TIR domain-containing protein

Overview
NameTIR domain-containing protein
Smed IDSMED30032258
Length (bp)1837
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TIR domain-containing protein (SMED30032258) t-SNE clustered cells

Violin plots show distribution of expression levels for TIR domain-containing protein (SMED30032258) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TIR domain-containing protein (SMED30032258) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TIR domain-containing protein (SMED30032258) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032258

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30032258SMESG000006301.1 SmedASXL_008983SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30032258SMESG000006301.1 dd_Smed_v4_11412_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30032258SMESG000006301.1 dd_Smed_v4_11412_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TIR domain-containing protein vs. TrEMBL
Match: A0A504YCL9 (TIR domain-containing protein OS=Fasciola gigantica OX=46835 GN=FGIG_08998 PE=4 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 3.098e-49
Identity = 134/477 (28.09%), Postives = 234/477 (49.06%), Query Frame = 1
Query:  139 NDLVTLHKAGKQLTSLYFDCKTHRLILSEHLIKIEFLEYAVKTLKQLNNLGVFQNDDIWFASFYLYNLCWNYSTINPEFGSGLMLCGIESLLISNITHDPYINNLSKRNVNYLISATLSIMNNILKTPGYRLIFSTENVIKGLIKISKFDDK-IAVLCTMCLSYIATNDN---IKSTSDFDIFYNVKVLFYCIDRALETDGKY-NNYTVYEFFEVLKFASLSNNQKDAIVNLDGFNIMIEQLNTTKDERVK-----REILFTLVNLCDAENGNKIKEIADF--------YSTNKSNVIS--------------------------SAVKTLSWFMEILEQKSKQNNNKLGKISRKKNIFINFAKPDERMAMKIFTDLMNGPNLP---LIINDDEDV--------------------DKLRQAYDKSSIIIVCVSEAFKNSINLKVGAEY-----ISLKNKIIFPVLIQNNYKPEGWI 1353
            +DL ++++ GKQL+  YFDC  +R  L++HL   E+  +A K +K+LNN+GVF+NDDIWF+SFY YN  WN+S   PEF + L   G+ +LL  NI H PY+ NLS +NV YLI A+LSI++NI + PG    F++++V + L+ +++ +++ +  + T+CL++I T      +  TS   I  + ++LF  I+ A  ++ +  + + V E    L   S+ +  K +++    F+       T  D         R+++   V L ++ N   ++E  +         + +N+S+V S                           A++   W +  +   +  +    G       I  +FA P  R+A+    D M   +LP   L  N++E +                     +  +A ++SSI++VC+S+A++ S   ++ AEY          K I P+++Q   KP GW+
Sbjct:   44 SDLRSMYETGKQLSRAYFDCHAYRAELAQHLTNCEYPAFASKMMKKLNNMGVFKNDDIWFSSFYFYNTTWNFSDTWPEFATSLATAGLPNLLNLNIGHQPYLENLSSKNVYYLIKASLSIIHNIARVPGNTHYFASDSVRQALLHLAQREEEFLRCVSTLCLAHIITESETHLVTDTSSGGIDLS-RILFSYINSARVSEKRRCHGFQVIELLGALSAFSVHDPVKPSLIQ-GTFSASGTGATTNADHGATCVGLLRDLI--EVALLNSPNAVTLREAEEAIRILWNLTFDSNESSVTSHHQLKTWLAEVTANPAVSTQLTKAMLRALEAAQWKLNHVPPAAHHDPTDFGP------ILFSFA-PSNRLAVSRIADRMRESSLPVANLPFNNNEIIALPEANAVGLSMCACSTGSQTQWLEAVEQSSILVVCLSDAYRLSPGCRMEAEYFMSTGTDAHPKPIVPIVLQPKLKPTGWL 509          
BLAST of TIR domain-containing protein vs. TrEMBL
Match: A0A4E0S2W0 (TIR domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_001036 PE=4 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 5.453e-49
Identity = 136/471 (28.87%), Postives = 231/471 (49.04%), Query Frame = 1
Query:  139 NDLVTLHKAGKQLTSLYFDCKTHRLILSEHLIKIEFLEYAVKTLKQLNNLGVFQNDDIWFASFYLYNLCWNYSTINPEFGSGLMLCGIESLLISNITHDPYINNLSKRNVNYLISATLSIMNNILKTPGYRLIFSTENVIKGLIKISKFDDK-IAVLCTMCLSYIATNDN---IKSTSDFDIFYNVKVLFYCIDRALETDGKY-NNYTVYEFFEVLKFASLSNNQKDAIVNLDGFNIMIEQLNTTKDERVK-----REIL-------FTLVNLCDAENGNKIKEIADFYSTNKSNVISSAVKTLSWFMEILEQKS-------------KQNNNKLGKISRKKN--------IFINFAKPDERMAMKIFTDLMNGPNLP---LIINDDEDV--------------------DKLRQAYDKSSIIIVCVSEAFKNSINLKVGAEY-----ISLKNKIIFPVLIQNNYKPEGWI 1353
            +DL ++++ GKQL+  YFDC  +R  L++HL   E+  +A K +K+LNN+GVF+NDDIWF+SFY YN  WN+S   PEF + L   G+ +LL  NI H PY+ NLS +NV YLI A+LSI++NI + PG    F++++V + L+ +++ +++ +  + T+CL++I T      +  TS   I  + ++LF  I+ A  ++ +  + + V E    L   S+ +  K +++    F+       T  D         R+++        + V L +AE   +I     F S   S      +KT  W  E+    +             +    KL  +    +        I  +FA P  R+A+    D M   +LP   L  N++E +                     +  +A ++SS+++VC+S+A++ S   ++ AEY          K I P+++Q   KP GW+
Sbjct:   44 SDLRSMYETGKQLSRAYFDCHAYRAELAQHLTNCEYPAFASKMMKKLNNMGVFKNDDIWFSSFYFYNTTWNFSDTWPEFATSLATAGLPNLLNLNIGHQPYLENLSSKNVYYLIKASLSIIHNIARVPGNTHYFASDSVRQALLHLAQREEEFLRCVSTLCLAHIITESETHLVTDTSSGGIDLS-RILFSYINSARVSEKRRCHGFQVIELLGALSAFSVHDPVKPSLIQ-GTFSASGTGATTNADHGATCVGLLRDLIEVALLNSPSAVTLREAEEAIRILWNLTFDSNESSATSHHQLKT--WLAEVTANPAVSTQLTKAILRALEAAQWKLNHVPPAAHHDPTDCGPILFSFA-PSNRLAVSRIADRMRESSLPVANLPFNNNEIIALPEANAVGLSMCACSTGSQTQWLEAVEQSSVLVVCLSDAYRLSPGCRMEAEYFMSTGTDAHPKPIVPIVLQPKLKPTGWL 509          
BLAST of TIR domain-containing protein vs. TrEMBL
Match: A0A0R3WQA6 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS2931 PE=4 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 2.379e-48
Identity = 141/476 (29.62%), Postives = 223/476 (46.85%), Query Frame = 1
Query:  142 DLVTLHKAGKQLTSLYFDCKTHRLILSEHLIKIEFLEYAVKTLKQLNNLGVFQNDDIWFASFYLYNLCWNYSTINPEFGSGLMLCGIESLLISNITHDPYINNLSKRNVNYLISATLSIMNNILKTPGYRLIFSTENVIKGLI-KISKFDDKIAVLCTMCLSYIATNDNIKSTSDF---DIFYNVKVLFYCIDRALETDG----KYNNYTVYEFFEVLKFASLSNNQKDAI----VNLDGFNIMIEQLNTTKDE------------RVKREILFTLVNLC-DAENGNKIKEIADFYSTNKSNVISSAVKT--LSWFMEILEQKSKQNNNKL-GKISRKKNIF-INFAKPDERMAMKIFTDLMNGPNLPLIINDDEDVD----------------------KLRQAYDKSSIIIVCVSEAFK-----------------NSINLKVGAEYISLKNKIIFPVLIQNNYKPEGWIKDFI 1365
            DL ++++ GKQL+ LYFDC  +R+ L+E+L  +E+  +A K +K+LNN+GVF+ND+IWF+SFY YN  WN+S I P+F + L   G+ +LL  NI H PY++NL  +NV YL+ A+LSI++NI + PG    FST++V   L  K  + ++ +  +  +CL+YI  +++    + F       N  VL   +D  +        + + + V E    +   +++++ K  I    VN  G  I I QL     E            R   E +  L NL  D    N   E+        S+ I     +   S   + LE  S +    L   +S  + +F I+FA P  RMA     + +    LP+   +  D D                        R+  + +S+I+VC SEA++                  S N+  G   I   ++ I PV +Q  YKP GW+ D +
Sbjct:   45 DLRSMYETGKQLSRLYFDCHQYRVDLAEYLTSLEYPAFASKMMKKLNNMGVFKNDNIWFSSFYFYNTTWNFSEIWPDFATALANAGLPNLLNLNIGHQPYLDNLPSKNVYYLVKASLSIIHNIARVPGNVHCFSTDSVKSALTNKFLREEEFLRCISDLCLAYIVNDNDTNLMTQFINGAPPNNSSVLQGLVDHVVTAKASEKRRCHGFQVSELMSAIATLAVNDSIKPDILSVSVNQAGERITITQLAKEAIEAATQSTPSLMVIREAEEAVRLLWNLSLDPRAPNPSSELNSLIGNWLSSFIKEGKTSSLPSHLAKALEAVSARLTIPLPASVSPGQGVFLISFA-PVNRMAAVKIAERLQAAGLPVSTLESPDSDNALPDSSAVGMSGTYSVATSFPHWRKMIESASVIVVCASEAYRLSPGCRYEIESVRPGLTTSNNIPGGDSSIKQPSRYILPVYLQPKYKPSGWLGDLL 519          
BLAST of TIR domain-containing protein vs. TrEMBL
Match: A0A075A0F8 (TIR domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_02093 PE=4 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 5.661e-48
Identity = 137/474 (28.90%), Postives = 239/474 (50.42%), Query Frame = 1
Query:  130 GVEN--DLVTLHKAGKQLTSLYFDCKTHRLILSEHLIKIEFLEYAVKTLKQLNNLGVFQNDDIWFASFYLYNLCWNYSTINPEFGSGLMLCGIESLLISNITHDPYINNLSKRNVNYLISATLSIMNNILKTPGYRLIFSTENVIKGLIKISKFDDK-IAVLCTMCLSYIATNDN---IKSTSDFDIFYNVKVLFYCIDRALETDGKY-NNYTVYEFFEVLKFASLSNNQKDAIVNL----------DGFNIMIEQLNTTKDERVKREILFTLVNLCDAENGNKIKEIADFYSTNKSNVISSAVKTLSWFMEILEQKSKQN-----------------NNKLGKISRKK-----NIFINFAKPDERMAMKIFTDLMNGPNLPL---------IINDDEDVDKLR-------------QAYDKSSIIIVCVSEAFKNSINLKVGAEYI-----SLKNKIIFPVLIQNNYKPEGWI 1353
            G+E+  DL ++++ GKQL+  YFDC T+R  L++HL   ++  +A K +K+LNN+GVF+NDDIWF+SFY YN  WN+S   P+F + L   G+ +LL  NI H PY+ NLS +NV YLI A+LSI++NI + PG    F++E+V + L+ +++ +++ +  + T+CL++I T      I  TS   I    +VLF  I+ A  ++ +  + + V E    L   S+ +  K  +V++          D  +  I  L    D  V      + V++ +AE   +I       +T+ ++   + +KT  W  E+L   +  N                  + +  + R +     ++  +FA P  R+A+    D +   NLP+         I   +  +  L              +  D+S+I++VC+S+A++ S   ++ AEY       ++ + I P+++Q   KP GW+
Sbjct:   39 GLEDMSDLRSMYETGKQLSRAYFDCHTYRAELAQHLTNCDYPAFASKMMKKLNNMGVFKNDDIWFSSFYFYNTTWNFSDTWPDFATALAAAGLPNLLNLNIGHQPYLENLSSKNVYYLIKASLSIIHNIARVPGNTHYFTSESVRQALLHLAQREEEFLRCVSTLCLAHIVTESEAHLIMDTSSGGIDLP-RVLFGYINSARVSEKRRCHGFQVIELLSALSAFSVHDTVKANLVSISIPPTGGPTSDQGSACISLLKDLIDAAVHPSP--STVSIKEAEEAIRILWNLTVETTSLTSSTQNQMKT--WVGEVLNNPAVPNLFTKAMIRALEAIHWKLCHTVPAVIRDEPAECGSVLFSFA-PSNRVAVSRVADRLREANLPISNVPFVSESIALSEASLVGLSMCACNTATRTQWLECIDQSTIMVVCLSDAYRLSPGCRLEAEYFISTGSDIRPRPIIPIVLQPKLKPTGWL 506          
BLAST of TIR domain-containing protein vs. TrEMBL
Match: A0A4S2LNJ2 (TIR domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007272 PE=4 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 1.966e-47
Identity = 134/476 (28.15%), Postives = 241/476 (50.63%), Query Frame = 1
Query:  130 GVEN--DLVTLHKAGKQLTSLYFDCKTHRLILSEHLIKIEFLEYAVKTLKQLNNLGVFQNDDIWFASFYLYNLCWNYSTINPEFGSGLMLCGIESLLISNITHDPYINNLSKRNVNYLISATLSIMNNILKTPGYRLIFSTENVIKGLIKISKFDDK-IAVLCTMCLSYIATNDNIK-----STSDFDIFYNVKVLFYCIDRALETDGKY-NNYTVYEFFEVLKFASLSNNQKDAIVNL----------DGFNIMIEQLNTTKDERVKREILFTLVNLCDAENGNKIKEIADFYSTNKSNVISSAVKTLSWFMEILEQKSKQN-----------------NNKLGKISRKK-----NIFINFAKPDERMAMKIFTDLMNGPNLPL---------IINDDEDVDKLR-------------QAYDKSSIIIVCVSEAFKNSINLKVGAEYI-----SLKNKIIFPVLIQNNYKPEGWI 1353
            G+E+  DL ++++ GKQL+  YFDC T+R  L++HL   ++  +A K +K+LNN+GVF+NDDIWF+SFY YN  WN+S   P+F + L   G+ +LL  NI H PY+ NLS +NV YLI A+LSI++NI + PG    F++E+V + L+ +++ +++ +  + T+CL++I T          S+   D+   ++VLF  I+ A  ++ +  + + V E    L   S+ +  K  +V++          D  +  I  L    D  V      + V++ +AE   +I       +++ ++   + +KT  W  E+L   +  N                  + +  + R++     ++  +FA P  R+A+    D +   NLP+         I   +  +  L              +  D+S+I++VC+S+A++ S   ++ AEY       ++ + I P+++Q   KP GW+
Sbjct:   39 GLEDMSDLRSMYETGKQLSRAYFDCHTYRAELAQHLTSCDYPAFASKMMKKLNNMGVFKNDDIWFSSFYFYNTTWNFSDTWPDFATALAAAGLPNLLNLNIGHQPYLENLSSKNVYYLIKASLSIIHNIARVPGNTHYFTSESVRQALLHLAQREEEFLRCVSTLCLAHIITESEAHLIMDTSSGGIDL---LRVLFGYINSARVSEKRRCHGFQVIELLCALSALSVHDTVKANLVSISIPPTGGPTSDQGSACISLLKDLIDAAVHPSP--SAVSIKEAEEAIRILWNLTVETSSLTSSTQNQMKT--WVGEVLNNPAVPNLFTKAMVRALEAIHWKLCHTVPAVIREEPAECGSVLFSFA-PSNRVAVSRVADRLREANLPISNVPFVSESIALPEASLVGLSMCACNTATRTQWLECIDQSAIMVVCLSDAYRLSPGCRLEAEYFISTGSDIRPRPIIPIVLQPKLKPTGWL 506          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO41008 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5P1])

HSP 1 Score: 74.7146 bits (182), Expect = 6.948e-14
Identity = 101/485 (20.82%), Postives = 214/485 (44.12%), Query Frame = 1
Query:  445 NNLSKRNVNYLISATLSIMNNILKTPGYRLIFSTENVIKGLIKISKFDDKIAVL-CTMCLSYIA--TNDNIKSTSDFDIFYNVKVLFYCIDRALETDGKYNNYTVYEFFEVLKFASLSNNQKDAIVNLDGFNIMIEQLNTTKDERVKREILFTLVNLC-DAENGN-------KIKEIADFYSTNKSNVISSAVKTLSWFMEILEQKSKQNNNKLGKISRKKN------IFINFAKPDERMAM------------KIFTDL--MNGPNLPLIINDDEDVDKLRQAYDKSSIIIVCVSEAFKNSINLKVGAEYISLKNKIIFPVLIQNNYKPEGWIK---------DF--------IYQVSDVCYNFTQCFEENMDKFLVALNSQLTALKAECKEAVKESPPIKA-VVQAARES--KPCNISQWLIEHDLSHLQA--KMINISMELLCYMRKIRSEAPDFYFRSLQDSLKL-NFVEIIQFSAALDEL 1737
            ++ S+R    L+S  L  ++N+ + P  +  F   N +K L+   K      V+   +CL+Y+    N+++    +  I + +++L   I    ++  ++  +  +E    +   + ++  K  I   DG +I+   +   K++  +   L  L  L  D EN          +  + +   +    V  +AV  L W +E             GK+ R +N      I I++ + D + AM            K++ D+  M G  L          + + +A + +S+I++ +S+ +++S N +  AEY   + K I P++++ +Y+P+GW+          DF        ++ + ++ YN T   ++  D   V   + +++   +     ++ PP    VV     S  K  ++++WL +  LS      K ++ SM +L Y  +++ E+P+FY+ S++  +     +E++QF+  L +L
Sbjct:  805 DDFSRRG--ELLSHVLGALHNLSRRPAVKRFFEESNGVKHLLLFMKCGVTYFVMNALLCLAYLVDERNNDLIMADEEPITFLLRMLSSAIS---DSRRQHLGFAAWEIACGIGRVASNDKNKRLIGRHDGVSILSTLVKEAKNDAERVYGLQALYMLSFDGENKKILCKDKATVNLLRNLKQSGHKEVQKAAVGIL-WEIE-------------GKVGRDRNEDSQQHIMISY-QWDNQKAMLAVNKRLKEAGHKVWMDVEQMGGSTL----------EAMARAVENASVILIAMSQRYQDSPNCRSEAEYAFQRRKKIVPLMMEQDYRPDGWLGMILGAKLWMDFRESVDTGIVHLMKELQYNQTAALQQPHDPVTVDTTTVISSPPDK-----EDGPPGPTDVVDRPDVSKWKKEDVAKWLSDIGLSSSNKVRKKLDGSMLILLY--RLKQESPEFYYASVKKDMDFPTVIEVLQFTEELRKL 1252          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO33720 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRG5])

HSP 1 Score: 54.299 bits (129), Expect = 1.172e-9
Identity = 19/57 (33.33%), Postives = 39/57 (68.42%), Query Frame = 1
Query: 1183 VDKLRQAYDKSSIIIVCVSEAFKNSINLKVGAEYISLKNKIIFPVLIQNNYKPEGWI 1353
            ++ +  A + S+++++C S  +K+S+N +  AEY   + K I P++++N YKP+GW+
Sbjct:    6 LEAMANAVENSAVVLMCASRKYKDSVNYRSEAEYAYTQKKPIVPLMMENGYKPDGWL 62          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO45030 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU69])

HSP 1 Score: 56.6102 bits (135), Expect = 2.265e-8
Identity = 93/464 (20.04%), Postives = 210/464 (45.26%), Query Frame = 1
Query:  475 LISATLSIMNNILKTPGYRLIFSTENVIKGLI-----KISKFDDKIAVLCTMCLSYIA--TNDNIKSTSDFDIFYNVKVLFYCIDRALETDG-KYNNYTVYEFFEVLKFASLSNNQKDAIVNLDGFNIMIEQLNTTKDERVKR---EILFTLVNLCDAEN-------GNKIKEIADFYSTNKSNVISSAVKTLSWFMEILEQKSKQNNNKLGKISRKKNIFINF---AKPD--------ERMAMKIFTDL--MNGPNLPLIINDDEDVDKLRQAYDKSSIIIVCVSEAFKNSINLKVGAEYISLKNKIIFPVLIQNNYKPEGWIKDFIYQVSDVCYNFTQCFEENMDKFLVALNSQLTALKAECKEAVKESPPIKAVVQAARESKP-CNISQWLIEHDLSHLQA---KMIN-------ISMELLCYMRKIRSEAPDFYFRSL-QDSLKLNFVEIIQFSAALDEL 1737
            +++  +  M+N+ +    R  F   + +K L+     ++S+F    A    + L+Y+   +N+++   S+  I +    L + + ++  ++  +Y  +T  E  E L   +++++ K  I       I+++ L   K++  +R   E L+ L    D EN        N ++ + +   +   +V  +A   L W +E  E  + + +     +  + ++ I++    +P         +    +++ DL  M G  L  + N          A + + ++++CVS+ +K S N +  AEY     K I P++++ +Y+P+GW+   +   + +  +F+      +D     L  ++  ++   +  V ES  + AV     +  P  +IS+W  +  ++ +     ++ N       +S +LL  + K+RSE+P+F++ S+ QD    +  E++ F   L++L
Sbjct:  392 ILNTAMGTMHNLSRRIPCRQYFKKADTVKVLLPMLNDEVSQF----AAKALLILAYLTDESNNSLIMASEEPIQF----LIHILSKSCSSNSNRYLGFTNSELAEGLSQIAVNDSNKKLIGQHGAIPILVDMLANAKNDEQRRCGAEALWVLA--FDNENKEAILTTPNAVELLKELQHSEDDSVKKAAAGVL-WEIEGKESHTVKESTADEPL--RNHVMISYQWDVQPTMIQVKSKLQAAGYRVWMDLEQMGGSTLQAMAN----------AVENAEVVLMCVSQKYKESPNCRSEAEYAFQLRKDIVPLMMEKSYRPDGWLG--MIMGAKLWIDFSDKQTLRVDDSFEKLQKEI-GMRGRGRGNVVESKLV-AVQHDVVDVFPKIDISKWSKDDVMNWMNGFGLRLGNDSTIASHLSGKLLQRLAKLRSESPEFFYSSVKQDFGFAHLQEVLLFVDELNKL 828          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000006301.1 (SMESG000006301.1)

HSP 1 Score: 1147.88 bits (2968), Expect = 0.000e+0
Identity = 563/567 (99.29%), Postives = 565/567 (99.65%), Query Frame = 1
Query:   40 MNEIPCSYPEIGKNEALKLSHDLCHILLACGVENDLVTLHKAGKQLTSLYFDCKTHRLILSEHLIKIEFLEYAVKTLKQLNNLGVFQNDDIWFASFYLYNLCWNYSTINPEFGSGLMLCGIESLLISNITHDPYINNLSKRNVNYLISATLSIMNNILKTPGYRLIFSTENVIKGLIKISKFDDKIAVLCTMCLSYIATNDNIKSTSDFDIFYNVKVLFYCIDRALETDGKYNNYTVYEFFEVLKFASLSNNQKDAIVNLDGFNIMIEQLNTTKDERVKREILFTLVNLCDAENGNKIKEIADFYSTNKSNVISSAVKTLSWFMEILEQKSKQNNNKLGKISRKKNIFINFAKPDERMAMKIFTDLMNGPNLPLIINDDEDVDKLRQAYDKSSIIIVCVSEAFKNSINLKVGAEYISLKNKIIFPVLIQNNYKPEGWIKDFIYQVSDVCYNFTQCFEENMDKFLVALNSQLTALKAECKEAVKESPPIKAVVQAARESKPCNISQWLIEHDLSHLQAKMINISMELLCYMRKIRSEAPDFYFRSLQDSLKLNFVEIIQFSAALDELK 1740
            MNEIPCSYPEIGKNEALKLSHDLCHILLACGVENDLVTLHKAGKQLTSLYFDCKTHRLILSEHLIKIEFLEYAVKTLKQLNNLGVFQNDDIWFASFYLYNLCWNYSTINPEFGSGLMLCGIESLLISNITHDPYINNLSKRNVNYLISATLSIMNNILKTPGYRLIFSTENVIKGLIKISKFDDKI+VLCTMCLSYIATNDNIKSTSDFDIFYNVKVLFYCIDRALETDGKYNNYTVYEFFEVLKFASLSNNQKDAIVNLDGFNIMIEQLNTTKDERVKREILFTLVNLCDAENGNKIKEIADFYSTNKSNVISSAVKTLSWFMEILEQKSKQNNNKLGKISRKKNIFINFAKPDERMAMKIFTDLMNGPNLPLIINDDEDVDKLRQAYDKSSIIIVCVSEAFKNSINLKVGAEYISLKNKIIFPVLIQNNYKPEGWIKDFIYQVSDVCYNFTQCFEENMDKFLVALNSQLTALKAECKEAVKE P IKAVVQAARESKPCNISQWLIEH+LSHLQAKMINISMELLCYMRKIRSEAPDFYFRSLQDSLKLNFVEIIQFSAALDELK
Sbjct:    1 MNEIPCSYPEIGKNEALKLSHDLCHILLACGVENDLVTLHKAGKQLTSLYFDCKTHRLILSEHLIKIEFLEYAVKTLKQLNNLGVFQNDDIWFASFYLYNLCWNYSTINPEFGSGLMLCGIESLLISNITHDPYINNLSKRNVNYLISATLSIMNNILKTPGYRLIFSTENVIKGLIKISKFDDKISVLCTMCLSYIATNDNIKSTSDFDIFYNVKVLFYCIDRALETDGKYNNYTVYEFFEVLKFASLSNNQKDAIVNLDGFNIMIEQLNTTKDERVKREILFTLVNLCDAENGNKIKEIADFYSTNKSNVISSAVKTLSWFMEILEQKSKQNNNKLGKISRKKNIFINFAKPDERMAMKIFTDLMNGPNLPLIINDDEDVDKLRQAYDKSSIIIVCVSEAFKNSINLKVGAEYISLKNKIIFPVLIQNNYKPEGWIKDFIYQVSDVCYNFTQCFEENMDKFLVALNSQLTALKAECKEAVKEGPIIKAVVQAARESKPCNISQWLIEHELSHLQAKMINISMELLCYMRKIRSEAPDFYFRSLQDSLKLNFVEIIQFSAALDELK 567          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000058865.1 (SMESG000058865.1)

HSP 1 Score: 242.276 bits (617), Expect = 5.525e-71
Identity = 161/496 (32.46%), Postives = 275/496 (55.44%), Query Frame = 1
Query:   49 IPCSYPEIGKNEALKLSHDLCHILLACGVENDLVTLHKAGKQLTSLYFDCKTHRLILSEHLIKIEFLEYAVKTLKQLNNLGVFQNDDIWFASFYLYNLCWNYSTINPEFGSGLMLCGIESLLISNITHDPYINNLSKRNVNYLISATLSIMNNILKTPGYRLIFSTENVIKGLIK-ISKFDDKIAVLCTMCLSYIATND------NIKSTSDFDIFYNVKVLFYCIDRALETDGKYNNYTVYEFFEVLKFASLSNNQKDAIVNLDGFNIMIEQLNTTKDERVKREILFTLVNLCD-----------AENGNKIKEIADFYSTNKSNV-ISSAVKTLSWFMEILEQKSKQNNNKLGKISRKKNIFINFAKPDERMAMKIFTDLMNGPNLPLIINDD--EDVDKLRQAYDKSSIIIVCVSEAFKNSINLKVGAEYISLKNKIIFPVLIQNNYKPEGWIKDFI-YQVSDVCYNFTQCFEENMDKFLVALNSQLTALKAE 1470
            +P SY  +   EA     +   +  +     DL T+++AGKQL+ LYFDC  H+  L+E L+++EF EY +KT+K+LNN+GVF+NDDIWF+SFY YN+CWNYS  + EF + L LCG+ +LL  NI H PY++NLS RNV YLI A+LSI++NI + PG  + F +E+V   L+  I++ +D I V+ ++CL+ I   +      + +S    D+  +  ++ Y         G++  +  YE  + ++ A+    +K   ++LDG  ++ E L   K   ++ ++   L  LC+            E+G     I  F   N  NV I +A +   W +EI     +Q + ++  +++   ++I++A  +    +KI  D +   N+   I+ D   + + +++   KS+++I+CVSEAFK+    ++  E+    +K I P+LIQ  Y+PEGW++  I   +S    +  + FE + + F+ +L+ +L  +K E
Sbjct:   18 VPQSYKGMTLEEARVFLRNTMDLFQSLSSMTDLKTMYEAGKQLSRLYFDCANHQRELAEILLELEFPEYTIKTMKKLNNMGVFKNDDIWFSSFYFYNICWNYSDASFEFATALALCGLPNLLNLNIGHKPYLDNLSSRNVYYLIKASLSIIHNICRFPGSCIYFRSESVKSSLLNLINREEDFIRVVASLCLASIVGENEPHLLRDDESDERPDVMQS--IMGYIRKARNSERGRFMGFRSYELLQGIRSATTVECEKRHFIDLDGITLLKESL-INKSVVIEEDVAECLEILCNLNVNKEIQYKLVESGLDGTTIGQF--VNHENVRIRTASQDYLWSLEIDSTNPEQFHEEM-DLNKPLPVYISYASINRFSVLKI-RDRLADANIVRFIDSDVRSNGEMVKKTIGKSALVIICVSEAFKSHPRYQLEVEFCERIHKPIVPLLIQQKYRPEGWLQRAIDRDLSVFDLSSKRDFEASWETFITSLSGKLKEIKLE 506          

HSP 2 Score: 62.3882 bits (150), Expect = 7.961e-10
Identity = 30/87 (34.48%), Postives = 55/87 (63.22%), Query Frame = 1
Query: 1477 EAVKESPPIKAVVQAARESKPCNISQWLIEHDLSHLQAKMINISMELLCYMRKIRSEAPDFYFRSLQDSLKLNFVEIIQFSAALDEL 1737
            E+V  S   ++V   A  +    +  WL  +DLSHL+ K+  ++ +LL Y + ++  AP++++++L+  LKL FV+I++FS A+D L
Sbjct:  585 ESVPHSGAGESVDSVAGAAGENLVHAWLDSNDLSHLRPKLTWLNTKLLHYYQNVKKNAPEYFYQTLEKHLKLEFVDILKFSNAIDHL 671          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000017428.1 (SMESG000017428.1)

HSP 1 Score: 235.343 bits (599), Expect = 1.569e-68
Identity = 171/634 (26.97%), Postives = 304/634 (47.95%), Query Frame = 1
Query:  139 NDLVTLHKAGKQLTSLYFDCKTHRLILSEHLIKIEFLEYAVKTLKQLNNLGVFQNDDIWFASFYLYNLCWNYSTINPEFGSGLMLCGIESLLISNITHDPYINNLSKRNVNYLISATLSIMNNILKTPGYRLIFSTENVIKGLIKI-SKFDDKIAVLCTMCLSYIATNDN----IKSTSDF-----DIFYNVKVLFYCIDRALETDGKYNNYTVYEFFEVLKFASLSNNQKDAIVNLDGFNIMIEQLNTTKDERVKREILFTLVN----------LCDAENGNKIKEIADFYSTNKSNVISSAVKTLSWFMEILEQKSKQNNNKLGKI-------------SRKKNIFINFAKPDERMAMKIFTDLMNGPNLPLIINDDEDVDKLRQAYD-------KSSIIIVCVSEAFKNSINLKVGAEYISLKNKIIFPVLIQNNYKPEGWIKDFIYQVSDVCYNF--TQCFEENM-------------DKFLVALNSQLTA---------LKAECKEAVKES-------------------PPIKAVVQAARESKPCNIS------------------QWLIEHDLSHLQAKMINISMELLCYMRKIRSEAPDFYFRSLQDSLKLNFVEIIQFSAALDEL 1737
            NDL  +++ GKQL+ LYFDC   R IL   LIK+EF E+ VK +K+LNN+G+F++DDIWF+SFY YN+CWNYS  + EF + L    + SL++ N+ H PY+ NLS RN+ +LI A+LSIM+N+ + PG R +F ++ V   LI   S+ ++ I V+  +CL+++  +D     IK  ++F     DI    K         L   G++  +  +E  + L   S +++ K AIV+  G  ++ + L    +    RE L  + N          L    NG    +I D +  ++   + +    + W +E        ++ K G++             S   ++++ FA+ +  +  KI  D +   NL L++  + +++   +  +       +S++ +  +SEA K+    +   +Y +   K I PV++Q  +KP GW++ F      + ++F   + FE N+             D+ L +++S  +A         L   C+  +  S                   PP+        E  P  +S                  +WL+  DLSHL+ K+   +  +L  + +I+ EAP+++++ L++ L+L+F++ + F  AL +L
Sbjct:   54 NDLKNIYEMGKQLSRLYFDCAEFRPILCAKLIKLEFPEFVVKMMKKLNNMGIFKHDDIWFSSFYFYNICWNYSESSFEFATALSNASLPSLIVMNLLHKPYLENLSSRNIYFLIKASLSIMHNLCRYPGNRFMFKSDKVKDALIDFTSREEELIRVISILCLAFLLEDDEAGVLIKQWNNFTFNFIDIITKAK---------LHDRGRFMGFATWELLQALTIFSSNDSVKKAIVDSKGLLMVFDILGKASNVEEVRECLMIVWNFSFDNDLKSVLIKQHNG---LQIVDNFINHEDEDVRNCAAGIKWLLE--------DHMKSGRLLTEIVPSQPAPVNSSGFHLYVCFAEENREIVQKI-VDRLKRANLTLVLPKNSNIESALKNQENRFRGIVQSTLFLFVLSEASKSCQQCRSETQYAAYLKKPIIPVIVQTKFKPSGWMEKF---TDKLFFDFGGKRDFEANIELLKNTLLSECMNDEDLKSVHSMKSANSRPEIIAQLPVNCRLQLGHSMDSAHRHHFNHSASLNSTQPPLLDSTDQLPELVPNKVSSNMSSLESIKKWSKEEVTEWLVSSDLSHLRLKLSKFNGAMLASLLEIKREAPEYFYKCLEEKLELHFMDTLAFIDALHKL 663          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000015387.1 (SMESG000015387.1)

HSP 1 Score: 175.637 bits (444), Expect = 2.681e-47
Identity = 140/562 (24.91%), Postives = 281/562 (50.00%), Query Frame = 1
Query:  154 LHKAGKQLTSLYFDCKTHRLILSEHLIKIEFLEYAVKTLKQLNNLGVFQNDDIWFASFYLYNLCWNYSTINPEFGSGLMLCGIESLLISNITHDPYINNLSKRNVNYLISATLSIMNNILKTPGYR---LIFSTENVIKGLIKISKFDDKIAVLCTMCLSYIATNDNIKSTSDFDIFYNVKVLFYCIDRALETDG-KYNNYTVYEFFEVLKFASLSNNQKDAIVNLDGFNIMIEQL-NTTKDERVKREILFTLVNLC-DAE------NGNKIKEIADFYSTNKSNVISSAVKTLSWFM-EILEQKSKQNNNKLGKISRKK-----NIFINFAKPDERMAMKIFTDLMNGPNLPLIINDDE----DVDKLRQAYDKSSIIIVCVSEAFKNSINLKVGAEYISLKNKIIFPVLIQNNYKPEGWIKDFIYQVSDVCYNFT--QCFEENMDKFLVALNSQLTALKAECKEAVKESPPIKAVVQAARESKPCNIS----------QWLIEHDLSHLQAKMINISMELLCYMRKIRSEAPDFYFRSLQDSLKLNFVEIIQFSAALDEL 1737
            ++K  K ++  YFD K+H   LS  L+ ++++      + + +  G F NDD+WFA++Y  N  WNY     E  + +++  +   LI+N+ H PY++N+   N+ YLI A++SI++NI++ PG      I   +NV+ GLIK +   D I ++  + LS +     +    +     ++K L   I  A E D  K N + ++E    LK  S ++N K  IV  +G  ++ + L N T D  +++  L  L NLC D +      N   +K   + +  +K + I      + W + E ++ K +  +  L K+   K     ++FI++   +++M + I  D +   N+ + I+ D+     ++ +    + S+I I+ +SEA++ S N +  AEY    NK I P++++  YKP  W+   I   S + Y F+  + FEE++   L  +N+ +  ++ +    +          Q++    P  +S          +WL+++ L H++++ +N   +LL  +  +++++  +   +L+    + F+++++  +A++E+
Sbjct:   41 IYKIFKGISQSYFDLKSHLNALSNVLLNLKYVSITSNYVGKFSKEGYFVNDDVWFATYYALNSLWNYCDGFQEIANEIVVTDLPQYLIANLLHRPYLDNMKNTNIFYLIKASISIIHNIVRCPGNEEKFQIIELKNVLVGLIKRND-SDFIVLISMLTLSCLVNESELHLLDEGK--NSIKALIMKIRTAFENDSKKVNGFAIWELVNGLKCVSANDNVKKTIVTENGIKLIFDILKNPTCDNDIEK-CLGVLWNLCFDKDIKAILVNDFDLKLFINRFKNHKLSTIKRCYNGILWLIDEKIQSKERILSAHLSKVKASKTHWKFDVFISYCWANKQMVLSI-RDFLVQSNIKIWIDLDQMKGSTLEAMADGIENSNIFIMAISEAYRTSPNCRTEAEYAFSLNKPIIPLIVEMKYKPTSWLG--IIMGSKMYYEFSKRRNFEESIHSLLANVNTIIQNVERKIVTEIIVPVAQNESYQSSDGGTPKILSVHSWSNKIVEKWLVKNGLGHVKSRFMNFDGKLLFSLIDVKNKSRKYLIDALKVEYGMKFIDLLKLHSAINEI 595          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000047638.1 (SMESG000047638.1)

HSP 1 Score: 172.555 bits (436), Expect = 1.490e-46
Identity = 140/558 (25.09%), Postives = 272/558 (48.75%), Query Frame = 1
Query:  199 KTHRLILSEHLIKIEFLEYAVKTLKQLNNLGVFQNDDIWFASFYLYNLCWNYSTINPEFGSGLMLCGIESLLISNITHDPYINNLSKRNVNYLISATLSIMNNILKTPGYRLIFSTENVIKGLIKISKFDDK--IAVLCTMCLSYIATNDNIKSTSDFDIFYNVKVLFYCIDRALETDGKY-NNYTVYEFFEVLKFASLSNNQKDAIVNLDGFNIMIEQLNTTKDERVKREILFTLVNLC-DAENGNKIKE--IADF--------YSTNKSNVISSAVKTLSWFMEILEQKSKQN-------NNKLGKISRKKNIFINFAKPDERMAMKIFTDLMNGPNLPLIINDDEDVDKLR--------QAYDKSSIIIVCVSEAFKNSINLKVGAEYISLKNKIIFPVLIQNNYKPEGWIKDFIYQVSDVCYNFTQCFEENMDKFLVALNSQLTALKAECKEAV--KESPP-------IKAVVQAARE-----SKPCN--ISQWLIEHDLSHLQAKMINISMELLCYMRKIRSEAPDFYFRSLQDSLKLNFVEIIQFSAALDEL 1737
            KTH+  +   L+++ +       + + N++G F ND IWF+++Y  N  WNY   N E  + ++   + +LLISN+ H PY+ NL   NV Y++ A++SI++N+++  GY  IF  + + +GL+ +   +D   + ++  + L+ +   + +    +      + +L   I  A+E+  K  N ++++E    LK  S ++N K +IVN +G  ++++ +     +    + L  L NLC D E    IK+  I D+        + ++ S  I    + +SW +E  +  SKQ          K  K   K +IF++++  ++ + + I  +L+        IN   DVD+++           + S I ++ +SEA++ S N +  AEY     K I P++++  YKP  W+   +   S   Y F+     N ++ ++ L S +     + +  +  K   P       I+ V   + E     SK  N  + +WLI+H+L HL+ K  +    L+  M  + S++PDF + +L+    +  +++++F+ AL ++
Sbjct:    2 KTHQKAMGNELLRMNYASVIADVICKFNDVGFFNNDSIWFSTYYALNGFWNYCDSNQEIANSILNTKLPNLLISNVLHQPYVQNLKSTNVYYVMKASISIIHNVVRVAGYEGIFQNKELKEGLVGLIHINDSDFLGLVSILTLACLVKENELHLLEEGK--NTINLLIVQIRSAMESKTKRINGFSIWELVNGLKCVSANDNMKKSIVNENGIQLLLDIIEKPSCDDDIEKCLGVLWNLCFDKE----IKQTLIIDYKLSLLIKPFESHPSAKIKKCFEGISWLIEN-KSHSKQRLKSAQAFKLKANKDKWKFDIFLSYSWANKPIILAIRDELLKSK-----INVWIDVDQMKGSTLEAMADGIENSHIFVMAISEAYRTSPNCRTEAEYAFSLKKPIIPLIVELKYKPMSWLG--MIMGSKTYYEFSD--RRNFNESVIGLLSNINLFMNDTETIIVPKTDVPNEANHVEIRNVNTVSNEIRSEISKWTNKDVEKWLIKHNLEHLKIKFSSFDGRLINSMVDLNSKSPDFLYGNLKSEYGMKLIDVLKFNLALQQI 543          
The following BLAST results are available for this feature:
BLAST of TIR domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YCL93.098e-4928.09TIR domain-containing protein OS=Fasciola gigantic... [more]
A0A4E0S2W05.453e-4928.87TIR domain-containing protein OS=Fasciola hepatica... [more]
A0A0R3WQA62.379e-4829.62Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A075A0F85.661e-4828.90TIR domain-containing protein OS=Opisthorchis vive... [more]
A0A4S2LNJ21.966e-4728.15TIR domain-containing protein OS=Opisthorchis feli... [more]
back to top
BLAST of TIR domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO410086.948e-1420.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337201.172e-933.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO450302.265e-820.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TIR domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006301.10.000e+099.29SMESG000006301.1[more]
SMESG000058865.15.525e-7132.46SMESG000058865.1[more]
SMESG000017428.11.569e-6826.97SMESG000017428.1[more]
SMESG000015387.12.681e-4724.91SMESG000015387.1[more]
SMESG000047638.11.490e-4625.09SMESG000047638.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032258 ID=SMED30032258|Name=TIR domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1837bp
TTTTAAATTAACTTAATTAATTTTTCTTCAACAATAATTATGAATGAAAT
TCCTTGTTCCTATCCTGAAATTGGGAAAAATGAAGCTTTAAAATTATCTC
ATGATCTATGCCACATTTTATTGGCTTGTGGAGTAGAAAATGATTTAGTT
ACTTTACATAAAGCTGGCAAGCAATTGACTAGTCTTTATTTTGACTGCAA
AACCCACAGATTAATACTATCTGAGCATTTAATCAAAATAGAATTTTTAG
AATATGCTGTTAAAACGTTGAAACAGTTAAATAATTTAGGAGTATTTCAG
AATGATGATATATGGTTCGCTTCGTTCTATTTATATAATTTATGTTGGAA
TTATTCTACTATCAATCCAGAGTTTGGATCAGGATTAATGTTGTGTGGAA
TAGAATCTTTACTAATATCAAATATTACTCATGATCCCTACATTAATAAT
TTATCTAAACGAAATGTTAACTACTTAATTTCAGCAACATTGAGCATTAT
GAATAATATATTAAAAACTCCAGGATATCGTTTAATTTTTAGTACAGAAA
ATGTAATCAAAGGACTTATAAAAATATCTAAATTTGATGACAAAATTGCA
GTTCTTTGTACCATGTGTTTGTCATATATTGCAACTAATGACAATATTAA
AAGCACTTCGGATTTCGATATATTTTATAACGTTAAGGTTTTATTTTATT
GTATAGATCGAGCATTAGAAACAGATGGGAAGTATAATAATTATACTGTT
TATGAATTTTTTGAAGTTCTCAAATTTGCTTCTCTGTCAAACAACCAAAA
AGACGCCATTGTTAATCTTGATGGATTTAATATAATGATTGAACAACTAA
ATACAACCAAAGATGAGCGAGTAAAAAGAGAAATATTATTTACTTTAGTA
AATTTATGCGATGCCGAAAATGGAAATAAAATTAAAGAGATTGCTGATTT
TTATTCAACAAATAAGTCTAATGTAATTTCATCAGCCGTAAAAACTCTTT
CTTGGTTTATGGAGATTTTGGAACAAAAATCCAAACAAAATAACAACAAG
CTGGGTAAAATTTCCAGGAAAAAGAATATATTTATCAATTTTGCAAAGCC
GGATGAAAGAATGGCTATGAAAATTTTTACCGATTTAATGAATGGGCCGA
ATTTGCCGCTGATTATCAATGATGATGAAGACGTTGATAAACTGCGACAA
GCCTATGATAAATCCTCGATTATAATTGTTTGCGTTTCGGAGGCATTTAA
AAATTCCATCAATTTGAAAGTGGGAGCCGAATATATTTCGTTGAAAAATA
AAATCATTTTCCCGGTTTTGATTCAAAACAATTATAAACCGGAAGGCTGG
ATTAAGGATTTCATTTACCAAGTGTCCGATGTCTGTTATAATTTCACCCA
ATGTTTTGAGGAGAACATGGACAAATTTCTAGTTGCTTTGAACTCTCAAT
TGACTGCGTTGAAGGCAGAATGTAAGGAGGCCGTTAAGGAGAGCCCTCCA
ATTAAAGCAGTAGTACAAGCGGCAAGAGAGAGCAAACCTTGCAATATTTC
CCAATGGCTCATTGAACATGACTTGTCTCATTTACAGGCAAAAATGATTA
ATATTAGCATGGAGTTGTTATGTTACATGAGAAAAATCCGCTCAGAAGCT
CCAGATTTCTATTTCCGGTCTCTCCAGGACAGCCTAAAATTGAATTTTGT
GGAAATTATACAATTTTCGGCAGCATTGGACGAGTTGAAATAGGCCTGGG
ATTCGTCTGTGTTTAGATATATGTACAATCGATTTTTTACTGTTATTTTG
TAAAGCATTTTCAATTTAATAAATTTGTGTCTTCGCC
back to top

protein sequence of SMED30032258-orf-1

>SMED30032258-orf-1 ID=SMED30032258-orf-1|Name=SMED30032258-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=568bp
MNEIPCSYPEIGKNEALKLSHDLCHILLACGVENDLVTLHKAGKQLTSLY
FDCKTHRLILSEHLIKIEFLEYAVKTLKQLNNLGVFQNDDIWFASFYLYN
LCWNYSTINPEFGSGLMLCGIESLLISNITHDPYINNLSKRNVNYLISAT
LSIMNNILKTPGYRLIFSTENVIKGLIKISKFDDKIAVLCTMCLSYIATN
DNIKSTSDFDIFYNVKVLFYCIDRALETDGKYNNYTVYEFFEVLKFASLS
NNQKDAIVNLDGFNIMIEQLNTTKDERVKREILFTLVNLCDAENGNKIKE
IADFYSTNKSNVISSAVKTLSWFMEILEQKSKQNNNKLGKISRKKNIFIN
FAKPDERMAMKIFTDLMNGPNLPLIINDDEDVDKLRQAYDKSSIIIVCVS
EAFKNSINLKVGAEYISLKNKIIFPVLIQNNYKPEGWIKDFIYQVSDVCY
NFTQCFEENMDKFLVALNSQLTALKAECKEAVKESPPIKAVVQAARESKP
CNISQWLIEHDLSHLQAKMINISMELLCYMRKIRSEAPDFYFRSLQDSLK
LNFVEIIQFSAALDELK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR035897Toll_tir_struct_dom_sf
IPR011989ARM-like
IPR016024ARM-type_fold
IPR000157TIR_dom
Vocabulary: molecular function
TermDefinition
GO:0005488binding
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 464..484
NoneNo IPR availablePANTHERPTHR46270FAMILY NOT NAMEDcoord: 54..566
NoneNo IPR availablePANTHERPTHR46270:SF2coord: 54..566
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 27..349
e-value: 2.1E-8
score: 35.1
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 91..325
IPR035897Toll/interleukin-1 receptor homology (TIR) domain superfamilySUPERFAMILYSSF52200Toll/Interleukin receptor TIR domaincoord: 343..432