28S ribosomal protein S28, mitochondrial

Overview
Name28S ribosomal protein S28, mitochondrial
Smed IDSMED30032257
Length (bp)710
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 28S ribosomal protein S28, mitochondrial (SMED30032257) t-SNE clustered cells

Violin plots show distribution of expression levels for 28S ribosomal protein S28, mitochondrial (SMED30032257) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 28S ribosomal protein S28, mitochondrial (SMED30032257) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 28S ribosomal protein S28, mitochondrial (SMED30032257) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032257

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30032257h1SMcG0019762 SmedASXL_019226SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
parenchymal cellSMED30032257h1SMcG0019762 dd_Smed_v4_4981_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 28S ribosomal protein S28, mitochondrial vs. Ensembl Human
Match: MRPS28 (mitochondrial ribosomal protein S28 [Source:HGNC Symbol;Acc:HGNC:14513])

HSP 1 Score: 85.1149 bits (209), Expect = 7.717e-20
Identity = 43/95 (45.26%), Postives = 61/95 (64.21%), Query Frame = 1
Query:  355 KSFASLLRHSTLMQLGNCENFRATGVVFEIVDQDLYVDFGGKFYCVVEDNK--GALISRGTLVTIVVVDMEITSAFMLDKVATTVLEAEGFLLYV 633
            +SFAS+LRHS L Q+G  ++    G +F IV+ DLY+DFGGKF+CV    +  G    +GT V + ++D+E+TS F+     TTVLEA   LL +
Sbjct:   78 ESFASMLRHSPLTQMGPAKDKLVIGRIFHIVENDLYIDFGGKFHCVCRRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTVLEANAVLLGI 172          
BLAST of 28S ribosomal protein S28, mitochondrial vs. Ensembl Human
Match: MRPS28 (mitochondrial ribosomal protein S28 [Source:HGNC Symbol;Acc:HGNC:14513])

HSP 1 Score: 83.1889 bits (204), Expect = 1.261e-19
Identity = 43/95 (45.26%), Postives = 61/95 (64.21%), Query Frame = 1
Query:  355 KSFASLLRHSTLMQLGNCENFRATGVVFEIVDQDLYVDFGGKFYCVVEDNK--GALISRGTLVTIVVVDMEITSAFMLDKVATTVLEAEGFLLYV 633
            +SFAS+LRHS L Q+G  ++    G +F IV+ DLY+DFGGKF+CV    +  G    +GT V + ++D+E+TS F+     TTVLEA   LL +
Sbjct:   34 ESFASMLRHSPLTQMGPAKDKLVIGRIFHIVENDLYIDFGGKFHCVCRRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTVLEANAVLLGI 128          
BLAST of 28S ribosomal protein S28, mitochondrial vs. Ensembl Human
Match: MRPS28 (mitochondrial ribosomal protein S28 [Source:HGNC Symbol;Acc:HGNC:14513])

HSP 1 Score: 76.6406 bits (187), Expect = 1.764e-17
Identity = 39/90 (43.33%), Postives = 56/90 (62.22%), Query Frame = 1
Query:  370 LLRHSTLMQLGNCENFRATGVVFEIVDQDLYVDFGGKFYCVVEDNK--GALISRGTLVTIVVVDMEITSAFMLDKVATTVLEAEGFLLYV 633
            +LRHS L Q+G  ++    G +F IV+ DLY+DFGGKF+CV    +  G    +GT V + ++D+E+TS F+     TTVLEA   LL +
Sbjct:    1 MLRHSPLTQMGPAKDKLVIGRIFHIVENDLYIDFGGKFHCVCRRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTVLEANAVLLGI 90          
BLAST of 28S ribosomal protein S28, mitochondrial vs. Ensembl Human
Match: MRPS28 (mitochondrial ribosomal protein S28 [Source:HGNC Symbol;Acc:HGNC:14513])

HSP 1 Score: 64.3142 bits (155), Expect = 1.257e-12
Identity = 33/81 (40.74%), Postives = 49/81 (60.49%), Query Frame = 1
Query:  397 LGNCENFRATGVVFEIVDQDLYVDFGGKFYCVVEDNK--GALISRGTLVTIVVVDMEITSAFMLDKVATTVLEAEGFLLYV 633
            +G  ++    G +F IV+ DLY+DFGGKF+CV    +  G    +GT V + ++D+E+TS F+     TTVLEA   LL +
Sbjct:   30 MGPAKDKLVIGRIFHIVENDLYIDFGGKFHCVCRRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTVLEANAVLLGI 110          
BLAST of 28S ribosomal protein S28, mitochondrial vs. Ensembl Human
Match: MRPS28 (mitochondrial ribosomal protein S28 [Source:HGNC Symbol;Acc:HGNC:14513])

HSP 1 Score: 62.7734 bits (151), Expect = 3.316e-12
Identity = 33/79 (41.77%), Postives = 48/79 (60.76%), Query Frame = 1
Query:  397 LGNCENFRATGVVFEIVDQDLYVDFGGKFYCVVEDNK--GALISRGTLVTIVVVDMEITSAFMLDKVATTVLEAEGFLL 627
            +G  ++    G +F IV+ DLY+DFGGKF+CV    +  G    +GT V + ++D+E+TS F+     TTVLEA   LL
Sbjct:   30 MGPAKDKLVIGRIFHIVENDLYIDFGGKFHCVCRRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTVLEANAVLL 108          
BLAST of 28S ribosomal protein S28, mitochondrial vs. Ensembl Celegans
Match: mrps-28 (Mitochondrial Ribosomal Protein, Small [Source:UniProtKB/TrEMBL;Acc:Q9XWP0])

HSP 1 Score: 59.3066 bits (142), Expect = 8.715e-11
Identity = 36/105 (34.29%), Postives = 55/105 (52.38%), Query Frame = 1
Query:  319 LDNLPSRKSNETKSFASLLRHSTLMQLGNCENFRATGVVFEIVDQDLYVDFGGKF--YCVVEDNKGALISRGTLVTIVVVDMEITSAFMLDKVATTVLEAEGFLL 627
            +D +      + +SFASLLR+S  MQLG+       G + + V +D+Y+DFG KF   C V          G  V I ++D E++  F+  K   T+LEA+  L+
Sbjct:   34 VDTVTETSEAQNQSFASLLRNSKFMQLGDFNGRLVVGKIAQRVQEDVYIDFGLKFNAVCKVPALNSEAYRSGARVLIRLIDPELSERFLGSKHDLTLLEADAVLV 138          
BLAST of 28S ribosomal protein S28, mitochondrial vs. Ensembl Fly
Match: mRpS28 (gene:FBgn0034361 transcript:FBtr0086714)

HSP 1 Score: 70.8626 bits (172), Expect = 8.130e-15
Identity = 37/101 (36.63%), Postives = 58/101 (57.43%), Query Frame = 1
Query:  331 PSRKSNETKSFASLLRHSTLMQLGNCENFRATGVVFEIVDQDLYVDFGGKFYCVV--EDNKGALISRGTLVTIVVVDMEITSAFMLDKVATTVLEAEGFLL 627
            P +   + ++FASLLR+S L+ L N E    +G +F +V  DLY+DFG KF+CV        +   RG  V + + D+E+++ F+      T+LEA+  LL
Sbjct:   72 PPQLPEDNQTFASLLRNSKLIDLDNAEGKVVSGKIFHVVGDDLYIDFGWKFHCVCSRPTRNASDYVRGARVRLRIKDLELSTKFLGSSKDITILEADCHLL 172          
BLAST of 28S ribosomal protein S28, mitochondrial vs. Ensembl Zebrafish
Match: mrps28 (mitochondrial ribosomal protein S28 [Source:ZFIN;Acc:ZDB-GENE-061110-52])

HSP 1 Score: 82.8037 bits (203), Expect = 2.714e-19
Identity = 44/96 (45.83%), Postives = 59/96 (61.46%), Query Frame = 1
Query:  346 NETKSFASLLRHSTLMQLGNCENFRATGVVFEIVDQDLYVDFGGKFYCVVEDNK--GALISRGTLVTIVVVDMEITSAFMLDKVATTVLEAEGFLL 627
             E  SF +LLR S L+Q+G  +   A G +F IV+ DLYVDFGGKF+CV +     G    RG+ V + + D+E+TS F+     TT+LEAE  LL
Sbjct:   72 REESSFPALLRQSVLLQMGPAKGKIAIGKIFHIVNDDLYVDFGGKFHCVCKRPAVDGEKYQRGSKVRLRLEDLELTSRFLGATTDTTLLEAEATLL 167          
BLAST of 28S ribosomal protein S28, mitochondrial vs. Ensembl Zebrafish
Match: mrps28 (mitochondrial ribosomal protein S28 [Source:ZFIN;Acc:ZDB-GENE-061110-52])

HSP 1 Score: 82.8037 bits (203), Expect = 2.714e-19
Identity = 44/96 (45.83%), Postives = 59/96 (61.46%), Query Frame = 1
Query:  346 NETKSFASLLRHSTLMQLGNCENFRATGVVFEIVDQDLYVDFGGKFYCVVEDNK--GALISRGTLVTIVVVDMEITSAFMLDKVATTVLEAEGFLL 627
             E  SF +LLR S L+Q+G  +   A G +F IV+ DLYVDFGGKF+CV +     G    RG+ V + + D+E+TS F+     TT+LEAE  LL
Sbjct:   72 REESSFPALLRQSVLLQMGPAKGKIAIGKIFHIVNDDLYVDFGGKFHCVCKRPAVDGEKYQRGSKVRLRLEDLELTSRFLGATTDTTLLEAEATLL 167          
BLAST of 28S ribosomal protein S28, mitochondrial vs. Ensembl Xenopus
Match: sod2 (superoxide dismutase 2 [Source:Xenbase;Acc:XB-GENE-1000989])

HSP 1 Score: 84.3445 bits (207), Expect = 7.919e-20
Identity = 45/94 (47.87%), Postives = 62/94 (65.96%), Query Frame = 1
Query:  352 TKSFASLLRHSTLMQLGNCENFRATGVVFEIVDQDLYVDFGGKFYCVVE--DNKGALISRGTLVTIVVVDMEITSAFMLDKVATTVLEAEGFLL 627
            T+SFASLLR S L+Q+G  ++  A G +F IV  DLYVDFGGKF+CV +  +  G    +G  V + +VD+E+TS F+     TT+LEA+  LL
Sbjct:   67 TESFASLLRRSPLVQMGPSKDKIAIGKIFHIVGDDLYVDFGGKFHCVCKRPEQDGEKYQKGMRVRLRLVDLELTSRFLGATTDTTLLEADAVLL 160          
BLAST of 28S ribosomal protein S28, mitochondrial vs. Ensembl Mouse
Match: Mrps28 (mitochondrial ribosomal protein S28 [Source:MGI Symbol;Acc:MGI:1913480])

HSP 1 Score: 90.5077 bits (223), Expect = 4.280e-22
Identity = 45/93 (48.39%), Postives = 62/93 (66.67%), Query Frame = 1
Query:  355 KSFASLLRHSTLMQLGNCENFRATGVVFEIVDQDLYVDFGGKFYCVVE--DNKGALISRGTLVTIVVVDMEITSAFMLDKVATTVLEAEGFLL 627
            +SFAS+LRHS L QLG  ++    G +F IV+ DLY+DFGGKF+CV +  D  G    RGT V + ++D+E+TS F+     TT+LEA+  LL
Sbjct:   77 ESFASMLRHSPLTQLGPAKDKLVIGRIFHIVEDDLYIDFGGKFHCVCKRPDVDGEKYQRGTRVRLRLLDLELTSRFLGGTTDTTILEADAVLL 169          
BLAST of 28S ribosomal protein S28, mitochondrial vs. UniProt/SwissProt
Match: sp|Q9CY16|RT28_MOUSE (28S ribosomal protein S28, mitochondrial OS=Mus musculus OX=10090 GN=Mrps28 PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 2.994e-21
Identity = 45/93 (48.39%), Postives = 62/93 (66.67%), Query Frame = 1
Query:  355 KSFASLLRHSTLMQLGNCENFRATGVVFEIVDQDLYVDFGGKFYCVVE--DNKGALISRGTLVTIVVVDMEITSAFMLDKVATTVLEAEGFLL 627
            +SFAS+LRHS L QLG  ++    G +F IV+ DLY+DFGGKF+CV +  D  G    RGT V + ++D+E+TS F+     TT+LEA+  LL
Sbjct:   77 ESFASMLRHSPLTQLGPAKDKLVIGRIFHIVEDDLYIDFGGKFHCVCKRPDVDGEKYQRGTRVRLRLLDLELTSRFLGGTTDTTILEADAVLL 169          
BLAST of 28S ribosomal protein S28, mitochondrial vs. UniProt/SwissProt
Match: sp|P82928|RT28_BOVIN (28S ribosomal protein S28, mitochondrial OS=Bos taurus OX=9913 GN=MRPS28 PE=1 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 5.027e-20
Identity = 43/93 (46.24%), Postives = 62/93 (66.67%), Query Frame = 1
Query:  355 KSFASLLRHSTLMQLGNCENFRATGVVFEIVDQDLYVDFGGKFYCVVEDNK--GALISRGTLVTIVVVDMEITSAFMLDKVATTVLEAEGFLL 627
            +SFAS+LRHS L Q+G  ++    G +F IV+ DLY+DFGGKF+CV +  +  G    +GT V + ++D+E+TS F+     TT+LEAE  LL
Sbjct:   79 ESFASMLRHSPLTQMGPAKDKIVIGRIFHIVENDLYIDFGGKFHCVCKRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTILEAEAVLL 171          
BLAST of 28S ribosomal protein S28, mitochondrial vs. UniProt/SwissProt
Match: sp|Q9Y2Q9|RT28_HUMAN (28S ribosomal protein S28, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS28 PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 3.706e-19
Identity = 43/95 (45.26%), Postives = 61/95 (64.21%), Query Frame = 1
Query:  355 KSFASLLRHSTLMQLGNCENFRATGVVFEIVDQDLYVDFGGKFYCVVEDNK--GALISRGTLVTIVVVDMEITSAFMLDKVATTVLEAEGFLLYV 633
            +SFAS+LRHS L Q+G  ++    G +F IV+ DLY+DFGGKF+CV    +  G    +GT V + ++D+E+TS F+     TTVLEA   LL +
Sbjct:   78 ESFASMLRHSPLTQMGPAKDKLVIGRIFHIVENDLYIDFGGKFHCVCRRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTVLEANAVLLGI 172          
BLAST of 28S ribosomal protein S28, mitochondrial vs. TrEMBL
Match: A0A183AWA7 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS11241 PE=4 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 7.641e-25
Identity = 60/134 (44.78%), Postives = 78/134 (58.21%), Query Frame = 1
Query:  259 KSTRNILTPWTMPNLLQPFNLDNLPS-RKSNETKSFASLLRHSTLMQLGNCENFRATGVVFEIV-DQDLYVDFGGKFYCVVEDNKGALISRGTLVTIVVVDMEITSAFMLDKVATTVLEAEGFLL--YVGTKIR 648
            K+      PWTM  LLQ  N+  LP+ R +N   +F+SLLRHS+ +QLGN E     GVV E V D DLY+DFGGKF+CV          RG+LV I + D E+T+ FM++  A T+ EA+   L  Y G   R
Sbjct:   88 KAFAQAFVPWTMSRLLQEMNVRKLPAKRDTNPEPTFSSLLRHSSFVQLGNFEGREVIGVVIENVNDTDLYIDFGGKFHCVCPQPANQHYPRGSLVRIRLKDPEMTNQFMINTKAITLCEADATFLGPYRGRLTR 221          
BLAST of 28S ribosomal protein S28, mitochondrial vs. TrEMBL
Match: A0A4S2L674 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009726 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 4.234e-22
Identity = 59/144 (40.97%), Postives = 84/144 (58.33%), Query Frame = 1
Query:  229 SKSSHKRLGKKSTRNILTPWTMPNLLQPFNLDNLPSRK-SNETKSFASLLRHSTLMQLGNCENFRATGVVFEIVDQ-DLYVDFGGKFYCVVEDNKGALISRGTLVTIVVVDMEITSAFMLDKVATTVLEAEGFLL--YVGTKIR 648
            S S  KR    ST     PWT+  LLQ  N+  LPS++  NE +SF +LLR+S  +Q+G+  +    GVV E V++ DLY+DFGGKF+CV          RG+LV I + D E+T+ FM++    ++ EA+  LL  Y G  +R
Sbjct:   73 SASEGKR--PPSTAVAFVPWTLGRLLQEMNVRKLPSKRIPNEEQSFPTLLRNSPFVQMGDFSSREVIGVVIENVNETDLYIDFGGKFHCVCPQPANQHYPRGSLVRIRLRDPEMTNKFMINTKGISLCEADATLLGPYRGRIVR 214          
BLAST of 28S ribosomal protein S28, mitochondrial vs. TrEMBL
Match: A0A4Z2CVL7 (28S ribosomal protein S28 OS=Schistosoma japonicum OX=6182 GN=EWB00_007217 PE=4 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.329e-21
Identity = 55/141 (39.01%), Postives = 82/141 (58.16%), Query Frame = 1
Query:  256 KKSTRNILTPWTMPNLLQPFNLDNLPSRKSNET-KSFASLLRHSTLMQLGNCENFRATGVVFEIVDQ-DLYVDFGGKFYCVVEDNKGALISRGTLVTIVVVDMEITSAFMLDKVATTVLEAEGFLL--YVGTKIRKVDTID 666
            ++ T     PWTM  LL+  N+  L S +S  + KSF++LLR+S  +QLG+ E+    GVV + VD  DLY+DFGGKF+CV          RG+LV I + + E+T  FM++    ++ EA+  LL  Y G  +R ++  D
Sbjct:  105 RRVTATSFVPWTMSTLLKEMNISKLISERSKHSEKSFSTLLRYSPFIQLGDFESRELIGVVIDNVDNTDLYIDFGGKFHCVCSQPANHFYPRGSLVRIRLKNPELTDKFMINTKGISIFEADAVLLGPYKGRLVRVINEED 245          
BLAST of 28S ribosomal protein S28, mitochondrial vs. TrEMBL
Match: A0A419PZC2 (Deoxyhypusine synthase OS=Clonorchis sinensis OX=79923 GN=DHPS PE=4 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 6.416e-21
Identity = 58/138 (42.03%), Postives = 84/138 (60.87%), Query Frame = 1
Query:  253 GKK--STRNILTPWTMPNLLQPFNLDNLPSRK-SNETKSFASLLRHSTLMQLGNCENFRATGVVFEIV-DQDLYVDFGGKFYCVVEDNKGALISRGTLVTIVVVDMEITSAFMLDKVATTVLEAEGFLL--YVGTKIR 648
            GK+  ST     PWT+  LLQ  N+  LPS++  NE +SF++LLR+S  +Q+G+ ++    GVV E V D DLY+DFGGKF+CV          RG+LV I + D E+T+ FM++    ++ EA+  LL  Y G  +R
Sbjct:  243 GKRPPSTAVAFVPWTLGRLLQEMNIRKLPSKRIPNEEQSFSTLLRNSPFVQMGDFDSREVIGVVIENVNDTDLYIDFGGKFHCVCPQPANQHYPRGSLVRIRLRDPEMTNKFMINTKGISLCEADATLLGPYRGRIVR 380          
BLAST of 28S ribosomal protein S28, mitochondrial vs. TrEMBL
Match: G7YQ92 (Deoxyhypusine synthase (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_106921 PE=4 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 6.792e-21
Identity = 58/138 (42.03%), Postives = 84/138 (60.87%), Query Frame = 1
Query:  253 GKK--STRNILTPWTMPNLLQPFNLDNLPSRK-SNETKSFASLLRHSTLMQLGNCENFRATGVVFEIV-DQDLYVDFGGKFYCVVEDNKGALISRGTLVTIVVVDMEITSAFMLDKVATTVLEAEGFLL--YVGTKIR 648
            GK+  ST     PWT+  LLQ  N+  LPS++  NE +SF++LLR+S  +Q+G+ ++    GVV E V D DLY+DFGGKF+CV          RG+LV I + D E+T+ FM++    ++ EA+  LL  Y G  +R
Sbjct:  673 GKRPPSTAVAFVPWTLGRLLQEMNIRKLPSKRIPNEEQSFSTLLRNSPFVQMGDFDSREVIGVVIENVNDTDLYIDFGGKFHCVCPQPANQHYPRGSLVRIRLRDPEMTNKFMINTKGISLCEADATLLGPYRGRIVR 810          
BLAST of 28S ribosomal protein S28, mitochondrial vs. Ensembl Cavefish
Match: mrps28 (mitochondrial ribosomal protein S28 [Source:ZFIN;Acc:ZDB-GENE-061110-52])

HSP 1 Score: 87.8113 bits (216), Expect = 3.142e-21
Identity = 45/99 (45.45%), Postives = 62/99 (62.63%), Query Frame = 1
Query:  337 RKSNETKSFASLLRHSTLMQLGNCENFRATGVVFEIVDQDLYVDFGGKFYCVVEDNK--GALISRGTLVTIVVVDMEITSAFMLDKVATTVLEAEGFLL 627
            R S +  SFASLLR S LMQ+G  ++ R  G +F +V  DLY+DFGGKF+CV +  K       +GT V + + D+E+TS F+     TT+LEA+  LL
Sbjct:   74 RSSRQDASFASLLRRSPLMQMGPAKDKRVIGRIFHVVQDDLYIDFGGKFHCVCKRPKVEAERYHKGTWVRLRLEDLELTSRFLGANTDTTLLEADAELL 172          
BLAST of 28S ribosomal protein S28, mitochondrial vs. Ensembl Sea Lamprey
Match: mrps28 (mitochondrial ribosomal protein S28 [Source:ZFIN;Acc:ZDB-GENE-061110-52])

HSP 1 Score: 79.337 bits (194), Expect = 2.034e-19
Identity = 40/93 (43.01%), Postives = 60/93 (64.52%), Query Frame = 1
Query:  355 KSFASLLRHSTLMQLGNCENFRATGVVFEIVDQDLYVDFGGKFYCVVEDNK--GALISRGTLVTIVVVDMEITSAFMLDKVATTVLEAEGFLL 627
            ++FA +LR S LMQLG  ++    G +F +V+ +LY+DFGGKF+CV +     G    RG  V + +VD+E+T+ F+  K  TT+LEA+  LL
Sbjct:    8 ETFAEMLRKSPLMQLGPAKDKFVLGRIFHVVENELYIDFGGKFHCVCQRPAVDGEKYQRGARVRLRLVDLEMTARFLGAKTDTTLLEADAALL 100          
BLAST of 28S ribosomal protein S28, mitochondrial vs. Ensembl Nematostella
Match: EDO46321 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ96])

HSP 1 Score: 49.6766 bits (117), Expect = 6.303e-8
Identity = 38/129 (29.46%), Postives = 59/129 (45.74%), Query Frame = 1
Query:  250 LGKKSTRNILTPWTMPNLLQPFNLDNLPSRKSNETKSFASLLRHSTLMQLGNCENFRATGVVFEIV----DQDLYVDFGGKFYCVVEDNKGALISRGTLVTIVVVDMEITSAFMLDKVATTVLEAEGFL 624
            LG+ S   + +    P L + +N       K+N+ ++F  LLR+S  ++LG     R  G V  +V     QD+Y DFG KF+ V         + G  V + +  +E T  F+      T+ EAE  L
Sbjct:    6 LGRISLDRVFSAVKRPILGRLYNA------KANDVENFDELLRNSQFVKLGRPAGKRLKGRVMHVVARDKAQDVYADFGWKFHAVETHPLHKNFNVGDDVEVTLKTLEATGHFLGQSKRITLCEAEAKL 128          
BLAST of 28S ribosomal protein S28, mitochondrial vs. Ensembl Medaka
Match: mrps28 (mitochondrial ribosomal protein S28 [Source:ZFIN;Acc:ZDB-GENE-061110-52])

HSP 1 Score: 71.2478 bits (173), Expect = 5.040e-15
Identity = 40/97 (41.24%), Postives = 60/97 (61.86%), Query Frame = 1
Query:  343 SNETKSFASLLRHSTLMQLGNCENFRATGVVFEIVDQDLYVDFGGKFYCVVED--NKGALISRGTLVTIVVVDMEITSAFMLDKVATTVLEAEGFLL 627
            S + +SFA+LLR S L+Q+G   +    G V  +V  DLYVDFGGKF CV     + G  + RG+ V + +++ E+T+ F+  +  TT+LEA+  LL
Sbjct:   70 SGQEQSFAALLRRSPLIQMGPAHDKVVVGRVVHVVQDDLYVDFGGKFPCVCRRPADGGEQLQRGSRVRLRLLEPELTARFLGARTDTTLLEAQAVLL 166          
BLAST of 28S ribosomal protein S28, mitochondrial vs. Planmine SMEST
Match: SMESG000014293.1 (SMESG000014293.1)

HSP 1 Score: 377.481 bits (968), Expect = 1.583e-134
Identity = 211/214 (98.60%), Postives = 211/214 (98.60%), Query Frame = 1
Query:   37 MFSFRNYLSCLKRKLPNFNIQSIRLFDSKIDKDGXXXXXXXXXXXXXXXXXXXXXXXSTTVEHSSKSSHKRLGKKSTRNILTPWTMPNLLQPFNLDNLPSRKSNETKSFASLLRHSTLMQLGNCENFRATGVVFEIVDQDLYVDFGGKFYCVVEDNKGALISRGTLVTIVVVDMEITSAFMLDKVATTVLEAEGFLLYVGTKIRKVDTIDLFVI 678
            MFSFRNYLSCLKRKLPNFNIQSIRLFDSKIDKDGSDINDSRYDDNDFDDIDFLEDEDSTTVEHSSKSSHKRLGKKSTRNILTPWTMPNLLQPFNLDNLPSRKSNETKSFASLLRHSTLMQLGNCENFRATGVVFEIVDQDLYVDFGGKFYCVVEDNKGALISRG LVTIVVVDMEITSAFMLDKVATTVLEAEGFLLYVGTKIRK DTIDLF I
Sbjct:    1 MFSFRNYLSCLKRKLPNFNIQSIRLFDSKIDKDGSDINDSRYDDNDFDDIDFLEDEDSTTVEHSSKSSHKRLGKKSTRNILTPWTMPNLLQPFNLDNLPSRKSNETKSFASLLRHSTLMQLGNCENFRATGVVFEIVDQDLYVDFGGKFYCVVEDNKGALISRGALVTIVVVDMEITSAFMLDKVATTVLEAEGFLLYVGTKIRKADTIDLFDI 214          
The following BLAST results are available for this feature:
BLAST of 28S ribosomal protein S28, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MRPS287.717e-2045.26mitochondrial ribosomal protein S28 [Source:HGNC S... [more]
MRPS281.261e-1945.26mitochondrial ribosomal protein S28 [Source:HGNC S... [more]
MRPS281.764e-1743.33mitochondrial ribosomal protein S28 [Source:HGNC S... [more]
MRPS281.257e-1240.74mitochondrial ribosomal protein S28 [Source:HGNC S... [more]
MRPS283.316e-1241.77mitochondrial ribosomal protein S28 [Source:HGNC S... [more]
back to top
BLAST of 28S ribosomal protein S28, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrps-288.715e-1134.29Mitochondrial Ribosomal Protein, Small [Source:Un... [more]
back to top
BLAST of 28S ribosomal protein S28, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mRpS288.130e-1536.63gene:FBgn0034361 transcript:FBtr0086714[more]
back to top
BLAST of 28S ribosomal protein S28, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mrps282.714e-1945.83mitochondrial ribosomal protein S28 [Source:ZFIN;A... [more]
mrps282.714e-1945.83mitochondrial ribosomal protein S28 [Source:ZFIN;A... [more]
back to top
BLAST of 28S ribosomal protein S28, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sod27.919e-2047.87superoxide dismutase 2 [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of 28S ribosomal protein S28, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Mrps284.280e-2248.39mitochondrial ribosomal protein S28 [Source:MGI Sy... [more]
back to top
BLAST of 28S ribosomal protein S28, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q9CY16|RT28_MOUSE2.994e-2148.3928S ribosomal protein S28, mitochondrial OS=Mus mu... [more]
sp|P82928|RT28_BOVIN5.027e-2046.2428S ribosomal protein S28, mitochondrial OS=Bos ta... [more]
sp|Q9Y2Q9|RT28_HUMAN3.706e-1945.2628S ribosomal protein S28, mitochondrial OS=Homo s... [more]
back to top
BLAST of 28S ribosomal protein S28, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183AWA77.641e-2544.78Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A4S2L6744.234e-2240.97Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4Z2CVL71.329e-2139.0128S ribosomal protein S28 OS=Schistosoma japonicum... [more]
A0A419PZC26.416e-2142.03Deoxyhypusine synthase OS=Clonorchis sinensis OX=7... [more]
G7YQ926.792e-2142.03Deoxyhypusine synthase (Fragment) OS=Clonorchis si... [more]
back to top
BLAST of 28S ribosomal protein S28, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrps283.142e-2145.45mitochondrial ribosomal protein S28 [Source:ZFIN;A... [more]
back to top
BLAST of 28S ribosomal protein S28, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrps282.034e-1943.01mitochondrial ribosomal protein S28 [Source:ZFIN;A... [more]
back to top
BLAST of 28S ribosomal protein S28, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 28S ribosomal protein S28, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO463216.303e-829.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 28S ribosomal protein S28, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrps285.040e-1541.24mitochondrial ribosomal protein S28 [Source:ZFIN;A... [more]
back to top
BLAST of 28S ribosomal protein S28, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000014293.11.583e-13498.60SMESG000014293.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032257 ID=SMED30032257|Name=28S ribosomal protein S28, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=710bp
ATGCATGTGTTTTAATAATATTTATTGTAATTTCAAATGTTTTCTTTTAG
AAATTATTTATCCTGTCTAAAACGTAAATTGCCAAATTTTAACATACAGT
CTATTCGCTTGTTCGATAGTAAAATCGATAAAGATGGTTCAGACATTAAT
GACAGCAGATATGATGATAATGATTTTGATGACATAGACTTTCTAGAAGA
TGAGGATTCTACAACAGTAGAACATAGTTCTAAAAGTTCTCACAAACGCT
TGGGAAAAAAGTCAACCAGAAATATTTTGACTCCCTGGACAATGCCTAAT
TTGTTACAGCCATTTAATTTGGATAACTTGCCAAGTAGGAAATCAAATGA
AACAAAATCTTTTGCCAGCTTGTTAAGGCATTCAACTCTAATGCAATTAG
GAAATTGTGAAAATTTTAGGGCTACTGGCGTAGTTTTCGAGATCGTAGAC
CAAGATCTTTATGTTGATTTTGGTGGGAAATTTTATTGTGTTGTTGAAGA
TAACAAAGGGGCGTTAATTTCTCGTGGAACTTTGGTTACAATTGTTGTTG
TAGATATGGAAATTACCTCAGCATTTATGCTTGATAAAGTCGCAACTACA
GTTTTAGAAGCGGAGGGATTTTTACTATACGTAGGTACAAAAATCAGAAA
AGTTGATACAATTGATCTTTTTGTTATTTAATAAATGTTAACTTATTGTA
AAAAAAGATC
back to top

protein sequence of SMED30032257-orf-1

>SMED30032257-orf-1 ID=SMED30032257-orf-1|Name=SMED30032257-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=215bp
MFSFRNYLSCLKRKLPNFNIQSIRLFDSKIDKDGSDINDSRYDDNDFDDI
DFLEDEDSTTVEHSSKSSHKRLGKKSTRNILTPWTMPNLLQPFNLDNLPS
RKSNETKSFASLLRHSTLMQLGNCENFRATGVVFEIVDQDLYVDFGGKFY
CVVEDNKGALISRGTLVTIVVVDMEITSAFMLDKVATTVLEAEGFLLYVG
TKIRKVDTIDLFVI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR019375Ribosomal_S28_mit
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005763mitochondrial small ribosomal subunit
GO:0005840ribosome
GO:0030529intracellular ribonucleoprotein complex
Vocabulary: biological process
TermDefinition
GO:0008150biological_process