc:5... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kat6b4.914e-8752.33K(lysine) acetyltransferase 6B [Source:MGI Symbol;... [more]
Kat6b4.914e-8752.33K(lysine) acetyltransferase 6B [Source:MGI Symbol;... [more]
Kat6b6.763e-8752.00K(lysine) acetyltransferase 6B [Source:MGI Symbol;... [more]
Kat6b7.146e-8752.33K(lysine) acetyltransferase 6B [Source:MGI Symbol;... [more]
Kat6b7.146e-8752.33K(lysine) acetyltransferase 6B [Source:MGI Symbol;... [more]
back to top
BLAST of Histone acetyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8WML3|KAT6B_MACFA2.434e-8651.85Histone acetyltransferase KAT6B OS=Macaca fascicul... [more]
sp|Q8WYB5|KAT6B_HUMAN3.104e-8651.67Histone acetyltransferase KAT6B OS=Homo sapiens OX... [more]
sp|Q8BRB7|KAT6B_MOUSE3.438e-8652.33Histone acetyltransferase KAT6B OS=Mus musculus OX... [more]
sp|Q5TKR9|KAT6A_RAT2.827e-8551.85Histone acetyltransferase KAT6A OS=Rattus norvegic... [more]
sp|Q8BZ21|KAT6A_MOUSE3.436e-8551.85Histone acetyltransferase KAT6A OS=Mus musculus OX... [more]
back to top
BLAST of Histone acetyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7DES91.518e-12154.73Histone acetyltransferase (Fragment) OS=Clonorchis... [more]
A0A5K3ERB26.522e-11953.60Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3ERI64.391e-11853.60Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A4S2L8M85.660e-11750.23Histone acetyltransferase OS=Opisthorchis felineus... [more]
G7Y8D16.712e-11754.71Histone acetyltransferase OS=Clonorchis sinensis O... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000015644.28.792e-8951.18pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
kat6b3.765e-8751.88lysine acetyltransferase 6B [Source:NCBI gene;Acc:... [more]
kat6b1.257e-8348.45lysine acetyltransferase 6B [Source:NCBI gene;Acc:... [more]
ENSAMXT00000046538.11.033e-8148.98histone acetyltransferase KAT7 [Source:NCBI gene;A... [more]
ENSAMXT00000046151.12.111e-8148.98histone acetyltransferase KAT7 [Source:NCBI gene;A... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007004.15.997e-8153.75pep scaffold:Pmarinus_7.0:GL480995:3484:21994:1 ge... [more]
kat7b8.556e-8148.98K(lysine) acetyltransferase 7b [Source:ZFIN;Acc:ZD... [more]
kat5b2.992e-7546.71K(lysine) acetyltransferase 5b [Source:ZFIN;Acc:ZD... [more]
dpf22.675e-3035.63D4, zinc and double PHD fingers family 2 [Source:Z... [more]
ENSPMAT00000002602.13.440e-1440.48pep scaffold:Pmarinus_7.0:GL477730:26567:61347:1 g... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
ESA16.134e-6243.80Catalytic subunit of the histone acetyltransferase... [more]
SAS32.611e-6137.88Histone acetyltransferase catalytic subunit of NuA... [more]
SAS29.452e-3632.18Histone acetyltransferase (HAT) catalytic subunit ... [more]
JHD21.167e-742.86JmjC domain family histone demethylase; promotes g... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO398845.904e-7645.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349342.794e-7344.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO397387.305e-5168.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412384.959e-3147.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO397392.824e-2659.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kat6b2.652e-8548.41lysine acetyltransferase 6B [Source:NCBI gene;Acc:... [more]
kat6b9.199e-8549.66lysine acetyltransferase 6B [Source:NCBI gene;Acc:... [more]
kat6a9.699e-8550.33lysine acetyltransferase 6A [Source:NCBI gene;Acc:... [more]
kat7b2.892e-8153.75lysine acetyltransferase 7 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000020927.27.142e-8147.96histone acetyltransferase KAT7 [Source:NCBI gene;A... [more]
back to top
BLAST of Histone acetyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
back to top
The following sequences are available for this feature:

transcript sequence

>SMED30032280 ID=SMED30032280|Name=Histone acetyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=5162bp
back to top

protein sequence of SMED30032280-orf-1

>SMED30032280-orf-1 ID=SMED30032280-orf-1|Name=SMED30032280-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1605bp
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0002109X1 cell
Vocabulary: INTERPRO
Vocabulary: molecular function
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0016747transferase activity, transferring acyl groups other than amino-acyl groups
GO:0004402histone acetyltransferase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: biological process
GO:0006355regulation of transcription, DNA-templated
GO:0016573histone acetylation
Vocabulary: cellular component
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001965Zinc finger, PHD-typeSMARTSM00249PHD_3coord: 247..294
e-value: 1.5E-10
score: 51.0
coord: 190..246
e-value: 0.16
score: 21.1
NoneNo IPR availableGENE3DG3DSA: 645..707
e-value: 3.9E-22
score: 79.3
NoneNo IPR availableGENE3DG3DSA:3.40.630.30coord: 711..944
e-value: 1.3E-78
score: 265.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 980..1064
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 391..407
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 391..435
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 985..1005
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1031..1057
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1006..1030
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 421..435
coord: 650..1234
coord: 650..1234
NoneNo IPR availableCDDcd15526PHD1_MOZ_d4coord: 190..245
e-value: 1.949E-22
score: 89.7222
NoneNo IPR availableCDDcd15527PHD2_KAT6A_6Bcoord: 248..293
e-value: 2.97399E-18
score: 77.4182
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA: 188..304
e-value: 2.4E-29
score: 103.8
IPR040706MYST, zinc finger domainPFAMPF17772zf-MYSTcoord: 656..706
e-value: 3.2E-17
score: 61.9
IPR002717Histone acetyltransferase domain, MYST-typePFAMPF01853MOZ_SAScoord: 711..897
e-value: 1.9E-70
score: 236.2
IPR002717Histone acetyltransferase domain, MYST-typePROSITEPS51726MYST_HATcoord: 650..944
score: 62.404
IPR019787Zinc finger, PHD-fingerPFAMPF00628PHDcoord: 247..295
e-value: 3.6E-11
score: 42.8
IPR019787Zinc finger, PHD-fingerPROSITEPS50016ZF_PHD_2coord: 245..296
score: 10.22
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA: 829..920
e-value: 1.3E-78
score: 265.2
IPR016181Acyl-CoA N-acyltransferaseSUPERFAMILYSSF55729Acyl-CoA N-acyltransferases (Nat)coord: 656..942
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 237..298