NEDD8-conjugating enzyme Ubc12

Overview
NameNEDD8-conjugating enzyme Ubc12
Smed IDSMED30032240
Length (bp)1155
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NEDD8-conjugating enzyme Ubc12 (SMED30032240) t-SNE clustered cells

Violin plots show distribution of expression levels for NEDD8-conjugating enzyme Ubc12 (SMED30032240) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NEDD8-conjugating enzyme Ubc12 (SMED30032240) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NEDD8-conjugating enzyme Ubc12 (SMED30032240) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032240

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30032240SMESG000069497.1 dd_Smed_v4_1766_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Human
Match: UBE2M (ubiquitin conjugating enzyme E2 M [Source:HGNC Symbol;Acc:HGNC:12491])

HSP 1 Score: 199.134 bits (505), Expect = 3.532e-62
Identity = 86/158 (54.43%), Postives = 123/158 (77.85%), Query Frame = 2
Query:  203 RMGSPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKGMPLDGINYDYVL 676
            +  S A +R+QKD+ +L+LP  C +   +PDDL NF++++ PD GFY +GKF+F+F V + YPH+ PKVKC+  +YHPNID +GNVCLNILR++WKPVLTIN++I+GL +LF+EPNPEDPLNK+AA VL+ ++R FE NV+R+M+G  +    ++  L
Sbjct:   25 KKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCL 182          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Human
Match: UBE2M (ubiquitin conjugating enzyme E2 M [Source:HGNC Symbol;Acc:HGNC:12491])

HSP 1 Score: 118.242 bits (295), Expect = 5.748e-32
Identity = 48/78 (61.54%), Postives = 67/78 (85.90%), Query Frame = 2
Query:  308 FRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFM 541
            F++++ PD GFY +GKF+F+F V + YPH+ PKVKC+  +YHPNID +GNVCLNILR++WKPVLTIN++I+GL +LF+
Sbjct:    1 FKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFL 78          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Human
Match: UBE2M (ubiquitin conjugating enzyme E2 M [Source:HGNC Symbol;Acc:HGNC:12491])

HSP 1 Score: 109.383 bits (272), Expect = 3.114e-29
Identity = 48/68 (70.59%), Postives = 62/68 (91.18%), Query Frame = 2
Query:  425 IYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKR 628
            +YHPNID +GNVCLNILR++WKPVLTIN++I+GL +LF+EPNPEDPLNK+AA VL+ ++R FE NV+R
Sbjct:    2 VYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQR 69          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Human
Match: UBE2D1 (ubiquitin conjugating enzyme E2 D1 [Source:HGNC Symbol;Acc:HGNC:12474])

HSP 1 Score: 104.375 bits (259), Expect = 2.497e-26
Identity = 53/143 (37.06%), Postives = 85/143 (59.44%), Query Frame = 2
Query:  218 AVIRLQKDLADL--DLPSMCTMEHPNPDDLKNFR-IIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMK 637
            A+ R+QK+L+DL  D P+ C+   P  DDL +++  I+ P    Y  G F  T     +YP + PK+    KIYHPNI+ +G++CL+ILR +W P LT++ V+  +  L  +PNP+DPL  D A + + DK ++  + +   +
Sbjct:    2 ALKRIQKELSDLQRDPPAHCSAG-PVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQ 143          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Human
Match: UBE2F (ubiquitin conjugating enzyme E2 F (putative) [Source:HGNC Symbol;Acc:HGNC:12480])

HSP 1 Score: 102.449 bits (254), Expect = 1.893e-25
Identity = 60/153 (39.22%), Postives = 81/153 (52.94%), Query Frame = 2
Query:  200 PRMGSPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQE------WKPVLTINAVIHGLIFLFME-PNPEDPLNKDAAAVLRKDKRQFELNVKRTMK 637
            P  GSP V  L+ +L     P  C +  P+P+ L  F++ V PD G+Y  GKF F   V + Y    PKVKC  KI+HPNI   G +CL++LR+       W P  T+  V+ GL  LF +  N +DPLN +AA    +DK  F   V   +K
Sbjct:   10 PVSGSPEVAELEANL-----PCTCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIK 157          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Celegans
Match: let-70 (Ubiquitin-conjugating enzyme E2 2 [Source:UniProtKB/Swiss-Prot;Acc:P35129])

HSP 1 Score: 99.7525 bits (247), Expect = 4.221e-25
Identity = 52/134 (38.81%), Postives = 81/134 (60.45%), Query Frame = 2
Query:  218 AVIRLQKDLADL--DLPSMCTMEHPNPDDLKNFR-IIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQF 610
            A+ R+QK+L DL  D P+ C+   P  DDL +++  I+ P    Y  G F  T     +YP + PKV    +IYHPNI+ +G++CL+ILR +W P LTI+ V+  +  L  +PNP+DPL  + A + + D+ ++
Sbjct:    2 ALKRIQKELQDLGRDPPAQCS-AGPVGDDLFHWQATIMGPPESPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRERY 134          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Celegans
Match: ubc-13 (Ubiquitin-conjugating enzyme E2 13 [Source:UniProtKB/Swiss-Prot;Acc:Q95XX0])

HSP 1 Score: 90.8929 bits (224), Expect = 8.034e-22
Identity = 52/145 (35.86%), Postives = 74/145 (51.03%), Query Frame = 2
Query:  233 QKDLADLDLPSMCTMEHPNPDDLKNFRIIVR-PDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKGMPLDGINY 664
            Q+ LAD   P      +P+  + + F +++  PD   ++ G F     + EEYP  APKV+   KIYHPNID  G +CL+IL+ +W P L I  V+  +  L   PNPEDPL  D A        Q++ N    +K      +NY
Sbjct:   14 QRLLAD---PVPGISANPDESNARYFHVMIAGPDDSPFAGGVFKLELFLPEEYPMAAPKVRFMTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPEDPLATDVA-------EQWKTNEAEAIKTAKQWTMNY 148          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Celegans
Match: ubc-1 (Ubiquitin-conjugating enzyme E2 1 [Source:UniProtKB/Swiss-Prot;Acc:P52478])

HSP 1 Score: 92.0485 bits (227), Expect = 1.026e-21
Identity = 47/146 (32.19%), Postives = 82/146 (56.16%), Query Frame = 2
Query:  206 MGSPAVIRLQKDLADL-DLPSMCTMEHPNPDDLKNFR-IIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMK 637
            M +P+  RL +D   L + P       P  D++  +  II  P    + +G F  +   TEEYP++ P VK  +K++HPN+  DG++CL+IL+  W P   + A++  +  L  EPNP  P N  AA + ++++R++E  V++ ++
Sbjct:    1 MTTPSRRRLMRDFKKLQEDPPAGVSGAPTEDNILTWEAIIFGPQETPFEDGTFKLSLEFTEEYPNKPPTVKFISKMFHPNVYADGSICLDILQNRWSPTYDVAAILTSIQSLLDEPNPNSPANSLAAQLYQENRREYEKRVQQIVE 146          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Celegans
Match: ubc-12 (NEDD8-conjugating enzyme ubc-12 [Source:UniProtKB/Swiss-Prot;Acc:Q9XVK5])

HSP 1 Score: 87.8113 bits (216), Expect = 2.761e-20
Identity = 52/152 (34.21%), Postives = 79/152 (51.97%), Query Frame = 2
Query:  197 RPRMGSPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQE------WKPVLTINAVIHGLIFLF---MEPNPEDPLNKDAAAVLRKDKRQFELNVK 625
            R ++ +  + +L+  L D     +  +E P+   L    + V P  G Y  GKF F   V  EY +  P VKC  K++HPNI+ DG++CL+ILRQ       W+P   +  V+HGL+ LF   M+ N  D LN  AA +  +++  F   V+
Sbjct:   25 RDKLLAQELQQLETALRD-QKQKLWHLEVPSTSCLHELELTVTPQEGIYRGGKFRFKITVPPEYNNVPPVVKCLTKVWHPNINEDGSICLSILRQNSLDQYGWRPTRNLTDVVHGLVSLFNDLMDFN--DALNIQAAQMWSQNRESFNHRVR 173          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Celegans
Match: ubc-18 (UBiquitin Conjugating enzyme [Source:UniProtKB/TrEMBL;Acc:Q21633])

HSP 1 Score: 82.8037 bits (203), Expect = 7.267e-19
Identity = 47/134 (35.07%), Postives = 69/134 (51.49%), Query Frame = 2
Query:  218 AVIRLQKDLADLDLPSMCTMEHPNPDD--LKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQE-WKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQF 610
            A  RLQK+L DL    +   E+   ++  L  + +++ PD   Y+ G F        +YP + PKV  + KIYHPN+D +G  CL I+  E WKP      V+  L+ L  EP P  P+  D A   +KD ++F
Sbjct:    3 ATRRLQKELGDLKNCGVKAYENVECEETNLLKWTVLLIPDKEPYNKGAFKVGITFPVDYPFKPPKVAFETKIYHPNVDEEGKFCLPIVTAENWKPATKTEQVMMALLSLINEPEPSHPIRADVAEEFQKDHKKF 136          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Fly
Match: UbcE2M (gene:FBgn0035853 transcript:FBtr0332139)

HSP 1 Score: 199.519 bits (506), Expect = 1.088e-62
Identity = 86/149 (57.72%), Postives = 119/149 (79.87%), Query Frame = 2
Query:  194 NRPRMGSPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKG 640
            ++ +  S A +R+QKD+ +L+LP+ C  + P+P+DL NF++I+ PD GFY +G+F+F F V   YPHE PKVKC  ++YHPNID DGNVCLNILR++W PVL IN++++GL FLF+EPNPEDPLNK+AA VL+ ++RQFE NVK+ M+G
Sbjct:   19 SQQKKASAAQLRIQKDINELNLPNTCATDFPDPNDLLNFKLIISPDEGFYRDGRFVFNFRVGSNYPHEPPKVKCATQVYHPNIDLDGNVCLNILREDWNPVLNINSIVYGLQFLFLEPNPEDPLNKEAADVLQTNRRQFENNVKKAMRG 167          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Fly
Match: UbcE2M (gene:FBgn0035853 transcript:FBtr0076722)

HSP 1 Score: 199.519 bits (506), Expect = 1.088e-62
Identity = 86/149 (57.72%), Postives = 119/149 (79.87%), Query Frame = 2
Query:  194 NRPRMGSPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKG 640
            ++ +  S A +R+QKD+ +L+LP+ C  + P+P+DL NF++I+ PD GFY +G+F+F F V   YPHE PKVKC  ++YHPNID DGNVCLNILR++W PVL IN++++GL FLF+EPNPEDPLNK+AA VL+ ++RQFE NVK+ M+G
Sbjct:   19 SQQKKASAAQLRIQKDINELNLPNTCATDFPDPNDLLNFKLIISPDEGFYRDGRFVFNFRVGSNYPHEPPKVKCATQVYHPNIDLDGNVCLNILREDWNPVLNINSIVYGLQFLFLEPNPEDPLNKEAADVLQTNRRQFENNVKKAMRG 167          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Fly
Match: UbcE2M (gene:FBgn0035853 transcript:FBtr0332138)

HSP 1 Score: 199.519 bits (506), Expect = 1.088e-62
Identity = 86/149 (57.72%), Postives = 119/149 (79.87%), Query Frame = 2
Query:  194 NRPRMGSPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKG 640
            ++ +  S A +R+QKD+ +L+LP+ C  + P+P+DL NF++I+ PD GFY +G+F+F F V   YPHE PKVKC  ++YHPNID DGNVCLNILR++W PVL IN++++GL FLF+EPNPEDPLNK+AA VL+ ++RQFE NVK+ M+G
Sbjct:   19 SQQKKASAAQLRIQKDINELNLPNTCATDFPDPNDLLNFKLIISPDEGFYRDGRFVFNFRVGSNYPHEPPKVKCATQVYHPNIDLDGNVCLNILREDWNPVLNINSIVYGLQFLFLEPNPEDPLNKEAADVLQTNRRQFENNVKKAMRG 167          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Fly
Match: eff (gene:FBgn0011217 transcript:FBtr0310554)

HSP 1 Score: 97.8265 bits (242), Expect = 2.726e-24
Identity = 55/144 (38.19%), Postives = 85/144 (59.03%), Query Frame = 2
Query:  218 AVIRLQKDLADL--DLPSMCTMEHPNPDDLKNFR-IIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQF-ELNVKRTMK 637
            A+ R+ K+L DL  D P+ C+   P  DDL +++  I+ P    Y  G F  T     +YP + PKV    +IYHPNI+ +G++CL+ILR +W P LTI+ V+  +  L  +PNP+DPL  + A + + D+ ++ EL  + T K
Sbjct:    2 ALKRINKELQDLGRDPPAQCS-AGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRK 144          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Fly
Match: eff (gene:FBgn0011217 transcript:FBtr0336876)

HSP 1 Score: 97.8265 bits (242), Expect = 2.726e-24
Identity = 55/144 (38.19%), Postives = 85/144 (59.03%), Query Frame = 2
Query:  218 AVIRLQKDLADL--DLPSMCTMEHPNPDDLKNFR-IIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQF-ELNVKRTMK 637
            A+ R+ K+L DL  D P+ C+   P  DDL +++  I+ P    Y  G F  T     +YP + PKV    +IYHPNI+ +G++CL+ILR +W P LTI+ V+  +  L  +PNP+DPL  + A + + D+ ++ EL  + T K
Sbjct:    2 ALKRINKELQDLGRDPPAQCS-AGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRK 144          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Zebrafish
Match: UBE2M (si:ch1073-205c8.3 [Source:ZFIN;Acc:ZDB-GENE-030131-1059])

HSP 1 Score: 197.593 bits (501), Expect = 1.119e-61
Identity = 86/158 (54.43%), Postives = 122/158 (77.22%), Query Frame = 2
Query:  203 RMGSPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKGMPLDGINYDYVL 676
            +  S A +R+QKD+ +L+LP  C +  P+ DDL NF++I+ PD GFY  GKF+F+F V + YPH+ PKVKC+  +YHPNID +GNVCLNILR++WKPVLTIN++I+GL +LF+EPNPEDPLNK+AA VL+ ++R FE NV+R+++G  +    ++  L
Sbjct:   27 KKASAAQLRIQKDINELNLPKTCEIVFPDQDDLLNFKLIISPDEGFYKGGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQTNRRLFEQNVQRSLRGGYVGATYFERCL 184          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Zebrafish
Match: UBE2M (si:ch1073-205c8.3 [Source:ZFIN;Acc:ZDB-GENE-030131-1059])

HSP 1 Score: 168.318 bits (425), Expect = 1.487e-50
Identity = 78/158 (49.37%), Postives = 112/158 (70.89%), Query Frame = 2
Query:  203 RMGSPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKGMPLDGINYDYVL 676
            +  S A +R+QKD+ +L+LP  C +  P+ DDL NF++I+ PD              V + YPH+ PKVKC+  +YHPNID +GNVCLNILR++WKPVLTIN++I+GL +LF+EPNPEDPLNK+AA VL+ ++R FE NV+R+++G  +    ++  L
Sbjct:   27 KKASAAQLRIQKDINELNLPKTCEIVFPDQDDLLNFKLIISPDE-------------VGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQTNRRLFEQNVQRSLRGGYVGATYFERCL 171          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Zebrafish
Match: UBE2M (si:ch1073-205c8.3 [Source:ZFIN;Acc:ZDB-GENE-030131-1059])

HSP 1 Score: 120.168 bits (300), Expect = 8.803e-33
Identity = 52/94 (55.32%), Postives = 70/94 (74.47%), Query Frame = 2
Query:  203 RMGSPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQE 484
            +  S A +R+QKD+ +L+LP  C +  P+ DDL NF++I+ PD GFY  GKF+F+F V + YPH+ PKVKC+  +YHPNID +GNVCLNILR E
Sbjct:   27 KKASAAQLRIQKDINELNLPKTCEIVFPDQDDLLNFKLIISPDEGFYKGGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILRLE 120          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Zebrafish
Match: UBE2M (si:ch1073-205c8.3 [Source:ZFIN;Acc:ZDB-GENE-030131-1059])

HSP 1 Score: 115.931 bits (289), Expect = 1.404e-31
Identity = 49/72 (68.06%), Postives = 66/72 (91.67%), Query Frame = 2
Query:  425 IYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKG 640
            +YHPNID +GNVCLNILR++WKPVLTIN++I+GL +LF+EPNPEDPLNK+AA VL+ ++R FE NV+R+++G
Sbjct:    2 VYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQTNRRLFEQNVQRSLRG 73          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Zebrafish
Match: ube2d1b (ubiquitin-conjugating enzyme E2D 1b [Source:ZFIN;Acc:ZDB-GENE-030131-2735])

HSP 1 Score: 103.605 bits (257), Expect = 2.946e-26
Identity = 54/134 (40.30%), Postives = 81/134 (60.45%), Query Frame = 2
Query:  218 AVIRLQKDLADL--DLPSMCTMEHPNPDDLKNFR-IIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQF 610
            A+ R+QK+L DL  D P+ C+   P  DDL +++  I+ P    Y  G F  T     +YP + PKV    KIYHPNI+ +G++CL+ILR +W P LT++ V+  +  L  +PNP+DPL  D A + + DK ++
Sbjct:    2 ALKRIQKELQDLQRDPPAQCSAG-PVGDDLFHWQATIMGPSDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAHIYKSDKEKY 134          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Xenopus
Match: mtnr1c (melatonin receptor type 1C [Source:Xenbase;Acc:XB-GENE-985295])

HSP 1 Score: 184.882 bits (468), Expect = 1.364e-56
Identity = 81/146 (55.48%), Postives = 114/146 (78.08%), Query Frame = 2
Query:  239 DLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKGMPLDGINYDYVL 676
            D+ +L+LP  C +E  + DDL NF++++ PD GFY  GKF+F+F V + YPH+ PKVKC+  +YHPNID +GNVCLNILR++WKPVLTIN++I+GL +LF+EPNPEDPLNK+AA VL+ ++R FE NV+R+M+G  +    ++  L
Sbjct:   38 DINELNLPKTCEIEFSDHDDLLNFKLVICPDEGFYKGGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCL 183          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Xenopus
Match: mtnr1c (melatonin receptor type 1C [Source:Xenbase;Acc:XB-GENE-985295])

HSP 1 Score: 149.828 bits (377), Expect = 2.405e-43
Identity = 63/116 (54.31%), Postives = 89/116 (76.72%), Query Frame = 2
Query:  194 NRPRMGSPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFM 541
               +  S A +R+QKD+ +L+LP  C +E  + DDL NF++++ PD GFY  GKF+F+F V + YPH+ PKVKC+  +YHPNID +GNVCLNILR++WKPVLTIN++I+GL +LF+
Sbjct:   22 GSSKKASAAQLRIQKDINELNLPKTCEIEFSDHDDLLNFKLVICPDEGFYKGGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFL 137          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Xenopus
Match: chmp2b (charged multivesicular body protein 2B [Source:Xenbase;Acc:XB-GENE-948820])

HSP 1 Score: 103.219 bits (256), Expect = 5.776e-26
Identity = 54/134 (40.30%), Postives = 81/134 (60.45%), Query Frame = 2
Query:  218 AVIRLQKDLADL--DLPSMCTMEHPNPDDLKNFR-IIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQF 610
            A+ R+QK+L DL  D P+ C+   P  DDL +++  I+ P    Y  G F  T     +YP + PKV    KIYHPNI+ +G++CL+ILR +W P LT++ V+  +  L  +PNP+DPL  D A + + DK ++
Sbjct:    2 ALKRIQKELNDLQRDPPAQCS-AGPVGDDLFHWQATIMGPTDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKY 134          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Xenopus
Match: chmp2b (charged multivesicular body protein 2B [Source:Xenbase;Acc:XB-GENE-948820])

HSP 1 Score: 101.679 bits (252), Expect = 1.496e-24
Identity = 54/133 (40.60%), Postives = 80/133 (60.15%), Query Frame = 2
Query:  218 AVIRLQKDLADL--DLPSMCTMEHPNPDDLKNFR-IIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQ 607
            A+ R+QK+L DL  D P+ C+   P  DDL +++  I+ P    Y  G F  T     +YP + PKV    KIYHPNI+ +G++CL+ILR +W P LT++ V+  +  L  +PNP+DPL  D A + + DK +
Sbjct:   98 ALKRIQKELNDLQRDPPAQCSAG-PVGDDLFHWQATIMGPTDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEK 229          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Xenopus
Match: ube2d3 (ubiquitin conjugating enzyme E2 D3 [Source:NCBI gene;Acc:548818])

HSP 1 Score: 97.4413 bits (241), Expect = 7.529e-24
Identity = 50/134 (37.31%), Postives = 81/134 (60.45%), Query Frame = 2
Query:  218 AVIRLQKDLADL--DLPSMCTMEHPNPDDLKNFR-IIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQF 610
            A+ R+ K+L DL  D P+ C+   P  DD+ +++  I+ P+   Y  G F  T     +YP + PKV    +IYHPNI+ +G++CL+ILR +W P LTI+ V+  +  L  +PNP+DPL  + A + + D+ ++
Sbjct:    2 ALKRIHKELNDLARDPPAQCSAG-PVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKY 134          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Mouse
Match: Ube2m (ubiquitin-conjugating enzyme E2M [Source:MGI Symbol;Acc:MGI:108278])

HSP 1 Score: 199.134 bits (505), Expect = 2.425e-62
Identity = 86/158 (54.43%), Postives = 123/158 (77.85%), Query Frame = 2
Query:  203 RMGSPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKGMPLDGINYDYVL 676
            +  S A +R+QKD+ +L+LP  C +   +PDDL NF++++ PD GFY +GKF+F+F V + YPH+ PKVKC+  +YHPNID +GNVCLNILR++WKPVLTIN++I+GL +LF+EPNPEDPLNK+AA VL+ ++R FE NV+R+M+G  +    ++  L
Sbjct:   25 KKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCL 182          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Mouse
Match: Ube2m (ubiquitin-conjugating enzyme E2M [Source:MGI Symbol;Acc:MGI:108278])

HSP 1 Score: 186.037 bits (471), Expect = 1.921e-57
Identity = 81/146 (55.48%), Postives = 115/146 (78.77%), Query Frame = 2
Query:  239 DLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKGMPLDGINYDYVL 676
            D+ +L+LP  C +   +PDDL NF++++ PD GFY +GKF+F+F V + YPH+ PKVKC+  +YHPNID +GNVCLNILR++WKPVLTIN++I+GL +LF+EPNPEDPLNK+AA VL+ ++R FE NV+R+M+G  +    ++  L
Sbjct:   25 DINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCL 170          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Mouse
Match: Ube2m (ubiquitin-conjugating enzyme E2M [Source:MGI Symbol;Acc:MGI:108278])

HSP 1 Score: 166.007 bits (419), Expect = 1.101e-49
Identity = 79/170 (46.47%), Postives = 111/170 (65.29%), Query Frame = 2
Query:  254 DLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFM-----------------------------EPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKGMPLDGINYDYVL 676
            +LP  C +   +PDDL NF++++ PD GFY +GKF+F+F V + YPH+ PKVKC+  +YHPNID +GNVCLNILR++WKPVLTIN++I+GL +LF+                             EPNPEDPLNK+AA VL+ ++R FE NV+R+M+G  +    ++  L
Sbjct:    2 NLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLVSRVRHLKLRVCWPSASLLPVDFHLYRPQEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCL 171          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Mouse
Match: Ube2m (ubiquitin-conjugating enzyme E2M [Source:MGI Symbol;Acc:MGI:108278])

HSP 1 Score: 116.701 bits (291), Expect = 5.723e-32
Identity = 50/72 (69.44%), Postives = 66/72 (91.67%), Query Frame = 2
Query:  425 IYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKG 640
            +YHPNID +GNVCLNILR++WKPVLTIN++I+GL +LF+EPNPEDPLNK+AA VL+ ++R FE NV+R+M+G
Sbjct:    2 VYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRG 73          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Mouse
Match: Ube2d1 (ubiquitin-conjugating enzyme E2D 1 [Source:MGI Symbol;Acc:MGI:2384911])

HSP 1 Score: 104.375 bits (259), Expect = 1.714e-26
Identity = 53/143 (37.06%), Postives = 85/143 (59.44%), Query Frame = 2
Query:  218 AVIRLQKDLADL--DLPSMCTMEHPNPDDLKNFR-IIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMK 637
            A+ R+QK+L+DL  D P+ C+   P  DDL +++  I+ P    Y  G F  T     +YP + PK+    KIYHPNI+ +G++CL+ILR +W P LT++ V+  +  L  +PNP+DPL  D A + + DK ++  + +   +
Sbjct:    2 ALKRIQKELSDLQRDPPAHCSAG-PVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQ 143          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. UniProt/SwissProt
Match: sp|Q9VSF3|UBC2M_DROME (Nedd8-conjugating enzyme UbcE2M OS=Drosophila melanogaster OX=7227 GN=UbcE2M PE=1 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 1.090e-61
Identity = 86/149 (57.72%), Postives = 119/149 (79.87%), Query Frame = 2
Query:  194 NRPRMGSPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKG 640
            ++ +  S A +R+QKD+ +L+LP+ C  + P+P+DL NF++I+ PD GFY +G+F+F F V   YPHE PKVKC  ++YHPNID DGNVCLNILR++W PVL IN++++GL FLF+EPNPEDPLNK+AA VL+ ++RQFE NVK+ M+G
Sbjct:   19 SQQKKASAAQLRIQKDINELNLPNTCATDFPDPNDLLNFKLIISPDEGFYRDGRFVFNFRVGSNYPHEPPKVKCATQVYHPNIDLDGNVCLNILREDWNPVLNINSIVYGLQFLFLEPNPEDPLNKEAADVLQTNRRQFENNVKKAMRG 167          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. UniProt/SwissProt
Match: sp|P61082|UBC12_MOUSE (NEDD8-conjugating enzyme Ubc12 OS=Mus musculus OX=10090 GN=Ube2m PE=1 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 1.696e-61
Identity = 86/158 (54.43%), Postives = 123/158 (77.85%), Query Frame = 2
Query:  203 RMGSPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKGMPLDGINYDYVL 676
            +  S A +R+QKD+ +L+LP  C +   +PDDL NF++++ PD GFY +GKF+F+F V + YPH+ PKVKC+  +YHPNID +GNVCLNILR++WKPVLTIN++I+GL +LF+EPNPEDPLNK+AA VL+ ++R FE NV+R+M+G  +    ++  L
Sbjct:   25 KKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCL 182          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. UniProt/SwissProt
Match: sp|P61081|UBC12_HUMAN (NEDD8-conjugating enzyme Ubc12 OS=Homo sapiens OX=9606 GN=UBE2M PE=1 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 1.696e-61
Identity = 86/158 (54.43%), Postives = 123/158 (77.85%), Query Frame = 2
Query:  203 RMGSPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKGMPLDGINYDYVL 676
            +  S A +R+QKD+ +L+LP  C +   +PDDL NF++++ PD GFY +GKF+F+F V + YPH+ PKVKC+  +YHPNID +GNVCLNILR++WKPVLTIN++I+GL +LF+EPNPEDPLNK+AA VL+ ++R FE NV+R+M+G  +    ++  L
Sbjct:   25 KKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCL 182          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. UniProt/SwissProt
Match: sp|A3KN22|UBC12_BOVIN (NEDD8-conjugating enzyme Ubc12 OS=Bos taurus OX=9913 GN=UBE2M PE=2 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 1.696e-61
Identity = 86/158 (54.43%), Postives = 123/158 (77.85%), Query Frame = 2
Query:  203 RMGSPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKGMPLDGINYDYVL 676
            +  S A +R+QKD+ +L+LP  C +   +PDDL NF++++ PD GFY +GKF+F+F V + YPH+ PKVKC+  +YHPNID +GNVCLNILR++WKPVLTIN++I+GL +LF+EPNPEDPLNK+AA VL+ ++R FE NV+R+M+G  +    ++  L
Sbjct:   25 KKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCL 182          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. UniProt/SwissProt
Match: sp|Q6DCZ9|UBC12_XENLA (NEDD8-conjugating enzyme Ubc12 OS=Xenopus laevis OX=8355 GN=ube2m PE=2 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 2.369e-61
Identity = 86/158 (54.43%), Postives = 122/158 (77.22%), Query Frame = 2
Query:  203 RMGSPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKGMPLDGINYDYVL 676
            +  S A +R+QKD+ +L+LP  C +E  + DDL NF++++ PD GFY  GKF+F+F V + YPH+ PKVKC+  +YHPNID +GNVCLNILR++WKPVLTIN++I+GL +LF+EPNPEDPLNK+AA VL+ ++R FE NV+R+M+G  +    ++  L
Sbjct:   25 KKASAAQLRIQKDITELNLPKTCEIEFSDHDDLLNFKLVICPDEGFYKGGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCL 182          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. TrEMBL
Match: A0A1X7U764 (UBIQUITIN_CONJUGAT_2 domain-containing protein OS=Amphimedon queenslandica OX=400682 GN=100632967 PE=3 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 1.927e-63
Identity = 89/155 (57.42%), Postives = 127/155 (81.94%), Query Frame = 2
Query:  212 SPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKGMPLDGINYDYVL 676
            S A +R+QKDLA+L+LP  C M+ P+P+DL NF++++ PD GFY NG+F+F+F + + YPHE PKVKC+ ++YHPNID +GNVCLNILR++WKPVLT+N++I+GL FLF+EPNP+DPLNKDAA VLR+++R FE NV ++M+G  +  + ++  L
Sbjct:   25 SAAFLRVQKDLAELNLPKTCQMDFPDPNDLLNFKLVISPDEGFYRNGRFVFSFKILQAYPHEPPKVKCETQVYHPNIDLEGNVCLNILREDWKPVLTVNSIIYGLQFLFLEPNPDDPLNKDAAEVLRQNRRLFEQNVSKSMRGGYVGSVYFERCL 179          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. TrEMBL
Match: A7SLW2 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g171977 PE=3 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 6.451e-62
Identity = 88/158 (55.70%), Postives = 123/158 (77.85%), Query Frame = 2
Query:  203 RMGSPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKGMPLDGINYDYVL 676
            +  S A +R+QKD+A+L LP  C  + P+ DD  NF++I+ PD GFY NG+F+F+F V   YPH+APKVKC+ K+YHPNID +GN+CLNILR++WKPVLTIN++I+GL +LF+EPNP+DPLNK+AA VLR ++R FE NV++ M+G  +  + +D  L
Sbjct:   22 KRASAAQLRIQKDIAELSLPKTCVTDFPDEDDFLNFKLIITPDEGFYKNGRFIFSFKVGAGYPHDAPKVKCETKVYHPNIDLEGNICLNILREDWKPVLTINSIIYGLQYLFLEPNPDDPLNKEAAEVLRSNRRLFEQNVQKAMRGGYVGSVYFDRCL 179          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. TrEMBL
Match: A0A3M6TND0 (UBIQUITIN_CONJUGAT_2 domain-containing protein OS=Pocillopora damicornis OX=46731 GN=pdam_00005139 PE=3 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 8.635e-62
Identity = 92/158 (58.23%), Postives = 123/158 (77.85%), Query Frame = 2
Query:  203 RMGSPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKGMPLDGINYDYVL 676
            +  S A +R+ KD+ DL+LP  C +E P+PDDL NF++ + PD GFY NG+F+F+F V   YPH+APKVKC+ K+YHPNID +GNVCLNILR++WKPVLTINA+I GL +LF+EPNPEDPLNKDAA VLR ++R FE NV ++M+G  +  + ++  L
Sbjct:   22 KRASAAQLRITKDVRDLELPKTCQIEFPDPDDLLNFKLNISPDEGFYRNGRFIFSFKVGPGYPHDAPKVKCETKVYHPNIDLEGNVCLNILREDWKPVLTINAIIIGLQYLFLEPNPEDPLNKDAAEVLRSNRRLFEQNVGKSMRGGYVGSVYFERCL 179          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. TrEMBL
Match: A0A2B4SQZ3 (NEDD8-conjugating enzyme Ubc12 OS=Stylophora pistillata OX=50429 GN=Ube2m PE=3 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 1.095e-61
Identity = 92/158 (58.23%), Postives = 123/158 (77.85%), Query Frame = 2
Query:  203 RMGSPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKGMPLDGINYDYVL 676
            +  S A +R+ KD+ DL+LP  C +E P+PDDL NF++ + PD GFY NG+F+F+F V   YPH+APKVKC+ K+YHPNID +GNVCLNILR++WKPVLTINA+I GL +LF+EPNPEDPLNKDAA VLR ++R FE NV ++M+G  +  + ++  L
Sbjct:   22 KRASAAQLRITKDVRDLELPKTCQIEFPDPDDLLNFKLNISPDEGFYRNGRFVFSFKVGPGYPHDAPKVKCETKVYHPNIDLEGNVCLNILREDWKPVLTINAIIIGLQYLFLEPNPEDPLNKDAAEVLRSNRRLFEQNVGKSMRGGYVGSVYFERCL 179          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. TrEMBL
Match: T2MFE4 (NEDD8-conjugating enzyme Ubc12 OS=Hydra vulgaris OX=6087 GN=UBE2M PE=2 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 3.831e-61
Identity = 89/158 (56.33%), Postives = 123/158 (77.85%), Query Frame = 2
Query:  203 RMGSPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKGMPLDGINYDYVL 676
            +  S A +R+QKDL++L LP  C  E  +PDDL NF++ ++PD GFY NG F+FTF +   YPHE PKVKC+  +YHPNID +GNVCLNILR++WKPVLTINA+++G+ +LF+EPNP+DPLNKDAA VLR+++R FE NV+RTM+G  +  + ++  +
Sbjct:   22 KRASAAQLRVQKDLSELQLPRTCQTEFADPDDLLNFKLTIQPDEGFYKNGIFVFTFKIGPNYPHEPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINAIVYGIQYLFLEPNPDDPLNKDAAEVLRQNRRLFEQNVQRTMRGGYIGSVYFERCM 179          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Cavefish
Match: si:ch1073-205c8.3 (ubiquitin conjugating enzyme E2 M [Source:NCBI gene;Acc:103036171])

HSP 1 Score: 197.978 bits (502), Expect = 5.904e-62
Identity = 86/158 (54.43%), Postives = 122/158 (77.22%), Query Frame = 2
Query:  203 RMGSPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKGMPLDGINYDYVL 676
            +  S A +R+QKD+ +L+LP  C +  P+ DDL NF++I+ PD GFY  GKF+F+F V + YPH+ PKVKC+  +YHPNID +GNVCLNILR++WKPVLTIN++I+GL +LF+EPNPEDPLNK+AA VL+ ++R FE NV+R+++G  +    ++  L
Sbjct:   27 KKASAAQLRIQKDINELNLPKTCEIVFPDQDDLLNFKLIISPDEGFYKGGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQTNRRLFEQNVQRSLRGGYVGATYFERCL 184          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Cavefish
Match: si:ch1073-205c8.3 (ubiquitin conjugating enzyme E2 M [Source:NCBI gene;Acc:103036171])

HSP 1 Score: 168.703 bits (426), Expect = 7.538e-51
Identity = 78/158 (49.37%), Postives = 112/158 (70.89%), Query Frame = 2
Query:  203 RMGSPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKGMPLDGINYDYVL 676
            +  S A +R+QKD+ +L+LP  C +  P+ DDL NF++I+ PD              V + YPH+ PKVKC+  +YHPNID +GNVCLNILR++WKPVLTIN++I+GL +LF+EPNPEDPLNK+AA VL+ ++R FE NV+R+++G  +    ++  L
Sbjct:   27 KKASAAQLRIQKDINELNLPKTCEIVFPDQDDLLNFKLIISPDE-------------VGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQTNRRLFEQNVQRSLRGGYVGATYFERCL 171          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Cavefish
Match: ube2d1b (ubiquitin conjugating enzyme E2 D1 [Source:NCBI gene;Acc:103029965])

HSP 1 Score: 103.605 bits (257), Expect = 2.497e-26
Identity = 54/134 (40.30%), Postives = 81/134 (60.45%), Query Frame = 2
Query:  218 AVIRLQKDLADL--DLPSMCTMEHPNPDDLKNFR-IIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQF 610
            A+ R+QK+L DL  D P+ C+   P  DDL +++  I+ P    Y  G F  T     +YP + PKV    KIYHPNI+ +G++CL+ILR +W P LT++ V+  +  L  +PNP+DPL  D A + + DK ++
Sbjct:    2 ALKRIQKELQDLQRDPPAQCSAG-PVGDDLFHWQATIMGPSDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAHIYKSDKEKY 134          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Cavefish
Match: ube2d1a (ubiquitin-conjugating enzyme E2 D4-like [Source:NCBI gene;Acc:103029158])

HSP 1 Score: 100.523 bits (249), Expect = 3.959e-25
Identity = 53/134 (39.55%), Postives = 80/134 (59.70%), Query Frame = 2
Query:  218 AVIRLQKDLADL--DLPSMCTMEHPNPDDLKNFR-IIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQF 610
            A+ R+QK+L DL  D PS C+   P  +DL +++  I+ P    +  G F  T     +YP + PKV    KIYHPNI+ +G++CL+ILR +W P LT++ V+  +  L  +PNP+DPL  D A   + DK ++
Sbjct:    2 AMKRIQKELQDLQRDPPSQCS-AGPMGEDLFHWQATIMGPGDSPFQGGVFFLTIQFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAHTYKSDKDKY 134          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Cavefish
Match: ube2d3 (ubiquitin-conjugating enzyme E2 D2 [Source:NCBI gene;Acc:103035280])

HSP 1 Score: 99.3673 bits (246), Expect = 8.773e-25
Identity = 51/134 (38.06%), Postives = 81/134 (60.45%), Query Frame = 2
Query:  218 AVIRLQKDLADL--DLPSMCTMEHPNPDDLKNFR-IIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQF 610
            A+ R+QK+L DL  D P+ C+   P  DD+ +++  I+ P+   Y  G F  T     +YP + PKV    +IYHPNI+ +G++CL+ILR +W P LTI+ V+  +  L  +PNP+DPL  + A + + D  ++
Sbjct:    2 ALKRIQKELTDLARDPPAQCS-AGPVGDDVFHWQATIMGPNESPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDTEKY 134          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010378.1 (pep scaffold:Pmarinus_7.0:GL477318:26908:31295:-1 gene:ENSPMAG00000009396.1 transcript:ENSPMAT00000010378.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.5153 bits (236), Expect = 5.561e-24
Identity = 51/143 (35.66%), Postives = 82/143 (57.34%), Query Frame = 2
Query:  215 PAVIRLQKDLADL--DLPSMCTMEHPNPDDLKNFR-IIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTM 634
            P    L ++L DL  D P+ C+   P  DDL +++  I+ P+   Y  G F  T     +YP + PKV    +IYHPNI+ +G++CL+ILR +W P LTI+ V+  +  L  +PNP+DPL  + A + + D+ ++    + T+
Sbjct:    2 PPTRPLHQELNDLGRDPPAQCSAG-PVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNKLARETI 143          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008817.1 (pep scaffold:Pmarinus_7.0:GL476329:1748443:1760143:-1 gene:ENSPMAG00000007968.1 transcript:ENSPMAT00000008817.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.4337 bits (228), Expect = 7.156e-23
Identity = 47/146 (32.19%), Postives = 83/146 (56.85%), Query Frame = 2
Query:  206 MGSPAVIRLQKDLADL-DLPSMCTMEHPNPDDLKNFR-IIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMK 637
            M +PA  RL +D   L + P       P+ +++  +  +I  P+   + +G F  T   TEEYP++ P VK  +K++HPN+  DG++CL+IL+  W P   +++++  +  L  EPNP  P N  AA + +++KR++E  V   ++
Sbjct:    1 MSTPARRRLMRDFKRLQEDPPAGVSGAPSENNIMLWNAVIFGPEGTPFEDGTFKLTLEFTEEYPNKPPTVKFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSLAAQLYQENKREYEKKVSAVVE 146          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006211.1 (pep scaffold:Pmarinus_7.0:GL476897:3176:4886:1 gene:ENSPMAG00000005612.1 transcript:ENSPMAT00000006211.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.1965 bits (217), Expect = 1.916e-21
Identity = 37/104 (35.58%), Postives = 64/104 (61.54%), Query Frame = 2
Query:  314 IIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVK 625
            +I  P+   + +G F  T   TEEYP++ P V+  +K++HPN+  DG++CL+IL+  W P   +++++  +  L  EPNP  P N  AA + +++KR++E  V 
Sbjct:   27 VIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKKVS 130          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Sea Lamprey
Match: ube2f (ubiquitin-conjugating enzyme E2F (putative) [Source:NCBI gene;Acc:406606])

HSP 1 Score: 86.6557 bits (213), Expect = 5.737e-21
Identity = 52/134 (38.81%), Postives = 72/134 (53.73%), Query Frame = 2
Query:  221 VIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQE------WKPVLTINAVIHGLIFLFME-PNPEDPLNKDAAAVLRKDK 601
            VI    DLA  +LP       P+P+ L   ++ + PD G+Y  GKF F   V + Y    PKVKC  +I+HPNI   G +CL++LR+       W P  T+  V+ GL  LF +  N +DPLN +AA    +DK
Sbjct:    1 VISEVADLAS-NLPKTLQQNFPDPNKLHFLQLTITPDEGYYVGGKFEFEVDVPDAYNMVPPKVKCLTRIWHPNIAETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDK 133          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Sea Lamprey
Match: ube2l3a (ubiquitin-conjugating enzyme E2L 3a [Source:ZFIN;Acc:ZDB-GENE-030131-2977])

HSP 1 Score: 83.1889 bits (204), Expect = 1.287e-19
Identity = 47/134 (35.07%), Postives = 67/134 (50.00%), Query Frame = 2
Query:  218 AVIRLQKDLADLDLPSMCTMEHPNPDD--LKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQE-WKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQF 610
            A     K+L D+    M    +   +D  +  +  ++ PD+  Y  G F        EYP + PK+  + KIYHPNID  G VCL I+  E WKP    + VI+ L+ L  +P PE PL  D A    KD+++F
Sbjct:    3 ATTSFHKELTDIRTSGMKNFRNILAEDSNILLWHGLIVPDNAPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPIINAENWKPATKTDQVINALVALVNDPEPEHPLRADVAEEYTKDRKKF 136          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Yeast
Match: UBC12 (Enzyme that mediates the conjugation of Rub1p; a ubiquitin-like protein, to other proteins; related to E2 ubiquitin-conjugating enzymes [Source:SGD;Acc:S000004297])

HSP 1 Score: 150.214 bits (378), Expect = 2.651e-44
Identity = 76/161 (47.20%), Postives = 102/161 (63.35%), Query Frame = 2
Query:  212 SPAVIRLQKDLADLDLPSMCTME---HPNPDDLKN---FRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKGMPLDGINYDYVL 676
            S A IRL++DL  LDLP   T+     P+  D        +IVRPD G+Y+ G   F     E YP E PKV C  KI+HPNID  GNVCLNILR++W P L + ++I GL+FLF+EPNP DPLNKDAA +L + +++F   V+ TM G  ++ + YD ++
Sbjct:   26 SAARIRLKRDLDSLDLPPTVTLNVITSPDSADRSQSPKLEVIVRPDEGYYNYGSINFNLDFNEVYPIEPPKVVCLKKIFHPNIDLKGNVCLNILREDWSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLLCEGEKEFAEAVRLTMSGGSIEHVKYDNIV 186          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Yeast
Match: UBC5 (Ubiquitin-conjugating enzyme; mediates selective degradation of short-lived, abnormal, or excess proteins, including histone H3; central component of the cellular stress response; expression is heat inducible; protein abundance increases in response to DNA replication stress; UBC5 has a paralog, UBC4, that arose from the whole genome duplication [Source:SGD;Acc:S000002466])

HSP 1 Score: 102.064 bits (253), Expect = 1.389e-26
Identity = 52/140 (37.14%), Postives = 81/140 (57.86%), Query Frame = 2
Query:  227 RLQKDLADL--DLPSMCTMEHPNPDDLKNFRI-IVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMK 637
            R+ K+L+DL  D P+ C+   P  DDL +++  I+ P    Y+ G F  +     +YP + PKV    KIYHPNI+  GN+CL+IL+ +W P LT++ V+  +  L  + NP+DPL  + A + + DK ++E   K   K
Sbjct:    6 RIAKELSDLGRDPPASCSA-GPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTKIYHPNINSSGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKTDKAKYEATAKEWTK 144          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Yeast
Match: UBC4 (Ubiquitin-conjugating enzyme (E2); key E2 partner with Ubc1p for the anaphase-promoting complex (APC); mediates degradation of abnormal or excess proteins, including calmodulin and histone H3; regulates levels of DNA Polymerase-{alpha} to promote efficient and accurate DNA replication; interacts with many SCF ubiquitin protein ligases; component of the cellular stress response; UBC4 has a paralog, UBC5, that arose from the whole genome duplication [Source:SGD;Acc:S000000286])

HSP 1 Score: 98.2117 bits (243), Expect = 3.468e-25
Identity = 49/140 (35.00%), Postives = 82/140 (58.57%), Query Frame = 2
Query:  227 RLQKDLADL--DLPSMCTMEHPNPDDLKNFRI-IVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMK 637
            R+ K+L+DL  D P+ C+   P  DDL +++  I+ P    Y+ G F  +     +YP + PK+    KIYHPNI+ +GN+CL+IL+ +W P LT++ V+  +  L  + NP+DPL  + A + + D+ ++E   +   K
Sbjct:    6 RIAKELSDLERDPPTSCSAG-PVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRPKYEATAREWTK 144          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Yeast
Match: UBC13 (E2 ubiquitin-conjugating enzyme; involved in the error-free DNA postreplication repair pathway; interacts with Mms2p to assemble ubiquitin chains at the Ub Lys-63 residue; DNA damage triggers redistribution from the cytoplasm to the nucleus [Source:SGD;Acc:S000002499])

HSP 1 Score: 87.4261 bits (215), Expect = 3.607e-21
Identity = 43/120 (35.83%), Postives = 66/120 (55.00%), Query Frame = 2
Query:  281 HPNPDDLKNFRIIVR-PDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMK 637
             P+ D+L+ F++ +  P+   Y +G F     + ++YP EAPKV+   KIYHPNID  G +CL++L+  W P L I  V+  +  L   PNP DPL  D A    K+++  +   +   K
Sbjct:   26 EPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQGAKAKAREWTK 145          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Yeast
Match: RAD6 (Ubiquitin-conjugating enzyme (E2); involved in postreplication repair as a heterodimer with Rad18p, regulation of K63 polyubiquitination in response to oxidative stress, DSBR and checkpoint control as a heterodimer with Bre1p, ubiquitin-mediated N-end rule protein degradation as a heterodimer with Ubr1p, ERAD with Ubr1p in the absence of canonical ER membrane ligases, and Rpn4p turnover as part of proteasome homeostasis, in complex with Ubr2p and Mub1p [Source:SGD;Acc:S000003026])

HSP 1 Score: 87.0409 bits (214), Expect = 7.942e-21
Identity = 47/147 (31.97%), Postives = 80/147 (54.42%), Query Frame = 2
Query:  206 MGSPAVIRLQKDLADL--DLPSMCTMEHPNPDDLKNFR-IIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMK 637
            M +PA  RL +D   +  D P   +   P PD++  +  +I+ P    Y +G F       EEYP++ P VK  ++++HPN+  +G +CL+IL+  W P   + +++  +  LF +PNP  P N +AA + +  K Q+   VK T++
Sbjct:    1 MSTPARRRLMRDFKRMKEDAPPGVSAS-PLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYVKRVKETVE 146          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Nematostella
Match: EDO35328 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLW2])

HSP 1 Score: 206.453 bits (524), Expect = 8.922e-66
Identity = 88/158 (55.70%), Postives = 123/158 (77.85%), Query Frame = 2
Query:  203 RMGSPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKGMPLDGINYDYVL 676
            +  S A +R+QKD+A+L LP  C  + P+ DD  NF++I+ PD GFY NG+F+F+F V   YPH+APKVKC+ K+YHPNID +GN+CLNILR++WKPVLTIN++I+GL +LF+EPNP+DPLNK+AA VLR ++R FE NV++ M+G  +  + +D  L
Sbjct:   22 KRASAAQLRIQKDIAELSLPKTCVTDFPDEDDFLNFKLIITPDEGFYKNGRFIFSFKVGAGYPHDAPKVKCETKVYHPNIDLEGNICLNILREDWKPVLTINSIIYGLQYLFLEPNPDDPLNKEAAEVLRSNRRLFEQNVQKAMRGGYVGSVYFDRCL 179          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Nematostella
Match: EDO28914 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T549])

HSP 1 Score: 140.584 bits (353), Expect = 2.185e-41
Identity = 58/96 (60.42%), Postives = 78/96 (81.25%), Query Frame = 2
Query:  239 DLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGL 526
            D+A+L LP  C  + P+ DD  NF++I+ PD GFY NG+F+F+F V   YPH+APKVKC+ K+YHPNID +GN+CLNILR++WKPVLTIN++I+GL
Sbjct:    1 DIAELSLPKTCVTDFPDEDDFLNFKLIITPDEGFYKNGRFIFSFKVGAGYPHDAPKVKCETKVYHPNIDLEGNICLNILREDWKPVLTINSIIYGL 96          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Nematostella
Match: EDO43669 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXR8])

HSP 1 Score: 97.4413 bits (241), Expect = 1.618e-24
Identity = 52/134 (38.81%), Postives = 80/134 (59.70%), Query Frame = 2
Query:  218 AVIRLQKDLADL--DLPSMCTMEHPNPDDLKNFR-IIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQF 610
            A+ R+ K+L DL  D P+ C+   P  DDL +++  I+ P    Y  G F  T     +YP + PKV    KIYHPNI+ +G++CL+ILR +W P LTI+ V+  +  L  +PNP+DPL  + A   + D++++
Sbjct:    2 ALKRINKELQDLGRDPPAQCS-AGPVGDDLFHWQATIMGPADSPYQGGVFFLTIHFPTDYPFKPPKVSFTTKIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLMDDPNPDDPLVPEIARSFKTDRKKY 134          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Nematostella
Match: EDO44768 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUX3])

HSP 1 Score: 94.7449 bits (234), Expect = 3.114e-23
Identity = 54/145 (37.24%), Postives = 79/145 (54.48%), Query Frame = 2
Query:  203 RMGSPAVIR---LQKDLADLD--LPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQE------WKPVLTINAVIHGLIFLFME-PNPEDPLNKDAAAVLRKDK 601
            R G    IR   L K+  +++  +P  C +   +PD L +F + V PD GF+ +G F F  ++ EEY  + P V C  KI+HPNI   G VCL++LR+       W P   +  V+ GL  LF +  N EDPLN +A+ +  K+K
Sbjct:   25 RKGQKISIRDALLTKEAQEMEENIPDTCQITFKDPDKLYDFYLTVVPDEGFWKDGIFKFHIMIPEEYNIKPPYVNCSTKIWHPNISESGEVCLSLLREHTLDGSGWAPTRHLKDVVWGLNSLFTDLLNFEDPLNVEASQMFEKNK 169          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Nematostella
Match: EDO32921 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STQ8])

HSP 1 Score: 89.7373 bits (221), Expect = 7.471e-22
Identity = 46/125 (36.80%), Postives = 75/125 (60.00%), Query Frame = 2
Query:  293 DDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNID-PDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKGMPLDGINY 664
            D+++ F + + P  G Y  G+F F+ + TE+YP+  P  +C N IYHPN+D  DG+VCL++L  +W     +  ++ GL+FLF  PN EDPL+         +   FE NV+ +++G  ++GI +
Sbjct:    1 DNMEEFELQITPTDGAYRGGQFKFS-VKTEDYPNTPPVPRCVNNIYHPNMDLDDGSVCLSLL-DDWNESNDLEDLVQGLLFLFYNPNLEDPLSPLFDLTDDYEYGSFEENVRASLEGKTVEGITF 123          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Medaka
Match: ENSORLT00000044082.1 (ubiquitin conjugating enzyme E2 M [Source:NCBI gene;Acc:111947719])

HSP 1 Score: 198.364 bits (503), Expect = 4.481e-62
Identity = 87/158 (55.06%), Postives = 121/158 (76.58%), Query Frame = 2
Query:  203 RMGSPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKGMPLDGINYDYVL 676
            +  S A +R+QKD+ +L+LP  C +  P+ DDL NFR+I+ PD GFY  GKF+F+F V + YPH+ PKVKC+  +YHPNID +GNVCLNILR++WKPVLTIN++I+GL +LF+EPNPEDPLNK+AA VL+ ++R FE NV R+++G  +    ++  L
Sbjct:   27 KKASAAQLRIQKDINELNLPKTCEISFPDDDDLLNFRLIISPDEGFYKGGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQTNRRLFEQNVHRSLRGGYVGATYFERCL 184          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Medaka
Match: ENSORLT00000039721.1 (ubiquitin conjugating enzyme E2 M [Source:NCBI gene;Acc:111947719])

HSP 1 Score: 168.703 bits (426), Expect = 9.896e-51
Identity = 78/146 (53.42%), Postives = 106/146 (72.60%), Query Frame = 2
Query:  203 RMGSPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKG 640
            +  S A +R+QKD+ +L+LP  C +  P+ DDL NFR+I+ PD              V + YPH+ PKVKC+  +YHPNID +GNVCLNILR +WKPVLTIN++I+GL +LF+EPNPEDPLNK+AA VL+ ++R FE NV R+++G
Sbjct:   27 KKASAAQLRIQKDINELNLPKTCEISFPDDDDLLNFRLIISPDE-------------VGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILRSDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQTNRRLFEQNVHRSLRG 159          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Medaka
Match: ube2f (ubiquitin conjugating enzyme E2 F (putative) [Source:NCBI gene;Acc:101158243])

HSP 1 Score: 106.301 bits (264), Expect = 7.551e-27
Identity = 59/145 (40.69%), Postives = 84/145 (57.93%), Query Frame = 2
Query:  230 LQKDLADLD--LPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQE------WKPVLTINAVIHGLIFLFME-PNPEDPLNKDAAAVLRKDKRQFELNVKRTMK 637
            L K++ADL+  LPS C    P+ + L +F++ V PD G+Y +GKF F   V E Y    PKV+C  +I+HPNI  +G +CL++LR+       W P  T+  V+ GL  LF +  N +DPLN DAA    +DK  F   V+  +K
Sbjct:   36 LTKEVADLEANLPSTCKASFPDENKLHHFQLSVSPDEGYYQSGKFQFEVDVPEAYNMVPPKVRCLTRIWHPNITENGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIDAAEHHLRDKEDFRNKVQEYIK 180          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Medaka
Match: ube2d4 (ubiquitin-conjugating enzyme E2 D4 [Source:NCBI gene;Acc:101172587])

HSP 1 Score: 101.293 bits (251), Expect = 1.679e-25
Identity = 52/134 (38.81%), Postives = 82/134 (61.19%), Query Frame = 2
Query:  218 AVIRLQKDLADL--DLPSMCTMEHPNPDDLKNFR-IIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQF 610
            A+ R+QK+L+DL  D P+ C+   P  DDL +++  I+ P    Y +G F  T     +YP + PKV    KIYHPNI+ +G++CL+ILR +W P LT++ V+  +  L  +PNP+DPL  + A   + D+ ++
Sbjct:    2 ALKRIQKELSDLQRDPPAQCSAG-PVGDDLFHWQATIMGPSDSPYQSGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKY 134          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Medaka
Match: ube2f (ubiquitin conjugating enzyme E2 F (putative) [Source:NCBI gene;Acc:101158243])

HSP 1 Score: 100.908 bits (250), Expect = 7.101e-25
Identity = 56/133 (42.11%), Postives = 79/133 (59.40%), Query Frame = 2
Query:  230 LQKDLADLD--LPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQE------WKPVLTINAVIHGLIFLFME-PNPEDPLNKDAAAVLRKDK 601
            L K++ADL+  LPS C    P+ + L +F++ V PD G+Y +GKF F   V E Y    PKV+C  +I+HPNI  +G +CL++LR+       W P  T+  V+ GL  LF +  N +DPLN DAA    +DK
Sbjct:   36 LTKEVADLEANLPSTCKASFPDENKLHHFQLSVSPDEGYYQSGKFQFEVDVPEAYNMVPPKVRCLTRIWHPNITENGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIDAAEHHLRDK 168          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Planmine SMEST
Match: SMESG000069497.1 (SMESG000069497.1)

HSP 1 Score: 340.887 bits (873), Expect = 3.190e-118
Identity = 177/177 (100.00%), Postives = 177/177 (100.00%), Query Frame = 2
Query:  146 MLRLVVXXXXXXXXXXNRPRMGSPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKGMPLDGINYDYVL 676
            MLRLVVKKEEEQKREENRPRMGSPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKGMPLDGINYDYVL
Sbjct:    1 MLRLVVKKEEEQKREENRPRMGSPAVIRLQKDLADLDLPSMCTMEHPNPDDLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKRTMKGMPLDGINYDYVL 177          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Planmine SMEST
Match: SMESG000063640.1 (SMESG000063640.1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.550e-23
Identity = 52/144 (36.11%), Postives = 85/144 (59.03%), Query Frame = 2
Query:  218 AVIRLQKDLADL--DLPSMCTMEHPNPDDLKNFR-IIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFELNVKR-TMK 637
            A+ R+Q +L  L  D P+ C+   P   DL ++   I+ P    Y  G F  +     +YP + P VK   KI+HPNI+ +G++CL+IL+ +W P LTI+ V+  +  L  +PN +DPL+ +AA + +KD+++F+   +  TMK
Sbjct:    2 ALKRIQTELKSLMTDPPAQCS-AGPKESDLVHWSATIMGPADSPYEGGIFSLSIEFPPDYPFKPPMVKFDTKIFHPNINSNGSICLDILKGQWSPALTISKVLLSICSLLCDPNADDPLDSNAANLYKKDRKKFDETARSWTMK 144          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Planmine SMEST
Match: SMESG000064169.1 (SMESG000064169.1)

HSP 1 Score: 94.3597 bits (233), Expect = 5.000e-23
Identity = 49/134 (36.57%), Postives = 81/134 (60.45%), Query Frame = 2
Query:  218 AVIRLQKDLADL--DLPSMCTMEHPNPDDLKNFR-IIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQF 610
            A+ R+ ++L DL  D P+ C+   P  +DL +++  I+ P+   Y  G F        +YP + PKV    KIYHPNI+ +G++CL+ILR +W P LTI+ V+  +  L  +PNP+DPL  + A + + D++++
Sbjct:    2 ALKRIGRELQDLAKDPPAQCS-AGPMHEDLFHWQATIMGPNDSPYDGGVFFLDIQFPTDYPFKPPKVTFTTKIYHPNINANGSICLDILRGQWSPALTISKVLLSICSLLTDPNPDDPLVPEIARIYKNDRKKY 134          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Planmine SMEST
Match: SMESG000078844.1 (SMESG000078844.1)

HSP 1 Score: 89.3521 bits (220), Expect = 3.223e-21
Identity = 44/134 (32.84%), Postives = 77/134 (57.46%), Query Frame = 2
Query:  221 VIRLQKDLADL--DLPSMCTMEHPNPDDLKNFR-IIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRKDKRQFE 613
            +IRL K+L +   + P+ CT    +  ++  ++  I+ P    Y  G F    +  E+YP   P +    +I+HPNI+  G +CLNIL++EW P LT++ V+  +  L ++PNP+DP +   A + + D+++FE
Sbjct:    1 MIRLNKELQEFRCNPPAQCTAGPISEANMYKWKATIMGPIGSPYEGGIFFLDILFPEKYPFNPPTINFLTRIFHPNINTSGAICLNILKKEWSPALTLSKVLLCISALLVDPNPDDPYSPAIAQLYKDDRKKFE 134          
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Planmine SMEST
Match: SMESG000045122.1 (SMESG000045122.1)

HSP 1 Score: 86.6557 bits (213), Expect = 3.571e-20
Identity = 42/100 (42.00%), Postives = 57/100 (57.00%), Query Frame = 2
Query:  284 PNPDDLKNFRIIVR-PDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNIDPDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAA 580
            PN ++ + F ++V  P    Y  G F     + +EYP  APKV+   KIYHPNID  G +CL+IL+ +W P L I  V+  +  L   PNP+DPL  D A
Sbjct:   28 PNEENARYFHVLVNGPKDSPYEGGVFKLELFLPDEYPMSAPKVRFVTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVA 127          
The following BLAST results are available for this feature:
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UBE2M3.532e-6254.43ubiquitin conjugating enzyme E2 M [Source:HGNC Sym... [more]
UBE2M5.748e-3261.54ubiquitin conjugating enzyme E2 M [Source:HGNC Sym... [more]
UBE2M3.114e-2970.59ubiquitin conjugating enzyme E2 M [Source:HGNC Sym... [more]
UBE2D12.497e-2637.06ubiquitin conjugating enzyme E2 D1 [Source:HGNC Sy... [more]
UBE2F1.893e-2539.22ubiquitin conjugating enzyme E2 F (putative) [Sour... [more]
back to top
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
let-704.221e-2538.81Ubiquitin-conjugating enzyme E2 2 [Source:UniProt... [more]
ubc-138.034e-2235.86Ubiquitin-conjugating enzyme E2 13 [Source:UniPro... [more]
ubc-11.026e-2132.19Ubiquitin-conjugating enzyme E2 1 [Source:UniProt... [more]
ubc-122.761e-2034.21NEDD8-conjugating enzyme ubc-12 [Source:UniProtKB... [more]
ubc-187.267e-1935.07UBiquitin Conjugating enzyme [Source:UniProtKB/Tr... [more]
back to top
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UbcE2M1.088e-6257.72gene:FBgn0035853 transcript:FBtr0332139[more]
UbcE2M1.088e-6257.72gene:FBgn0035853 transcript:FBtr0076722[more]
UbcE2M1.088e-6257.72gene:FBgn0035853 transcript:FBtr0332138[more]
eff2.726e-2438.19gene:FBgn0011217 transcript:FBtr0310554[more]
eff2.726e-2438.19gene:FBgn0011217 transcript:FBtr0336876[more]
back to top
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UBE2M1.119e-6154.43si:ch1073-205c8.3 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
UBE2M1.487e-5049.37si:ch1073-205c8.3 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
UBE2M8.803e-3355.32si:ch1073-205c8.3 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
UBE2M1.404e-3168.06si:ch1073-205c8.3 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
ube2d1b2.946e-2640.30ubiquitin-conjugating enzyme E2D 1b [Source:ZFIN;A... [more]
back to top
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtnr1c1.364e-5655.48melatonin receptor type 1C [Source:Xenbase;Acc:XB-... [more]
mtnr1c2.405e-4354.31melatonin receptor type 1C [Source:Xenbase;Acc:XB-... [more]
chmp2b5.776e-2640.30charged multivesicular body protein 2B [Source:Xen... [more]
chmp2b1.496e-2440.60charged multivesicular body protein 2B [Source:Xen... [more]
ube2d37.529e-2437.31ubiquitin conjugating enzyme E2 D3 [Source:NCBI ge... [more]
back to top
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ube2m2.425e-6254.43ubiquitin-conjugating enzyme E2M [Source:MGI Symbo... [more]
Ube2m1.921e-5755.48ubiquitin-conjugating enzyme E2M [Source:MGI Symbo... [more]
Ube2m1.101e-4946.47ubiquitin-conjugating enzyme E2M [Source:MGI Symbo... [more]
Ube2m5.723e-3269.44ubiquitin-conjugating enzyme E2M [Source:MGI Symbo... [more]
Ube2d11.714e-2637.06ubiquitin-conjugating enzyme E2D 1 [Source:MGI Sym... [more]
back to top
BLAST of NEDD8-conjugating enzyme Ubc12 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VSF3|UBC2M_DROME1.090e-6157.72Nedd8-conjugating enzyme UbcE2M OS=Drosophila mela... [more]
sp|P61082|UBC12_MOUSE1.696e-6154.43NEDD8-conjugating enzyme Ubc12 OS=Mus musculus OX=... [more]
sp|P61081|UBC12_HUMAN1.696e-6154.43NEDD8-conjugating enzyme Ubc12 OS=Homo sapiens OX=... [more]
sp|A3KN22|UBC12_BOVIN1.696e-6154.43NEDD8-conjugating enzyme Ubc12 OS=Bos taurus OX=99... [more]
sp|Q6DCZ9|UBC12_XENLA2.369e-6154.43NEDD8-conjugating enzyme Ubc12 OS=Xenopus laevis O... [more]
back to top
BLAST of NEDD8-conjugating enzyme Ubc12 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1X7U7641.927e-6357.42UBIQUITIN_CONJUGAT_2 domain-containing protein OS=... [more]
A7SLW26.451e-6255.70Predicted protein OS=Nematostella vectensis OX=453... [more]
A0A3M6TND08.635e-6258.23UBIQUITIN_CONJUGAT_2 domain-containing protein OS=... [more]
A0A2B4SQZ31.095e-6158.23NEDD8-conjugating enzyme Ubc12 OS=Stylophora pisti... [more]
T2MFE43.831e-6156.33NEDD8-conjugating enzyme Ubc12 OS=Hydra vulgaris O... [more]
back to top
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch1073-205c8.35.904e-6254.43ubiquitin conjugating enzyme E2 M [Source:NCBI gen... [more]
si:ch1073-205c8.37.538e-5149.37ubiquitin conjugating enzyme E2 M [Source:NCBI gen... [more]
ube2d1b2.497e-2640.30ubiquitin conjugating enzyme E2 D1 [Source:NCBI ge... [more]
ube2d1a3.959e-2539.55ubiquitin-conjugating enzyme E2 D4-like [Source:NC... [more]
ube2d38.773e-2538.06ubiquitin-conjugating enzyme E2 D2 [Source:NCBI ge... [more]
back to top
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010378.15.561e-2435.66pep scaffold:Pmarinus_7.0:GL477318:26908:31295:-1 ... [more]
ENSPMAT00000008817.17.156e-2332.19pep scaffold:Pmarinus_7.0:GL476329:1748443:1760143... [more]
ENSPMAT00000006211.11.916e-2135.58pep scaffold:Pmarinus_7.0:GL476897:3176:4886:1 gen... [more]
ube2f5.737e-2138.81ubiquitin-conjugating enzyme E2F (putative) [Sourc... [more]
ube2l3a1.287e-1935.07ubiquitin-conjugating enzyme E2L 3a [Source:ZFIN;A... [more]
back to top
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
UBC122.651e-4447.20Enzyme that mediates the conjugation of Rub1p; a u... [more]
UBC51.389e-2637.14Ubiquitin-conjugating enzyme; mediates selective d... [more]
UBC43.468e-2535.00Ubiquitin-conjugating enzyme (E2); key E2 partner ... [more]
UBC133.607e-2135.83E2 ubiquitin-conjugating enzyme; involved in the e... [more]
RAD67.942e-2131.97Ubiquitin-conjugating enzyme (E2); involved in pos... [more]
back to top
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO353288.922e-6655.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289142.185e-4160.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436691.618e-2438.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447683.114e-2337.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329217.471e-2236.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000044082.14.481e-6255.06ubiquitin conjugating enzyme E2 M [Source:NCBI gen... [more]
ENSORLT00000039721.19.896e-5153.42ubiquitin conjugating enzyme E2 M [Source:NCBI gen... [more]
ube2f7.551e-2740.69ubiquitin conjugating enzyme E2 F (putative) [Sour... [more]
ube2d41.679e-2538.81ubiquitin-conjugating enzyme E2 D4 [Source:NCBI ge... [more]
ube2f7.101e-2542.11ubiquitin conjugating enzyme E2 F (putative) [Sour... [more]
back to top
BLAST of NEDD8-conjugating enzyme Ubc12 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069497.13.190e-118100.00SMESG000069497.1[more]
SMESG000063640.11.550e-2336.11SMESG000063640.1[more]
SMESG000064169.15.000e-2336.57SMESG000064169.1[more]
SMESG000078844.13.223e-2132.84SMESG000078844.1[more]
SMESG000045122.13.571e-2042.00SMESG000045122.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032240 ID=SMED30032240|Name=NEDD8-conjugating enzyme Ubc12|organism=Schmidtea mediterranea sexual|type=transcript|length=1155bp
TCTAAAGTAGAATAAATTAAATAAATTAATAATTTACATTTTGTTTTAAA
AGTCAAGATTAATAGTTATTTAAAATTCTAGTTTTAATATTTTTATCTAA
TAAGATTTATTAATATTAGATCCAGTAATATATTATTTAATCGGAATGCT
CAGATTAGTAGTTAAAAAAGAAGAAGAACAGAAACGTGAAGAAAATAGAC
CGAGAATGGGCTCTCCTGCTGTTATTCGTTTACAGAAAGATCTCGCTGAT
TTGGACCTTCCATCTATGTGCACCATGGAACATCCTAATCCTGATGATTT
AAAAAATTTTCGCATAATTGTGAGACCAGATTCAGGATTTTACAGTAACG
GTAAATTTCTATTCACATTTATTGTGACTGAGGAGTATCCACACGAGGCT
CCAAAAGTTAAATGCCAAAATAAAATTTATCATCCAAACATCGATCCCGA
TGGAAATGTTTGTCTTAATATTTTAAGACAGGAATGGAAGCCTGTATTGA
CGATTAATGCTGTAATTCATGGATTAATCTTTCTGTTTATGGAACCAAAT
CCAGAAGATCCGCTAAACAAAGATGCCGCTGCTGTTTTGCGTAAAGACAA
ACGTCAATTTGAACTCAACGTGAAGCGAACCATGAAAGGGATGCCTCTTG
ATGGAATTAATTACGATTACGTATTGTAATGATTAATAGCAAATTTTGCT
ATTTTTTATTAAATTTTTTTTGATTTTTCTTATATTTTTTGAGGTGCATC
ACTTGTTGACTTTTATTTATTAACTTTTTTTATTTGTGTAAGGCAGTGAA
AATAATTTTAAAATTTTAATTTAGCACTTTGCTGGCTTTACTACTTTACT
GTTTACAAATAGTAAGTAGATAATTTAAAATTTTTCTAGATTCATTGCAG
GAATTTGTCTGGTTTTGATTGTTGCTTTATTTCTATGCACACATTGATTT
CCGTTATGACTGTTTCAATTCTTGGTCAATTACAACAGTTGGGGTAATGC
TTTTACATTTGGAACATTCTCTGGTACCTAATCGAATATCAATCAGTCCA
TGATTTTGCACTTTGTGAATACTTATGTTGAACGGAAAGTAACTGTTTCA
AATTTTCCGCGAAGATTTTCAAAATATTTAAAATTTCCAGGCTTTTCGAA
CTTGG
back to top

protein sequence of SMED30032240-orf-1

>SMED30032240-orf-1 ID=SMED30032240-orf-1|Name=SMED30032240-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=178bp
MLRLVVKKEEEQKREENRPRMGSPAVIRLQKDLADLDLPSMCTMEHPNPD
DLKNFRIIVRPDSGFYSNGKFLFTFIVTEEYPHEAPKVKCQNKIYHPNID
PDGNVCLNILRQEWKPVLTINAVIHGLIFLFMEPNPEDPLNKDAAAVLRK
DKRQFELNVKRTMKGMPLDGINYDYVL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0000166nucleotide binding
GO:0004842ubiquitin-protein transferase activity
GO:0005524ATP binding
GO:0016874ligase activity
GO:0018169ribosomal S6-glutamic acid ligase activity
GO:0019788NEDD8 transferase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000608UBQ-conjugat_E2
IPR016135UBQ-conjugating_enzyme/RWD
IPR023313UBQ-conjugating_AS
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006464cellular protein modification process
GO:0016567protein ubiquitination
GO:0045116protein neddylation
GO:0045879negative regulation of smoothened signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM00212ubc_7coord: 27..168
e-value: 6.1E-38
score: 142.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..21
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..23
NoneNo IPR availablePANTHERPTHR24068FAMILY NOT NAMEDcoord: 17..167
NoneNo IPR availablePANTHERPTHR24068:SF132NEDD8-CONJUGATING ENZYME UBC12coord: 17..167
IPR000608Ubiquitin-conjugating enzyme E2PFAMPF00179UQ_concoord: 28..162
e-value: 7.4E-38
score: 129.4
IPR000608Ubiquitin-conjugating enzyme E2PROSITEPS50127UBIQUITIN_CONJUGAT_2coord: 27..157
score: 28.639
IPR000608Ubiquitin-conjugating enzyme E2CDDcd00195UBCccoord: 26..163
e-value: 1.00542E-44
score: 142.726
IPR016135Ubiquitin-conjugating enzyme/RWD-likeGENE3DG3DSA:3.10.110.10coord: 25..177
e-value: 3.2E-56
score: 191.1
IPR016135Ubiquitin-conjugating enzyme/RWD-likeSUPERFAMILYSSF54495UBC-likecoord: 9..166
IPR023313Ubiquitin-conjugating enzyme, active sitePROSITEPS00183UBIQUITIN_CONJUGAT_1coord: 95..110