CARD domain-containing protein

Overview
NameCARD domain-containing protein
Smed IDSMED30032237
Length (bp)3907
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CARD domain-containing protein (SMED30032237) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CARD domain-containing protein (SMED30032237) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032237

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30032237SMESG000004758.1 dd_Smed_v4_11157_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30032237SMESG000004758.1 dd_Smed_v4_11157_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30032237SMESG000004758.1 dd_Smed_v4_11157_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CARD domain-containing protein vs. Ensembl Human
Match: NLRC3 (NLR family CARD domain containing 3 [Source:HGNC Symbol;Acc:HGNC:29889])

HSP 1 Score: 53.5286 bits (127), Expect = 3.947e-7
Identity = 39/127 (30.71%), Postives = 60/127 (47.24%), Query Frame = 1
Query: 3409 LVSIDLSGCIFTIIACKDLAEKIIQSRQLKILKLEKIQIQSMAFNTFIRSLCNNRTVIELNLSGIKMDNVCFFSLAEALKLNNRLEVLILLDIIINEHNCSEIAQVLRVNNTLKELRITESKVSSPG 3789
            L S+ L G        + +AE +  +R L +L L+K  I  M       +L  NR++ EL  S   + +    +LAEALK+N  LE L L    I++   + +   L  N TL  L + E+ +S  G
Sbjct:   25 LTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRMADALKQNRSLKELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNSISDAGVAALMGALCTNQTLLSLSLRENSISPEG 151          
BLAST of CARD domain-containing protein vs. Ensembl Human
Match: NLRC3 (NLR family CARD domain containing 3 [Source:HGNC Symbol;Acc:HGNC:29889])

HSP 1 Score: 53.5286 bits (127), Expect = 3.370e-6
Identity = 40/131 (30.53%), Postives = 61/131 (46.56%), Query Frame = 1
Query: 3397 IPDNLVSIDLSGCIFTIIACKDLAEKIIQSRQLKILKLEKIQIQSMAFNTFIRSLCNNRTVIELNLSGIKMDNVCFFSLAEALKLNNRLEVLILLDIIINEHNCSEIAQVLRVNNTLKELRITESKVSSPG 3789
            I   L S+ L G        + +AE +  +R L +L L+K  I  M       +L  NR++ EL  S   + +    +LAEALK+N  LE L L    I++   + +   L  N TL  L + E+ +S  G
Sbjct:  767 INRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRMADALKQNRSLKELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNSISDAGVAALMGALCTNQTLLSLSLRENSISPEG 897          
BLAST of CARD domain-containing protein vs. Ensembl Human
Match: NLRC3 (NLR family CARD domain containing 3 [Source:HGNC Symbol;Acc:HGNC:29889])

HSP 1 Score: 53.1434 bits (126), Expect = 3.692e-6
Identity = 39/127 (30.71%), Postives = 60/127 (47.24%), Query Frame = 1
Query: 3409 LVSIDLSGCIFTIIACKDLAEKIIQSRQLKILKLEKIQIQSMAFNTFIRSLCNNRTVIELNLSGIKMDNVCFFSLAEALKLNNRLEVLILLDIIINEHNCSEIAQVLRVNNTLKELRITESKVSSPG 3789
            L S+ L G        + +AE +  +R L +L L+K  I  M       +L  NR++ EL  S   + +    +LAEALK+N  LE L L    I++   + +   L  N TL  L + E+ +S  G
Sbjct:  724 LTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRMADALKQNRSLKELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNSISDAGVAALMGALCTNQTLLSLSLRENSISPEG 850          
BLAST of CARD domain-containing protein vs. TrEMBL
Match: A0A1I8FYV4 (CARD domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 771.926 bits (1992), Expect = 0.000e+0
Identity = 436/1261 (34.58%), Postives = 730/1261 (57.89%), Query Frame = 1
Query:  166 DNETFSEFSRLCYFITNFGILAFQNYIENSCLKNENYVDWLRQPKIHLSLRRLKCRGILTDAQWNSLYSIEKKSILFPPSDLSLLVLILKYTGIISRPEPNGWLHPPVSSDNSTGALLVKFQWIRKQIANATKMDSNTYQSNLELLIPILSHFGNNSLTEKIENFRHYELSNVDENNA---FEYFKLWHKTEEKIFKLENTLE-KSRENRQYEIPVLQKPINMRETSSRKIRRQKPSIFGTSFAENQNADLNKTNSKWSDIKYGIAEEEKEILRKFHPRLISEVRPDSMIDQLLTKKVLNIEESGEIFSSLNSSDQMSFLLDVLVLKNGQAFMEFLNALKSRYFELYLNIYEEYQHMKQEILANKPEGVSYCQTYLTNYYIKVYNQWNPVLWYPESFVNLQSFYCPLQVLDINGSLIEVDEILTHKVQKGPIRTVIVEGDSGTGKSYLSHLLASKWANDPFIFGEDNNLKLVFHLDLKITAPNLKWMLLDQLFNTDMKLTERELWEVIDKHQEICLFILDGYNDNINDEVLQLISGAIFPNSRLIIFSNSSATSLIRGFCQEKYVLTGFMSGESINFTKKYIKLTPRPYEMFESLLQKLSKNIPRNKFGK----SPKNEEP------------LNKINPNDELPILHNTGLVNQNKESPNWVDSEISFLGKQRAGSIIPGALMGFTKPNGRTSSRLSLIVNDSKNIKETSEETQFGLVSESESNSQERLTALRFYSQFPLYCSFFCLMTDLKLSIDLTSWSSMLEHFFTSIKMKLIERERESRFSVNRIFNTLIELSFESIKQGLAT-TFVKEADKLTKFGILRKAPSSNVNFTSKYVFHNDVIQNFLAAKCLDLYGLEEANSYFQNITITKSMYMLIIFYCGIRRNDFETAALRTLFRKX----XXXXXXXXXXXSDSGDYSNAKSRSVNIMKFQLSLDCVAAMN-GRKDLTLKVGQTLPERLLIEHTCTIPVLTLQGLSFIIDLSCKNIKELDIRLNYLSRQTPEAFQNLANSIQQNTSIKILRIFWEQLELMSSFFSRVC-------------------EKNQS---INTIEFFDESNHQYENFPQNVAFNIRNACKNMKSVEGFAFKDCIFPSLTHAIIRNIP----DNLVSIDLSGCIFTIIACKDLAEKIIQSRQLKILKLEKIQIQSMAFNTFIRSLCNNRTVIELNLSGIKMDNVCFFSLAEALKLNNRLEVLILLDIIINEHNCSEIAQVLRVNNTLKELRITESKVSSPGQ 3792
            D  +    SR+C+F+   G    ++  ++    +E   + L  P IH +LRRLK + +LT+  W +LY  EK S+     DL LL+L++KYT  +++P+PNGW+  P   D+S GA L +   I++++A+   + ++        +   L   G++   + +  ++    +++DE  +      F +W++ E  + +L+  +E + R+ ++ EIP+LQK +  R+  + + ++++ S+ G +  +  +    +   +W+ IK G+   E+ IL K++ +L+++V+ D++++ L+ K+++  +ES EIFS+L +++QMS L+D LV K+G    EF+ +LK +  ++Y  ++++YQ  K +ILANKP+G+ YC   L   Y   Y +WNP+ WY +   ++  FYC  Q+L++NG  +   ++  +K  +    TV++EGD GTGKS L+  +A KW+ D  +FG     +L+  LDLK+TAP +K M+++QLF  D KL ERE+WEV++ HQ   L I+DGY DN+NDE+  L+   I P   +++FS ++ T  +    Q K +LTGF   ++  + +KY+KL  +P+E F S L KL       +  K    + K++EP            +    P DE P+          +E+ + V +++S                       R+SS            K    + Q    S  E+++Q ++ +LR YSQ PLYCSFFCL+TD+++SIDL S ++++E F + IK+KLIERE+ESRF  NR +  L E + ++IK+G AT    KE   +TKFG+++ A +       +Y+F N +IQ +LAAK LD  G +EA+ +FQN+++T   Y +++FYC IR++D +T A R LF KI            +    +    +++     IM +QLSL+CVA M+  R+DL  K+ ++LPER  ++H   IP L+L GLS +I  +   I+E+D+RL+ L+++T EA+++LA +++ N  IK LRI+W + +LM+ F   VC                   + +Q+   +  +E  DES  + +     +  N+R AC NM  +E FAF++C   SL  +II+N+P    DNL  +D SGC  +I+A +DL  K+++S+ L+ L L  ++I +MAFNTFI +  +NRT++ L+LSGI++DNVCFFSL+EALK+NN+LE L L  + ++   C E+A++L++N  LK L +T+  VS  G+
Sbjct:   34 DERSVENLSRVCHFLMREGKACLRSLFDSKHPTDE-LTEHLASPDIHRTLRRLKIKDMLTEDDWQTLYPKEKSSVSADNYDLRLLLLLVKYTCDVTKPQPNGWMGDPEPRDDSQGAALQRLLGIQRELASLQTLKASAANRLFSRIAEQLQRLGHSGAADCMNAYKQD--TSMDETESRFILGEFLVWYRQE--VSQLKREIENQERKKKREEIPILQKRLKTRDLDTSETKKRQ-SVVGKATMDMSDKSRCQ---RWAHIKTGMVLAERLILDKYYEQLLNDVKADTVVEHLMNKEIITQDESTEIFSTLRNNEQMSTLIDFLVPKSGNVLDEFVESLKPKNEQVYQQMHQDYQAAKADILANKPQGLPYCNNILRERYSTAYAKWNPIPWYTKVETDIAEFYCQQQLLNLNGKSVNAFQVFDYKEGEKDPHTVVIEGDPGTGKSTLAKYMAYKWSLDENVFGRP--FQLLILLDLKVTAPTVKVMMMEQLFGGDCKLAEREIWEVMNMHQASTLLIIDGYEDNLNDEMKSLLFENIMPELHILVFSQTNFTVRLMHRYQRKVILTGFAKSQAEEYVQKYVKLAKKPWEHFSSFLNKLVVAKKSTELQKLLDAAKKSQEPQRRRGSSESATSVTSAKPRDERPL---------ERENTDKVSTKLS-----------------------RSSS------------KGQGNDQQQQQDSNGENSNQSKIASLRHYSQVPLYCSFFCLLTDMRMSIDLNSPTTIVEQFVSCIKLKLIEREKESRFEANRAYAMLSERAMDTIKKGSATFILAKEDHMMTKFGLIQLATNLTAEDNQRYMFGNRLIQEYLAAKNLDTSGTDEASRFFQNMSMTPISYNVVVFYCSIRKSDNDTPATRELFAKILQYNKRRGKASRMKMPAATSPEDSQLVEGKIMDYQLSLECVAVMDMARRDLGKKIVESLPERFTVKHEGIIPRLSLTGLSKMIKFNHTTIQEVDLRLDLLAKETLEAYKSLATAMKTNVHIKTLRIYWTEKDLMADFLQTVCCPEPEDPANSTGQMEIRRKKPDQTGFHLKNLECIDESGKKLDQLSPKMLNNMREACSNMTKLETFAFQNCHHMSLVGSIIKNLPTKFADNLRILDFSGCQMSIVASQDLNGKLMESKSLEGLILANLKIDAMAFNTFIAAFSSNRTIVLLDLSGIRLDNVCFFSLSEALKINNKLEKLFLRQVPMDTRACKEVARILKINKMLKLLTVTQEVVSEEGR 1239          
BLAST of CARD domain-containing protein vs. TrEMBL
Match: A0A267DGN7 (CARD domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026612g2 PE=4 SV=1)

HSP 1 Score: 771.926 bits (1992), Expect = 0.000e+0
Identity = 436/1261 (34.58%), Postives = 730/1261 (57.89%), Query Frame = 1
Query:  166 DNETFSEFSRLCYFITNFGILAFQNYIENSCLKNENYVDWLRQPKIHLSLRRLKCRGILTDAQWNSLYSIEKKSILFPPSDLSLLVLILKYTGIISRPEPNGWLHPPVSSDNSTGALLVKFQWIRKQIANATKMDSNTYQSNLELLIPILSHFGNNSLTEKIENFRHYELSNVDENNA---FEYFKLWHKTEEKIFKLENTLE-KSRENRQYEIPVLQKPINMRETSSRKIRRQKPSIFGTSFAENQNADLNKTNSKWSDIKYGIAEEEKEILRKFHPRLISEVRPDSMIDQLLTKKVLNIEESGEIFSSLNSSDQMSFLLDVLVLKNGQAFMEFLNALKSRYFELYLNIYEEYQHMKQEILANKPEGVSYCQTYLTNYYIKVYNQWNPVLWYPESFVNLQSFYCPLQVLDINGSLIEVDEILTHKVQKGPIRTVIVEGDSGTGKSYLSHLLASKWANDPFIFGEDNNLKLVFHLDLKITAPNLKWMLLDQLFNTDMKLTERELWEVIDKHQEICLFILDGYNDNINDEVLQLISGAIFPNSRLIIFSNSSATSLIRGFCQEKYVLTGFMSGESINFTKKYIKLTPRPYEMFESLLQKLSKNIPRNKFGK----SPKNEEP------------LNKINPNDELPILHNTGLVNQNKESPNWVDSEISFLGKQRAGSIIPGALMGFTKPNGRTSSRLSLIVNDSKNIKETSEETQFGLVSESESNSQERLTALRFYSQFPLYCSFFCLMTDLKLSIDLTSWSSMLEHFFTSIKMKLIERERESRFSVNRIFNTLIELSFESIKQGLAT-TFVKEADKLTKFGILRKAPSSNVNFTSKYVFHNDVIQNFLAAKCLDLYGLEEANSYFQNITITKSMYMLIIFYCGIRRNDFETAALRTLFRKX----XXXXXXXXXXXSDSGDYSNAKSRSVNIMKFQLSLDCVAAMN-GRKDLTLKVGQTLPERLLIEHTCTIPVLTLQGLSFIIDLSCKNIKELDIRLNYLSRQTPEAFQNLANSIQQNTSIKILRIFWEQLELMSSFFSRVC-------------------EKNQS---INTIEFFDESNHQYENFPQNVAFNIRNACKNMKSVEGFAFKDCIFPSLTHAIIRNIP----DNLVSIDLSGCIFTIIACKDLAEKIIQSRQLKILKLEKIQIQSMAFNTFIRSLCNNRTVIELNLSGIKMDNVCFFSLAEALKLNNRLEVLILLDIIINEHNCSEIAQVLRVNNTLKELRITESKVSSPGQ 3792
            D  +    SR+C+F+   G    ++  ++    +E   + L  P IH +LRRLK + +LT+  W +LY  EK S+     DL LL+L++KYT  +++P+PNGW+  P   D+S GA L +   I++++A+   + ++        +   L   G++   + +  ++    +++DE  +      F +W++ E  + +L+  +E + R+ ++ EIP+LQK +  R+  + + ++++ S+ G +  +  +    +   +W+ IK G+   E+ IL K++ +L+++V+ D++++ L+ K+++  +ES EIFS+L +++QMS L+D LV K+G    EF+ +LK +  ++Y  ++++YQ  K +ILANKP+G+ YC   L   Y   Y +WNP+ WY +   ++  FYC  Q+L++NG  +   ++  +K  +    TV++EGD GTGKS L+  +A KW+ D  +FG     +L+  LDLK+TAP +K M+++QLF  D KL ERE+WEV++ HQ   L I+DGY DN+NDE+  L+   I P   +++FS ++ T  +    Q K +LTGF   ++  + +KY+KL  +P+E F S L KL       +  K    + K++EP            +    P DE P+          +E+ + V +++S                       R+SS            K    + Q    S  E+++Q ++ +LR YSQ PLYCSFFCL+TD+++SIDL S ++++E F + IK+KLIERE+ESRF  NR +  L E + ++IK+G AT    KE   +TKFG+++ A +       +Y+F N +IQ +LAAK LD  G +EA+ +FQN+++T   Y +++FYC IR++D +T A R LF KI            +    +    +++     IM +QLSL+CVA M+  R+DL  K+ ++LPER  ++H   IP L+L GLS +I  +   I+E+D+RL+ L+++T EA+++LA +++ N  IK LRI+W + +LM+ F   VC                   + +Q+   +  +E  DES  + +     +  N+R AC NM  +E FAF++C   SL  +II+N+P    DNL  +D SGC  +I+A +DL  K+++S+ L+ L L  ++I +MAFNTFI +  +NRT++ L+LSGI++DNVCFFSL+EALK+NN+LE L L  + ++   C E+A++L++N  LK L +T+  VS  G+
Sbjct:   34 DERSVENLSRVCHFLMREGKACLRSLFDSKHPTDE-LTEHLASPDIHRTLRRLKIKDMLTEDDWQTLYPKEKSSVSADNYDLRLLLLLVKYTCDVTKPQPNGWMGDPEPRDDSQGAALQRLLGIQRELASLQTLKASAANRLFSRIAEQLQRLGHSGAADCMNAYKQD--TSMDETESRFILGEFLVWYRQE--VSQLKREIENQERKKKREEIPILQKRLKTRDLDTSETKKRQ-SVVGKATMDMSDKSRCQ---RWAHIKTGMVLAERLILDKYYEQLLNDVKADTVVEHLMNKEIITQDESTEIFSTLRNNEQMSTLIDFLVPKSGNVLDEFVESLKPKNEQVYQQMHQDYQAAKADILANKPQGLPYCNNILRERYSTAYAKWNPIPWYTKVETDIAEFYCQQQLLNLNGKSVNAFQVFDYKEGEKDPHTVVIEGDPGTGKSTLAKYMAYKWSLDENVFGRP--FQLLILLDLKVTAPTVKVMMMEQLFGGDCKLAEREIWEVMNMHQASTLLIIDGYEDNLNDEMKSLLFENIMPELHILVFSQTNFTVRLMHRYQRKVILTGFAKSQAEEYVQKYVKLAKKPWEHFSSFLNKLVVAKKSTELQKLLDAAKKSQEPQRRRGSSESATSVTSAKPRDERPL---------ERENTDKVSTKLS-----------------------RSSS------------KGQGNDQQQQQDSNGENSNQSKIASLRHYSQVPLYCSFFCLLTDMRMSIDLNSPTTIVEQFVSCIKLKLIEREKESRFEANRAYAMLSERAMDTIKKGSATFILAKEDHMMTKFGLIQLATNLTAEDNQRYMFGNRLIQEYLAAKNLDTSGTDEASRFFQNMSMTPISYNVVVFYCSIRKSDNDTPATRELFAKILQYNKRRGKASRMKMPAATSPEDSQLVEGKIMDYQLSLECVAVMDMARRDLGKKIVESLPERFTVKHEGIIPRLSLTGLSKMIKFNHTTIQEVDLRLDLLAKETLEAYKSLATAMKTNVHIKTLRIYWTEKDLMADFLQTVCCPEPEDPANSTGQMEIRRKKPDQTGFHLKNLECIDESGKKLDQLSPKMLNNMREACSNMTKLETFAFQNCHHMSLVGSIIKNLPTKFADNLRILDFSGCQMSIVASQDLNGKLMESKSLEGLILANLKIDAMAFNTFIAAFSSNRTIVLLDLSGIRLDNVCFFSLSEALKINNKLEKLFLRQVPMDTRACKEVARILKINKMLKLLTVTQEIVSEEGR 1239          
BLAST of CARD domain-containing protein vs. TrEMBL
Match: A0A267FPC0 (CARD domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016872g2 PE=4 SV=1)

HSP 1 Score: 768.844 bits (1984), Expect = 0.000e+0
Identity = 437/1261 (34.66%), Postives = 730/1261 (57.89%), Query Frame = 1
Query:  166 DNETFSEFSRLCYFITNFGILAFQNYIENSCLKNENYVDWLRQPKIHLSLRRLKCRGILTDAQWNSLYSIEKKSILFPPSDLSLLVLILKYTGIISRPEPNGWLHPPVSSDNSTGALLVKFQWIRKQIANATKMDSNTYQSNLELLIPILSHFGNNSLTEKIENFRHYELSNVDENNA---FEYFKLWHKTEEKIFKLENTLE-KSRENRQYEIPVLQKPINMRETSSRKIRRQKPSIFGTSFAENQNADLNKTNSKWSDIKYGIAEEEKEILRKFHPRLISEVRPDSMIDQLLTKKVLNIEESGEIFSSLNSSDQMSFLLDVLVLKNGQAFMEFLNALKSRYFELYLNIYEEYQHMKQEILANKPEGVSYCQTYLTNYYIKVYNQWNPVLWYPESFVNLQSFYCPLQVLDINGSLIEVDEILTHKVQKGPIRTVIVEGDSGTGKSYLSHLLASKWANDPFIFGEDNNLKLVFHLDLKITAPNLKWMLLDQLFNTDMKLTERELWEVIDKHQEICLFILDGYNDNINDEVLQLISGAIFPNSRLIIFSNSSATSLIRGFCQEKYVLTGFMSGESINFTKKYIKLTPRPYEMFESLLQKLSKNIPRNKFGK----SPKNEEP------------LNKINPNDELPILHNTGLVNQNKESPNWVDSEISFLGKQRAGSIIPGALMGFTKPNGRTSSRLSLIVNDSKNIKETSEETQFGLVSESESNSQERLTALRFYSQFPLYCSFFCLMTDLKLSIDLTSWSSMLEHFFTSIKMKLIERERESRFSVNRIFNTLIELSFESIKQGLAT-TFVKEADKLTKFGILRKAPSSNVNFTSKYVFHNDVIQNFLAAKCLDLYGLEEANSYFQNITITKSMYMLIIFYCGIRRNDFETAALRTLFRKXXXXXXXXXXXXSDSGDYSNAKSRSV----NIMKFQLSLDCVAAMN-GRKDLTLKVGQTLPERLLIEHTCTIPVLTLQGLSFIIDLSCKNIKELDIRLNYLSRQTPEAFQNLANSIQQNTSIKILRIFWEQLELMSSFFSRVC-------------------EKNQS---INTIEFFDESNHQYENFPQNVAFNIRNACKNMKSVEGFAFKDCIFPSLTHAIIRNIP----DNLVSIDLSGCIFTIIACKDLAEKIIQSRQLKILKLEKIQIQSMAFNTFIRSLCNNRTVIELNLSGIKMDNVCFFSLAEALKLNNRLEVLILLDIIINEHNCSEIAQVLRVNNTLKELRITESKVSSPGQ 3792
            D  +    SR+C+F+   G    ++  ++    +E   + L  P IH +LRRLK + +LT+  W +LY  EK S+     DL LL+L++KYT  +++P+PNGW+  P   D+S GA L +   I++++A+   + ++        +   L   G++   + +  ++    +++DE  +    + F +W++ E  + +L+  +E + R+ ++ EIP+LQK +  R+  + +I++++ S+ G +  +  +    +   +W+ IK G+   E+ IL K++ +L+++V+ D++++ L+ K+++  +ES EIFS+L +++QMS L+D LV K+G    EF+ +LK +  ++Y  ++++YQ  K +ILANKP+G+ YC   L   Y   Y +WNP+ WY +   ++  FYC  Q+L++NG  +   ++  +K  +    TV++EGD GTGKS L+  +A KW+ D  +F      +L+  LDLK+TAP +K M+++QLF  D KL ERE+WEV++ HQ   L I+DGY DN+NDE+  L+   I P   +++FS ++ T  +    Q K +LTGF   ++  + +KY+KL  +P+E F S L KL       +  K    + K++EP            +    P DE P+          +E+ + V +++S                       R+SS            K    + Q    S  E+++Q ++ +LR YSQ PLYCSFFCL+TD+++SIDL S ++++E F + IK+KLIERE+ESRF  NR +  L E + ++IK+G AT    KE   +TKFG+++ A +       +Y+F N +IQ +LAAK LD  G +EA+ +FQN+++T   Y +++FYC IR++D +T A R LF KI+  N +           + +   S      IM +QLSL+CVA M+  R+DL  K+ ++LPER  ++H   IP L+L GLS +I  +   I+E+D+RL+ L+++T EA+++LA +++ N  IK LRI+W + +LM+ F   VC                   + +Q+   +  +E  DES  + +     +  N+R AC NM  +E F F++C   SL  +II+N+P    DNL  +D SGC  +I+A +DL  K+++S+ L+ L L  ++I +MAFNTFI +  +NRT++ L+LSGI++DNVCFFSL+EALK+NN+LE L L  + ++   C E+A++L +N  LK L +T+  VS  G+
Sbjct:   34 DERSVENLSRVCHFLMREGKACLRSLFDSKHPTDE-LTEHLASPDIHRTLRRLKIKDMLTEDDWQTLYPKEKSSVSADNYDLRLLLLLVKYTCDVTKPQPNGWMGDPEPRDDSQGAALQRLLGIQRELASLQTLKASAANRLFSRIAEQLQRLGHSGAADCMNAYKQD--TSMDETESRFILDEFLVWYRQE--VSQLKREIENQERKKKREEIPILQKRLKTRDLDTSEIKKRQ-SVVGKATMDMSDKSRCQ---RWAHIKTGMVLAERLILDKYYEQLLNDVKADTVVEHLMNKEIITQDESTEIFSTLRNNEQMSTLIDFLVPKSGNVLDEFVESLKPKNEQVYQQMHQDYQAAKADILANKPQGLPYCNNILRERYSTAYAKWNPIPWYTKVETDIAEFYCQQQLLNLNGKSVNAFQVFDYKEGEKDPHTVVIEGDPGTGKSTLAKYMAYKWSLDENVFRRP--FQLLILLDLKVTAPTVKVMMMEQLFGGDCKLAEREIWEVMNMHQASTLLIIDGYEDNLNDEMKSLLFENIMPELHILVFSQTNFTVRLMHRYQRKVILTGFAKSQAEEYVQKYVKLAKKPWEHFSSFLNKLVVAKKSTELQKLLDAAKKSQEPQRRRGSSESATSVTSTKPRDERPL---------ERENTDKVSTKLS-----------------------RSSS------------KGQGNDQQQQQDSNGENSNQSKIASLRHYSQVPLYCSFFCLLTDMRMSIDLNSPTTIVEQFVSCIKLKLIEREKESRFEANRAYAMLSERAMDTIKKGSATFILAKEDHMMTKFGLIQLATNLTAEDNQRYMFGNRLIQEYLAAKNLDTSGTDEASRFFQNMSMTPISYNVVVFYCSIRKSDNDTPATRELFAKILQYNKRRGKASRMKMPAATSPEDSQLVEGKIMDYQLSLECVAVMDMARRDLGKKIVESLPERFTVKHEGIIPRLSLTGLSKMIKFNHTTIQEVDLRLDLLAKETLEAYKSLATAMKTNVHIKTLRIYWTEKDLMADFLQTVCCPEPEDPANSTGQMEIRRKKPDQTGFHLKNLECIDESGKKLDQLSPKMLNNMREACSNMTKLETFGFQNCHHMSLVGSIIKNLPTKFADNLRILDFSGCQMSIVASQDLNGKLMESKSLEGLILANLKIDAMAFNTFIAAFSSNRTIVLLDLSGIRLDNVCFFSLSEALKINNKLEKLFLRQVPMDTRACKEVARILMINKMLKLLTVTQEVVSEEGR 1239          
BLAST of CARD domain-containing protein vs. TrEMBL
Match: A0A267DFS1 (CARD domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026612g4 PE=4 SV=1)

HSP 1 Score: 762.296 bits (1967), Expect = 0.000e+0
Identity = 433/1224 (35.38%), Postives = 716/1224 (58.50%), Query Frame = 1
Query:  277 VDWLRQPKIHLSLRRLKCRGILTDAQWNSLYSIEKKSILFPPSDLSLLVLILKYTGIISRPEPNGWLHPPVSSDNSTGALLVKFQWIRKQIANATKMDSNTYQSNLELLIPILSHFGNNSLTEKIENFRHYELSNVDENNA---FEYFKLWHKTEEKIFKLENTLE-KSRENRQYEIPVLQKPINMRETSSRKIRRQKPSIFGTSFAENQNADLNKTNSKWSDIKYGIAEEEKEILRKFHPRLISEVRPDSMIDQLLTKKVLNIEESGEIFSSLNSSDQMSFLLDVLVLKNGQAFMEFLNALKSRYFELYLNIYEEYQHMKQEILANKPEGVSYCQTYLTNYYIKVYNQWNPVLWYPESFVNLQSFYCPLQVLDINGSLIEVDEILTHKVQKGPIRTVIVEGDSGTGKSYLSHLLASKWANDPFIFGEDNNLKLVFHLDLKITAPNLKWMLLDQLFNTDMKLTERELWEVIDKHQEICLFILDGYNDNINDEVLQLISGAIFPNSRLIIFSNSSATSLIRGFCQEKYVLTGFMSGESINFTKKYIKLTPRPYEMFESLLQKLSKNIPRNKFGK----SPKNEEP------------LNKINPNDELPILHNTGLVNQNKESPNWVDSEISFLGKQRAGSIIPGALMGFTKPNGRTSSRLSLIVNDSKNIKETSEETQFGLVSESESNSQERLTALRFYSQFPLYCSFFCLMTDLKLSIDLTSWSSMLEHFFTSIKMKLIERERESRFSVNRIFNTLIELSFESIKQGLAT-TFVKEADKLTKFGILRKAPSSNVNFTSKYVFHNDVIQNFLAAKCLDLYGLEEANSYFQNITITKSMYMLIIFYCGIRRNDFETAALRTLFRKXXXXXXXXXXXXSDSGDYSNAKSRSV----NIMKFQLSLDCVAAMN-GRKDLTLKVGQTLPERLLIEHTCTIPVLTLQGLSFIIDLSCKNIKELDIRLNYLSRQTPEAFQNLANSIQQNTSIKILRIFWEQLELMSSFFSRVC-------------------EKNQS---INTIEFFDESNHQYENFPQNVAFNIRNACKNMKSVEGFAFKDCIFPSLTHAIIRNIP----DNLVSIDLSGCIFTIIACKDLAEKIIQSRQLKILKLEKIQIQSMAFNTFIRSLCNNRTVIELNLSGIKMDNVCFFSLAEALKLNNRLEVLILLDIIINEHNCSEIAQVLRVNNTLKELRITESKVSSPGQ 3792
             + L  P IH +LRRLK + +LT+  W +LY  EK S+     DL LL+L++KYT  +++P+PNGW+  P   D+S GA L +   I++++A+   + ++        +   L   G++   + +  ++    +++DE  +      F +W++ E  + +L+  +E + R+ ++ EIP+LQK +  R+  + + ++++ S+ G   A    +D ++   +W+ IK G+   E+ IL K++ +L+++V+ D++++ L+ K+++  +ES EIFS+L +++QMS L+D LV K+G    EF+ +LK +  ++Y  ++++YQ  K +ILANKP+G+ YC   L   Y   Y +WNP+ WY +   ++  FYC  Q+L++NG  +   ++  +K  +    TV++EGD GTGKS L+  +A KW+ D  +FG     +L+  LDLK+TAP +K M+++QLF  D KL ERE+WEV++ HQ   L I+DGY DN+NDE+  L+   I P   +++FS ++ T  +    Q K +LTGF   ++  + +KY+KL  +P+E F S L KL       +  K    + K++EP            +    P DE P+          +E+ + V +++S                       R+SS            K    + Q    S  E+++Q ++ +LR YSQ PLYCSFFCL+TD+++SIDL S ++++E F + IK+KLIERE+ESRF  NR +  L E + ++IK+G AT    KE   +TKFG+++ A +       +Y+F N +IQ +LAAK LD  G +EA+ +FQN+++T   Y +++FYC IR++D +T A R LF KI+  N +           + +   S      IM +QLSL+CVA M+  R+DL  K+ ++LPER  ++H   IP L+L GLS +I  +   I+E+D+RL+ L+++T EA+++LA +++ N  IK LRI+W + +LM+ F   VC                   + +Q+   +  +E  DES  + +     +  N+R AC NM  +E FAF++C   SL  +II+N+P    DNL  +D SGC  +I+A +DL  K+++S+ L+ L L  ++I +MAFNTFI +  +NRT++ L+LSGI++DNVCFFSL+EALK+NN+LE L L  + ++   C E+A++L++N  LK L +T+  VS  G+
Sbjct:   22 TEHLASPDIHRTLRRLKIKDMLTEDDWQTLYPKEKSSVSADNYDLRLLLLLVKYTCDVTKPQPNGWMGDPEPRDDSQGAALQRLLGIQRELASLQTLKASAANRLFSRIAEQLQRLGHSGAADCMNAYKQD--TSMDETESRFILGEFLVWYRQE--VSQLKREIENQERKKKREEIPILQKRLKTRDLDTSETKKRQ-SVVGK--ATMDMSDKSRCQ-RWAHIKTGMVLAERLILDKYYEQLLNDVKADTVVEHLMNKEIITQDESTEIFSTLRNNEQMSTLIDFLVPKSGNVLDEFVESLKPKNEQVYQQMHQDYQAAKADILANKPQGLPYCNNILRERYSTAYAKWNPIPWYTKVETDIAEFYCQQQLLNLNGKSVNAFQVFDYKEGEKDPHTVVIEGDPGTGKSTLAKYMAYKWSLDENVFGRP--FQLLILLDLKVTAPTVKVMMMEQLFGGDCKLAEREIWEVMNMHQASTLLIIDGYEDNLNDEMKSLLFENIMPELHILVFSQTNFTVRLMHRYQRKVILTGFAKSQAEEYVQKYVKLAKKPWEHFSSFLNKLVVAKKSTELQKLLDAAKKSQEPQRRRGSSESATSVTSAKPRDERPL---------ERENTDKVSTKLS-----------------------RSSS------------KGQGNDQQQQQDSNGENSNQSKIASLRHYSQVPLYCSFFCLLTDMRMSIDLNSPTTIVEQFVSCIKLKLIEREKESRFEANRAYAMLSERAMDTIKKGSATFILAKEDHMMTKFGLIQLATNLTAEDNQRYMFGNRLIQEYLAAKNLDTSGTDEASRFFQNMSMTPISYNVVVFYCSIRKSDNDTPATRELFAKILQYNKRRGKASRMKMPAATSPEDSQLVEGKIMDYQLSLECVAVMDMARRDLGKKIVESLPERFTVKHEGIIPRLSLTGLSKMIKFNHTTIQEVDLRLDLLAKETLEAYKSLATAMKTNVHIKTLRIYWTEKDLMADFLQTVCCPEPEDPANSTGQMEIRRKKPDQTGFHLKNLECIDESGKKLDQLSPKMLNNMREACSNMTKLETFAFQNCHHMSLVGSIIKNLPTKFADNLRILDFSGCQMSIVASQDLNGKLMESKSLEGLILANLKIDAMAFNTFIAAFSSNRTIVLLDLSGIRLDNVCFFSLSEALKINNKLEKLFLRQVPMDTRACKEVARILKINKMLKLLTVTQEVVSEEGR 1191          
BLAST of CARD domain-containing protein vs. TrEMBL
Match: A0A267GNH0 (CARD domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026612g1 PE=4 SV=1)

HSP 1 Score: 682.559 bits (1760), Expect = 0.000e+0
Identity = 374/1005 (37.21%), Postives = 597/1005 (59.40%), Query Frame = 1
Query:  922 KWSDIKYGIAEEEKEILRKFHPRLISEVRPDSMIDQLLTKKVLNIEESGEIFSSLNSSDQMSFLLDVLVLKNGQAFMEFLNALKSRYFELYLNIYEEYQHMKQEILANKPEGVSYCQTYLTNYYIKVYNQWNPVLWYPESFVNLQSFYCPLQVLDINGSLIEVDEILTHKVQKGPIRTVIVEGDSGTGKSYLSHLLASKWANDPFIFGEDNNLKLVFHLDLKITAPNLKWMLLDQLFNTDMKLTERELWEVIDKHQEICLFILDGYNDNINDEVLQLISGAIFPNSRLIIFSNSSATSLIRGFCQEKYVLTGFMSGESINFTKKYIKLTPRPYEMFESLLQKLSKNIPRNKFGK----SPKNEEP------------LNKINPNDELPILHNTGLVNQNKESPNWVDSEISFLGKQRAGSIIPGALMGFTKPNGRTSSRLSLIVNDSKNIKETSEETQFGLVSESESNSQERLTALRFYSQFPLYCSFFCLMTDLKLSIDLTSWSSMLEHFFTSIKMKLIERERESRFSVNRIFNTLIELSFESIKQGLAT-TFVKEADKLTKFGILRKAPSSNVNFTSKYVFHNDVIQNFLAAKCLDLYGLEEANSYFQNITITKSMYMLIIFYCGIRRNDFETAALRTLFRKXXXXXXXXXXXXSDSGDYSNAKSRSV----NIMKFQLSLDCVAAMN-GRKDLTLKVGQTLPERLLIEHTCTIPVLTLQGLSFIIDLSCKNIKELDIRLNYLSRQTPEAFQNLANSIQQNTSIKILRIFWEQLELMSSFFSRVC-------------------EKNQS---INTIEFFDESNHQYENFPQNVAFNIRNACKNMKSVEGFAFKDCIFPSLTHAIIRNIP----DNLVSIDLSGCIFTIIACKDLAEKIIQSRQLKILKLEKIQIQSMAFNTFIRSLCNNRTVIELNLSGIKMDNVCFFSLAEALKLNNRLEVLILLDIIINEHNCSEIAQVLRVNNTLKELRITESKVSSPGQ 3792
            +W+ IK G+   E+ IL K++ +L+++V+ D++++ L+ K+++  +ES EIFS+L +++QMS L+D LV K+G    EF+ +LK +  ++Y  ++++YQ  K +ILANKP+G+ YC   L   Y   Y +WNP+ WY +   ++  FYC  Q+L++NG  +   ++  +K  +    TV++EGD GTGKS L+  +A KW+ D  +FG     +L+  LDLK+TAP +K M+++QLF  D KL ERE+WEV++ HQ   L I+DGY DN+NDE+  L+   I P   +++FS ++ T  +    Q K +LTGF   ++  + +KY+KL  +P+E F S L KL       +  K    + K++EP            +    P DE P+          +E+ + V +++S                       R+SS            K    + Q    S  E+++Q ++ +LR YSQ PLYCSFFCL+TD+++SIDL S ++++E F + IK+KLIERE+ESRF  NR +  L E + ++IK+G AT    KE   +TKFG+++ A +       +Y+F N +IQ +LAAK LD  G +EA+ +FQN+++T   Y +++FYC IR++D +T A R LF KI+  N +           + +   S      IM +QLSL+CVA M+  R+DL  K+ ++LPER  ++H   IP L+L GLS +I  +   I+E+D+RL+ L+++T EA+++LA +++ N  IK LRI+W + +LM+ F   VC                   + +Q+   +  +E  DES  + +     +  N+R AC NM  +E FAF++C   SL  +II+N+P    DNL  +D SGC  +I+A +DL  K+++S+ L+ L L  ++I +MAFNTFI +  +NRT++ L+LSGI++DNVCFFSL+EALK+NN+LE L L  + ++   C E+A++L++N  LK L +T+  VS  G+
Sbjct:   11 RWAHIKTGMVLAERLILDKYYEQLLNDVKADTVVEHLMNKEIITQDESTEIFSTLRNNEQMSTLIDFLVPKSGNVLDEFVESLKPKNEQVYQQMHQDYQAAKADILANKPQGLPYCNNILRERYSTAYAKWNPIPWYTKVETDIAEFYCQQQLLNLNGKSVNAFQVFDYKEGEKDPHTVVIEGDPGTGKSTLAKYMAYKWSLDENVFGRP--FQLLILLDLKVTAPTVKVMMMEQLFGGDCKLAEREIWEVMNMHQASTLLIIDGYEDNLNDEMKSLLFENIMPELHILVFSQTNFTVRLMHRYQRKVILTGFAKSQAEEYVQKYVKLAKKPWEHFSSFLNKLVVAKKSTELQKLLDAAKKSQEPQRRRGSSESATSVTSAKPRDERPL---------ERENTDKVSTKLS-----------------------RSSS------------KGQGNDQQQQQDSNGENSNQSKIASLRHYSQVPLYCSFFCLLTDMRMSIDLNSPTTIVEQFVSCIKLKLIEREKESRFEANRAYAMLSERAMDTIKKGSATFILAKEDHMMTKFGLIQLATNLTAEDNQRYMFGNRLIQEYLAAKNLDTSGTDEASRFFQNMSMTPISYNVVVFYCSIRKSDNDTPATRELFAKILQYNKRRGKASRMKMPAATSPEDSQLVEGKIMDYQLSLECVAVMDMARRDLGKKIVESLPERFTVKHEGIIPRLSLTGLSKMIKFNHTTIQEVDLRLDLLAKETLEAYKSLATAMKTNVHIKTLRIYWTEKDLMADFLQTVCCPEPEDPANSTGQMEIRRKKPDQTGFHLKNLECIDESGKKLDQLSPKMLNNMREACSNMTKLETFAFQNCHHMSLVGSIIKNLPTKFADNLRILDFSGCQMSIVASQDLNGKLMESKSLEGLILANLKIDAMAFNTFIAAFSSNRTIVLLDLSGIRLDNVCFFSLSEALKINNKLEKLFLRQVPMDTRACKEVARILKINKMLKLLTVTQEVVSEEGR 969          
BLAST of CARD domain-containing protein vs. Ensembl Nematostella
Match: EDO35459 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLI4])

HSP 1 Score: 59.3066 bits (142), Expect = 2.606e-9
Identity = 47/186 (25.27%), Postives = 84/186 (45.16%), Query Frame = 1
Query: 1270 QTYLTNYYIKVYNQWNPVLWYPESFVNLQSFYCPLQVLDINGS--------LIEVDEILTHKVQKGPIRTVIVEGDSGTGKSYLSHLLASKWANDPFIFGEDNNLKLVFHLDLKITAPNLKWMLLDQLFNTDMKLTERELWEVIDKHQEICLFILDGYND----NINDEVLQLISGAIFPNSRLII 1791
            Q  L ++Y        P+ W     ++++  Y  L+++             L   +E+     ++   + +++EG +G GKS L   +A  WA +  +        +VF ++LK     +   + D L   D  +T  +L++ +  HQE  LFILDGY++     + D V  LISG I   S +I+
Sbjct:  107 QETLKDHYKNEIGWLQPLTWNESFRLHIKQIYTNLELITTKQHSSSPSRKPLNSYEELFVTSSRQNKTKRILIEGKAGVGKSTLVSEMAYDWATNENL----AQFSMVFFIELKHVLGRISDAMFD-LLPKDFPITCEQLYKYVQGHQEQVLFILDGYDEIKPSRVGD-VHDLISGKILRQSTVIL 286          
BLAST of CARD domain-containing protein vs. Ensembl Nematostella
Match: EDO30788 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZT3])

HSP 1 Score: 50.447 bits (119), Expect = 5.964e-6
Identity = 32/96 (33.33%), Postives = 53/96 (55.21%), Query Frame = 1
Query: 1447 IRTVIVEGDSGTGKSYLSHLLASKWANDPFIFGED-NNLKLVFHLDLK-ITAPNLKWMLLDQLFNTDMKLTER-ELWEVIDKHQEICLFILDGYND 1725
            +R+V++EGDSG GK+ L   +A  WA       E    ++LV  L  K +++      + DQLF  +  + +R E+ + I ++Q   L ILDGY++
Sbjct:  371 VRSVLLEGDSGAGKTTLCKKIAYDWATGVLAKTESFPQVELVLSLKCKGMSSKGFPQAIQDQLFPEEFSVQDRVEVVQYIKENQNKVLIILDGYDE 466          
BLAST of CARD domain-containing protein vs. Planmine SMEST
Match: SMESG000004758.1 (SMESG000004758.1)

HSP 1 Score: 2549.62 bits (6607), Expect = 0.000e+0
Identity = 1261/1268 (99.45%), Postives = 1265/1268 (99.76%), Query Frame = 1
Query:   91 MLSLAGRNKAVKISVLLPDEILFNLDNETFSEFSRLCYFITNFGILAFQNYIENSCLKNENYVDWLRQPKIHLSLRRLKCRGILTDAQWNSLYSIEKKSILFPPSDLSLLVLILKYTGIISRPEPNGWLHPPVSSDNSTGALLVKFQWIRKQIANATKMDSNTYQSNLELLIPILSHFGNNSLTEKIENFRHYELSNVDENNAFEYFKLWHKTEEKIFKLENTLEKSRENRQYEIPVLQKPINMRETSSRKIRRQKPSIFGTSFAENQNADLNKTNSKWSDIKYGIAEEEKEILRKFHPRLISEVRPDSMIDQLLTKKVLNIEESGEIFSSLNSSDQMSFLLDVLVLKNGQAFMEFLNALKSRYFELYLNIYEEYQHMKQEILANKPEGVSYCQTYLTNYYIKVYNQWNPVLWYPESFVNLQSFYCPLQVLDINGSLIEVDEILTHKVQKGPIRTVIVEGDSGTGKSYLSHLLASKWANDPFIFGEDNNLKLVFHLDLKITAPNLKWMLLDQLFNTDMKLTERELWEVIDKHQEICLFILDGYNDNINDEVLQLISGAIFPNSRLIIFSNSSATSLIRGFCQEKYVLTGFMSGESINFTKKYIKLTPRPYEMFESLLQKLSKNIPRNKFGKSPKNEEPLNKINPNDELPILHNTGLVNQNKESPNWVDSEISFLGKQRAGSIIPGALMGFTKPNGRTSSRLSLIVNDSKNIKETSEETQFGLVSESESNSQERLTALRFYSQFPLYCSFFCLMTDLKLSIDLTSWSSMLEHFFTSIKMKLIERERESRFSVNRIFNTLIELSFESIKQGLATTFVKEADKLTKFGILRKAPSSNVNFTSKYVFHNDVIQNFLAAKCLDLYGLEEANSYFQNITITKSMYMLIIFYCGIRRNDFETAALRTLFRKXXXXXXXXXXXXSDSGDYSNAKSRSVNIMKFQLSLDCVAAMNGRKDLTLKVGQTLPERLLIEHTCTIPVLTLQGLSFIIDLSCKNIKELDIRLNYLSRQTPEAFQNLANSIQQNTSIKILRIFWEQLELMSSFFSRVCEKNQSINTIEFFDESNHQYENFPQNVAFNIRNACKNMKSVEGFAFKDCIFPSLTHAIIRNIPDNLVSIDLSGCIFTIIACKDLAEKIIQSRQLKILKLEKIQIQSMAFNTFIRSLCNNRTVIELNLSGIKMDNVCFFSLAEALKLNNRLEVLILLDIIINEHNCSEIAQVLRVNNTLKELRITESKVSSPGQIEMQKYAKTTKITGMSLQKPKLPIKDKESELFNL 3894
            MLSLAGRNKAVKISVLLPDEILFNLDNETFSEFSRLCYFITNFGILAFQNYIENSCLKNENY+DWLRQPKIHLSLRRLKCRGILTD QWNSLYSIEKKSILFPPSDLSLLVLILKYTGIISRPEPNGWLHPPVSSDNSTGALLVKFQWIRKQIANATKMDSNTYQSNLELLIPILSHFGNNSLTEKIENFRHYELSNVDENNAFEYFKLWHKTEEKIFKLENTLEKSRENRQYEIPVLQKPINMRETSSRKIRRQKPSIFGT+FAENQNADLNKTNSKWSDIKYGIAEEEKEILRKFHPRLISEVRPDSMIDQLLTKKVLNIEESGEIFSSLNSSDQMSFLLDVLVLKNGQAFMEFLNALKSRYFELYLNIYEEYQHMKQEILANKPEGVSYCQTYLTNYYIK+YNQWNPVLWYPESFVNLQSFYCPLQVLDINGSLIEVDEILTHKVQKGPIRTVIVEGDSGTGKSYLSHLLASKWANDPFIFGEDNNLKLVFHLDLKITAPNLKWMLLDQLFNTDMKLTERELWEVIDKHQEICLFILDGYNDNINDEVLQLISGAIFPNSRLIIFSNSSATSLIRGFCQEKYVLTGFMSGESINFTKKYIKLTPRPYEMFESLLQKLSKNIPRNKFGKSPKNEEPLNKINPNDELPILHNTGLVNQNKESPNWVDSEISFLGKQRAGSIIPGALMGFTKPNGRTSSRLSLIVNDSKNIKETSEETQFGLVSESESNSQERLTALRFYSQFPLYCSFFCLMTDLKLSIDLTSWSSMLEHFFTSIKMKLIERERESRFSVNRIFNTLIELSFESIKQGLATTFVKEADKLTKFGILRKAPSSNVNFTSKYVFHNDVIQNFLAAKCLDLYGLEEANSYFQNITITKSMYMLIIFYCGIRRNDFETAALRTLFRKIIDLNLQILINDSDSGDYSNAKSRSVNIMKFQLSLDCVAAMNGRKDLTLKVGQTLPERLLIEHTCTIPVLTLQGLSFIIDLSCKNIKELDIRLNYLSRQTPEAFQNLANSIQQNTSIKILRIFWEQLELMSSFFSRVCEKNQSINTIEFFDESNHQ ENFPQNVAFNIR ACKNMKSVEGFAFKDC+FPSLTHAIIRNIPDNLVSIDLSGCIFTIIACKDLAEKIIQSRQLKILKLEKIQIQSMAFNTFIRSLCNNRTVIELNLSGIKMDNVCFFSLAEALKLNNRLEVLILLDIIINEHNCSEIAQVLRVNNTLKELRITESKVSSPGQIEMQKYAKTTKITGMSLQKPKLPIKDKESELFNL
Sbjct:    1 MLSLAGRNKAVKISVLLPDEILFNLDNETFSEFSRLCYFITNFGILAFQNYIENSCLKNENYIDWLRQPKIHLSLRRLKCRGILTDVQWNSLYSIEKKSILFPPSDLSLLVLILKYTGIISRPEPNGWLHPPVSSDNSTGALLVKFQWIRKQIANATKMDSNTYQSNLELLIPILSHFGNNSLTEKIENFRHYELSNVDENNAFEYFKLWHKTEEKIFKLENTLEKSRENRQYEIPVLQKPINMRETSSRKIRRQKPSIFGTNFAENQNADLNKTNSKWSDIKYGIAEEEKEILRKFHPRLISEVRPDSMIDQLLTKKVLNIEESGEIFSSLNSSDQMSFLLDVLVLKNGQAFMEFLNALKSRYFELYLNIYEEYQHMKQEILANKPEGVSYCQTYLTNYYIKIYNQWNPVLWYPESFVNLQSFYCPLQVLDINGSLIEVDEILTHKVQKGPIRTVIVEGDSGTGKSYLSHLLASKWANDPFIFGEDNNLKLVFHLDLKITAPNLKWMLLDQLFNTDMKLTERELWEVIDKHQEICLFILDGYNDNINDEVLQLISGAIFPNSRLIIFSNSSATSLIRGFCQEKYVLTGFMSGESINFTKKYIKLTPRPYEMFESLLQKLSKNIPRNKFGKSPKNEEPLNKINPNDELPILHNTGLVNQNKESPNWVDSEISFLGKQRAGSIIPGALMGFTKPNGRTSSRLSLIVNDSKNIKETSEETQFGLVSESESNSQERLTALRFYSQFPLYCSFFCLMTDLKLSIDLTSWSSMLEHFFTSIKMKLIERERESRFSVNRIFNTLIELSFESIKQGLATTFVKEADKLTKFGILRKAPSSNVNFTSKYVFHNDVIQNFLAAKCLDLYGLEEANSYFQNITITKSMYMLIIFYCGIRRNDFETAALRTLFRKIIDLNLQILINDSDSGDYSNAKSRSVNIMKFQLSLDCVAAMNGRKDLTLKVGQTLPERLLIEHTCTIPVLTLQGLSFIIDLSCKNIKELDIRLNYLSRQTPEAFQNLANSIQQNTSIKILRIFWEQLELMSSFFSRVCEKNQSINTIEFFDESNHQNENFPQNVAFNIRKACKNMKSVEGFAFKDCVFPSLTHAIIRNIPDNLVSIDLSGCIFTIIACKDLAEKIIQSRQLKILKLEKIQIQSMAFNTFIRSLCNNRTVIELNLSGIKMDNVCFFSLAEALKLNNRLEVLILLDIIINEHNCSEIAQVLRVNNTLKELRITESKVSSPGQIEMQKYAKTTKITGMSLQKPKLPIKDKESELFNL 1268          
BLAST of CARD domain-containing protein vs. Planmine SMEST
Match: SMESG000004758.1 (SMESG000004758.1)

HSP 1 Score: 2512.26 bits (6510), Expect = 0.000e+0
Identity = 1245/1268 (98.19%), Postives = 1250/1268 (98.58%), Query Frame = 1
Query:   91 MLSLAGRNKAVKISVLLPDEILFNLDNETFSEFSRLCYFITNFGILAFQNYIENSCLKNENYVDWLRQPKIHLSLRRLKCRGILTDAQWNSLYSIEKKSILFPPSDLSLLVLILKYTGIISRPEPNGWLHPPVSSDNSTGALLVKFQWIRKQIANATKMDSNTYQSNLELLIPILSHFGNNSLTEKIENFRHYELSNVDENNAFEYFKLWHKTEEKIFKLENTLEKSRENRQYEIPVLQKPINMRETSSRKIRRQKPSIFGTSFAENQNADLNKTNSKWSDIKYGIAEEEKEILRKFHPRLISEVRPDSMIDQLLTKKVLNIEESGEIFSSLNSSDQMSFLLDVLVLKNGQAFMEFLNALKSRYFELYLNIYEEYQHMKQEILANKPEGVSYCQTYLTNYYIKVYNQWNPVLWYPESFVNLQSFYCPLQVLDINGSLIEVDEILTHKVQKGPIRTVIVEGDSGTGKSYLSHLLASKWANDPFIFGEDNNLKLVFHLDLKITAPNLKWMLLDQLFNTDMKLTERELWEVIDKHQEICLFILDGYNDNINDEVLQLISGAIFPNSRLIIFSNSSATSLIRGFCQEKYVLTGFMSGESINFTKKYIKLTPRPYEMFESLLQKLSKNIPRNKFGKSPKNEEPLNKINPNDELPILHNTGLVNQNKESPNWVDSEISFLGKQRAGSIIPGALMGFTKPNGRTSSRLSLIVNDSKNIKETSEETQFGLVSESESNSQERLTALRFYSQFPLYCSFFCLMTDLKLSIDLTSWSSMLEHFFTSIKMKLIERERESRFSVNRIFNTLIELSFESIKQGLATTFVKEADKLTKFGILRKAPSSNVNFTSKYVFHNDVIQNFLAAKCLDLYGLEEANSYFQNITITKSMYMLIIFYCGIRRNDFETAALRTLFRKXXXXXXXXXXXXSDSGDYSNAKSRSVNIMKFQLSLDCVAAMNGRKDLTLKVGQTLPERLLIEHTCTIPVLTLQGLSFIIDLSCKNIKELDIRLNYLSRQTPEAFQNLANSIQQNTSIKILRIFWEQLELMSSFFSRVCEKNQSINTIEFFDESNHQYENFPQNVAFNIRNACKNMKSVEGFAFKDCIFPSLTHAIIRNIPDNLVSIDLSGCIFTIIACKDLAEKIIQSRQLKILKLEKIQIQSMAFNTFIRSLCNNRTVIELNLSGIKMDNVCFFSLAEALKLNNRLEVLILLDIIINEHNCSEIAQVLRVNNTLKELRITESKVSSPGQIEMQKYAKTTKITGMSLQKPKLPIKDKESELFNL 3894
            MLSLAGRNKAVKISVLLPDEILFNLDNETFSEFSRLCYFITNFGILAFQNYIENSCLKNENY+DWLRQPKIHLSLRRLKCRGILTD QWNSLYSIEKKSILFPPSDLSLLVLILKYTGIISRPEPNGWLHPPVSSDNSTGALLVKFQWIRKQIANATKMDSNTYQSNLELLIPILSHFGNNSLTEKIENFRHYELSNVDENNAFEYFKLWHKTEEKIFKLENTLEKSRENRQYEIPVLQKPINMRETSSRKIRRQKPSIFGT+FAENQNADLNKTNSKWSDIKYGIAEEEKEILRKFHPRLISEVRPDSMIDQLLTKKVLNIEESGEIFSSLNSSDQMSFLLDVLVLKNGQAFMEFLNALKSRYFELYLNIYEEYQHMKQEILANKPEGVSYCQTYLTNYYIK+YNQWNPVLWYPESFVNLQSFYCPLQVLDINGSLIEVDEILTHKVQKGPIRTVIVEGDSGTGKSYLSHLLASKWANDPFIFGEDNNLKLVFHLDLKITAPNLKWMLLDQLFNTDMKLTERELWEVIDKHQEICLFILDGYNDNINDEVLQLISGAIFPNSRLIIFSNSSATSLIRGFCQEKYVLTGFMSGESINFTKKYIKLTPRPYEMFESLLQKLSKNIPRNKFGKSPKNEEPLNKINPNDELPILHNTGLVNQNKESPNWVDSEISFLGKQRAGSIIPGALMGFTKPNGRT               +TSEETQFGLVSESESNSQERLTALRFYSQFPLYCSFFCLMTDLKLSIDLTSWSSMLEHFFTSIKMKLIERERESRFSVNRIFNTLIELSFESIKQGLATTFVKEADKLTKFGILRKAPSSNVNFTSKYVFHNDVIQNFLAAKCLDLYGLEEANSYFQNITITKSMYMLIIFYCGIRRNDFETAALRTLFRKIIDLNLQILINDSDSGDYSNAKSRSVNIMKFQLSLDCVAAMNGRKDLTLKVGQTLPERLLIEHTCTIPVLTLQGLSFIIDLSCKNIKELDIRLNYLSRQTPEAFQNLANSIQQNTSIKILRIFWEQLELMSSFFSRVCEKNQSINTIEFFDESNHQ ENFPQNVAFNIR ACKNMKSVEGFAFKDC+FPSLTHAIIRNIPDNLVSIDLSGCIFTIIACKDLAEKIIQSRQLKILKLEKIQIQSMAFNTFIRSLCNNRTVIELNLSGIKMDNVCFFSLAEALKLNNRLEVLILLDIIINEHNCSEIAQVLRVNNTLKELRITESKVSSPGQIEMQKYAKTTKITGMSLQKPKLPIKDKESELFNL
Sbjct:    1 MLSLAGRNKAVKISVLLPDEILFNLDNETFSEFSRLCYFITNFGILAFQNYIENSCLKNENYIDWLRQPKIHLSLRRLKCRGILTDVQWNSLYSIEKKSILFPPSDLSLLVLILKYTGIISRPEPNGWLHPPVSSDNSTGALLVKFQWIRKQIANATKMDSNTYQSNLELLIPILSHFGNNSLTEKIENFRHYELSNVDENNAFEYFKLWHKTEEKIFKLENTLEKSRENRQYEIPVLQKPINMRETSSRKIRRQKPSIFGTNFAENQNADLNKTNSKWSDIKYGIAEEEKEILRKFHPRLISEVRPDSMIDQLLTKKVLNIEESGEIFSSLNSSDQMSFLLDVLVLKNGQAFMEFLNALKSRYFELYLNIYEEYQHMKQEILANKPEGVSYCQTYLTNYYIKIYNQWNPVLWYPESFVNLQSFYCPLQVLDINGSLIEVDEILTHKVQKGPIRTVIVEGDSGTGKSYLSHLLASKWANDPFIFGEDNNLKLVFHLDLKITAPNLKWMLLDQLFNTDMKLTERELWEVIDKHQEICLFILDGYNDNINDEVLQLISGAIFPNSRLIIFSNSSATSLIRGFCQEKYVLTGFMSGESINFTKKYIKLTPRPYEMFESLLQKLSKNIPRNKFGKSPKNEEPLNKINPNDELPILHNTGLVNQNKESPNWVDSEISFLGKQRAGSIIPGALMGFTKPNGRT---------------KTSEETQFGLVSESESNSQERLTALRFYSQFPLYCSFFCLMTDLKLSIDLTSWSSMLEHFFTSIKMKLIERERESRFSVNRIFNTLIELSFESIKQGLATTFVKEADKLTKFGILRKAPSSNVNFTSKYVFHNDVIQNFLAAKCLDLYGLEEANSYFQNITITKSMYMLIIFYCGIRRNDFETAALRTLFRKIIDLNLQILINDSDSGDYSNAKSRSVNIMKFQLSLDCVAAMNGRKDLTLKVGQTLPERLLIEHTCTIPVLTLQGLSFIIDLSCKNIKELDIRLNYLSRQTPEAFQNLANSIQQNTSIKILRIFWEQLELMSSFFSRVCEKNQSINTIEFFDESNHQNENFPQNVAFNIRKACKNMKSVEGFAFKDCVFPSLTHAIIRNIPDNLVSIDLSGCIFTIIACKDLAEKIIQSRQLKILKLEKIQIQSMAFNTFIRSLCNNRTVIELNLSGIKMDNVCFFSLAEALKLNNRLEVLILLDIIINEHNCSEIAQVLRVNNTLKELRITESKVSSPGQIEMQKYAKTTKITGMSLQKPKLPIKDKESELFNL 1253          
The following BLAST results are available for this feature:
BLAST of CARD domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
NLRC33.947e-730.71NLR family CARD domain containing 3 [Source:HGNC S... [more]
NLRC33.370e-630.53NLR family CARD domain containing 3 [Source:HGNC S... [more]
NLRC33.692e-630.71NLR family CARD domain containing 3 [Source:HGNC S... [more]
back to top
BLAST of CARD domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CARD domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CARD domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CARD domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CARD domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CARD domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CARD domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8FYV40.000e+034.58CARD domain-containing protein OS=Macrostomum lign... [more]
A0A267DGN70.000e+034.58CARD domain-containing protein OS=Macrostomum lign... [more]
A0A267FPC00.000e+034.66CARD domain-containing protein OS=Macrostomum lign... [more]
A0A267DFS10.000e+035.38CARD domain-containing protein OS=Macrostomum lign... [more]
A0A267GNH00.000e+037.21CARD domain-containing protein OS=Macrostomum lign... [more]
back to top
BLAST of CARD domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CARD domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CARD domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CARD domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO354592.606e-925.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO307885.964e-633.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CARD domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CARD domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000004758.10.000e+099.45SMESG000004758.1[more]
SMESG000004758.10.000e+098.19SMESG000004758.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032237 ID=SMED30032237|Name=CARD domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3907bp
TTATATATGAATCGTTCATCTGTTAAATTTTTATAAAATATTTGTTGGAA
TATTTTTACTTTCAATTTGACAATTCTATCACTATCACACATGCTATCTT
TGGCGGGGCGCAATAAAGCTGTGAAGATATCTGTTTTGTTGCCGGACGAG
ATCTTATTCAATTTAGACAATGAAACATTTTCCGAATTTAGCAGGTTATG
CTATTTTATTACAAATTTCGGGATTTTGGCATTTCAAAATTACATTGAAA
ATAGTTGCTTAAAAAACGAGAACTATGTAGATTGGCTAAGACAGCCGAAA
ATACATCTCAGTTTGCGACGGTTGAAGTGTCGGGGTATCTTAACTGATGC
TCAATGGAATTCGTTGTATTCTATTGAAAAGAAGTCTATTCTATTTCCGC
CTTCTGATCTCAGTCTTTTAGTTTTAATCCTCAAGTATACTGGCATTATT
AGCCGACCAGAACCAAATGGTTGGCTGCATCCTCCTGTATCTTCTGATAA
TAGTACTGGGGCGCTTTTGGTGAAGTTTCAATGGATCAGAAAGCAAATTG
CAAATGCTACAAAAATGGATTCTAATACCTATCAGTCAAATCTGGAGCTT
CTTATTCCAATATTATCTCACTTTGGAAATAATTCATTGACAGAAAAGAT
TGAAAACTTCAGACATTACGAACTTAGTAATGTTGATGAAAACAACGCGT
TTGAATATTTCAAATTATGGCATAAAACAGAAGAAAAGATATTCAAGTTA
GAAAATACTCTCGAAAAATCTAGAGAAAATCGACAATATGAAATTCCAGT
ACTCCAAAAACCTATAAATATGAGAGAAACGTCCTCCAGGAAAATTAGAC
GACAGAAGCCATCAATATTTGGAACTAGTTTTGCGGAAAATCAGAACGCC
GATTTGAATAAAACAAACTCCAAATGGTCCGATATTAAATATGGAATAGC
CGAAGAAGAAAAAGAAATATTAAGAAAGTTCCATCCTAGATTAATATCGG
AAGTTAGACCTGATTCAATGATTGATCAACTACTAACAAAAAAGGTCCTT
AACATTGAAGAAAGTGGAGAGATTTTTAGCAGTCTGAACAGTTCAGATCA
AATGAGTTTTTTGTTAGATGTTCTTGTTTTGAAAAATGGTCAAGCTTTTA
TGGAATTTTTAAATGCTTTAAAAAGCAGATATTTCGAACTTTATCTAAAT
ATTTATGAAGAATATCAACACATGAAACAGGAAATTCTCGCTAACAAACC
AGAAGGCGTATCATATTGTCAGACGTATCTTACCAATTATTACATAAAAG
TTTACAATCAGTGGAATCCAGTATTGTGGTATCCTGAGTCTTTTGTAAAT
CTTCAATCATTTTATTGTCCACTCCAAGTTTTAGATATCAATGGCTCACT
AATAGAAGTAGATGAAATACTTACTCACAAAGTTCAAAAAGGTCCGATTC
GAACTGTAATAGTTGAAGGTGACTCTGGAACTGGTAAATCATACCTTTCT
CATTTGTTAGCATCTAAATGGGCAAATGATCCGTTCATTTTTGGTGAAGA
CAATAATTTGAAACTCGTCTTCCATCTGGACTTGAAAATCACAGCACCAA
ATTTAAAATGGATGTTATTGGATCAGTTATTTAATACAGATATGAAATTA
ACAGAAAGAGAACTTTGGGAGGTTATTGATAAACACCAAGAAATTTGCTT
ATTTATTCTCGACGGTTACAATGATAACATCAATGATGAAGTGCTACAGC
TGATTTCAGGAGCAATATTTCCCAATTCTCGACTGATAATATTTAGTAAC
TCATCCGCTACCAGCTTAATTCGAGGTTTTTGTCAAGAGAAATATGTATT
GACAGGATTTATGTCTGGTGAGTCTATTAATTTTACTAAAAAATATATAA
AATTAACTCCGAGACCCTATGAAATGTTTGAAAGTCTTTTGCAGAAATTG
TCCAAAAATATTCCCAGAAATAAATTTGGTAAATCTCCCAAAAATGAAGA
ACCATTGAATAAGATCAATCCAAACGATGAACTTCCCATACTGCACAATA
CAGGCCTAGTTAATCAAAATAAAGAAAGTCCCAATTGGGTAGATTCAGAA
ATATCTTTCCTTGGTAAACAACGTGCCGGAAGTATTATTCCGGGTGCACT
GATGGGATTCACAAAACCAAATGGGAGAACGAGTAGTAGATTATCTTTGA
TCGTAAATGATTCTAAAAACATTAAAGAAACTTCTGAAGAAACGCAATTC
GGGCTAGTTAGTGAATCTGAATCGAATTCGCAAGAGCGATTAACAGCATT
GAGATTTTATTCACAATTTCCTCTTTATTGCTCTTTTTTCTGTTTAATGA
CCGACTTAAAATTGAGTATAGACCTCACTTCTTGGTCATCAATGCTTGAA
CACTTTTTTACATCAATTAAAATGAAGTTGATCGAAAGAGAGCGTGAAAG
TCGGTTTTCAGTGAATCGGATTTTCAACACGTTGATAGAACTGTCTTTTG
AGTCCATAAAGCAAGGACTAGCCACTACTTTCGTAAAGGAGGCCGATAAA
TTGACAAAATTTGGTATTTTGAGAAAAGCTCCTTCATCAAATGTAAATTT
TACTTCAAAATATGTTTTCCACAATGACGTCATACAAAACTTCCTAGCCG
CAAAATGTCTTGATCTTTACGGTTTGGAAGAAGCGAATAGTTATTTTCAG
AACATCACTATTACGAAATCCATGTATATGCTCATTATTTTTTATTGCGG
AATACGAAGGAATGATTTTGAAACGGCTGCCCTAAGAACTCTTTTCAGAA
AGATTATAGACCTTAACTTACAAATACTAATAAATGATTCTGATTCCGGG
GATTATTCTAATGCTAAATCACGTTCTGTAAATATTATGAAATTTCAATT
AAGTTTGGATTGCGTGGCCGCAATGAACGGTAGGAAGGATTTGACATTAA
AGGTTGGACAAACCCTTCCGGAAAGACTTTTAATTGAACATACTTGTACT
ATTCCTGTGTTGACTTTGCAAGGGCTATCCTTTATTATCGACTTAAGCTG
TAAAAATATTAAAGAATTGGATATTCGACTGAATTACCTTAGCCGTCAAA
CTCCTGAAGCATTTCAAAATTTGGCAAATTCCATTCAACAAAATACCTCA
ATCAAAATTTTAAGAATCTTTTGGGAACAACTTGAGTTGATGAGTTCTTT
CTTCAGTAGAGTATGTGAAAAGAATCAGTCCATAAATACGATAGAATTCT
TTGATGAGTCGAATCATCAATATGAGAACTTTCCTCAAAACGTTGCGTTT
AATATCCGTAACGCTTGCAAAAATATGAAAAGTGTAGAAGGGTTCGCTTT
TAAAGATTGTATATTTCCTAGCCTTACCCATGCAATCATTAGAAATATCC
CGGATAATCTCGTGTCTATTGATCTTAGTGGATGCATTTTTACAATAATA
GCCTGCAAAGATCTTGCGGAAAAAATTATCCAAAGTAGACAATTGAAAAT
TTTAAAGTTAGAAAAAATTCAAATTCAAAGCATGGCTTTCAATACCTTTA
TCCGATCCTTGTGTAATAACCGAACCGTGATTGAGCTCAACTTGAGTGGC
ATTAAAATGGACAATGTTTGTTTCTTTTCGTTGGCGGAAGCATTGAAGCT
AAATAATAGATTGGAGGTTTTAATTTTGTTAGACATTATTATCAATGAAC
ACAATTGTTCTGAAATTGCACAAGTCTTACGAGTTAATAACACGTTGAAA
GAATTACGTATAACCGAAAGTAAGGTTTCCTCGCCAGGTCAGATTGAGAT
GCAAAAATATGCAAAAACCACAAAAATAACTGGCATGAGCCTCCAGAAGC
CTAAGTTACCTATTAAAGATAAAGAATCAGAATTATTCAATCTTTAATTC
TTTTTTG
back to top

protein sequence of SMED30032237-orf-1

>SMED30032237-orf-1 ID=SMED30032237-orf-1|Name=SMED30032237-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1269bp
MLSLAGRNKAVKISVLLPDEILFNLDNETFSEFSRLCYFITNFGILAFQN
YIENSCLKNENYVDWLRQPKIHLSLRRLKCRGILTDAQWNSLYSIEKKSI
LFPPSDLSLLVLILKYTGIISRPEPNGWLHPPVSSDNSTGALLVKFQWIR
KQIANATKMDSNTYQSNLELLIPILSHFGNNSLTEKIENFRHYELSNVDE
NNAFEYFKLWHKTEEKIFKLENTLEKSRENRQYEIPVLQKPINMRETSSR
KIRRQKPSIFGTSFAENQNADLNKTNSKWSDIKYGIAEEEKEILRKFHPR
LISEVRPDSMIDQLLTKKVLNIEESGEIFSSLNSSDQMSFLLDVLVLKNG
QAFMEFLNALKSRYFELYLNIYEEYQHMKQEILANKPEGVSYCQTYLTNY
YIKVYNQWNPVLWYPESFVNLQSFYCPLQVLDINGSLIEVDEILTHKVQK
GPIRTVIVEGDSGTGKSYLSHLLASKWANDPFIFGEDNNLKLVFHLDLKI
TAPNLKWMLLDQLFNTDMKLTERELWEVIDKHQEICLFILDGYNDNINDE
VLQLISGAIFPNSRLIIFSNSSATSLIRGFCQEKYVLTGFMSGESINFTK
KYIKLTPRPYEMFESLLQKLSKNIPRNKFGKSPKNEEPLNKINPNDELPI
LHNTGLVNQNKESPNWVDSEISFLGKQRAGSIIPGALMGFTKPNGRTSSR
LSLIVNDSKNIKETSEETQFGLVSESESNSQERLTALRFYSQFPLYCSFF
CLMTDLKLSIDLTSWSSMLEHFFTSIKMKLIERERESRFSVNRIFNTLIE
LSFESIKQGLATTFVKEADKLTKFGILRKAPSSNVNFTSKYVFHNDVIQN
FLAAKCLDLYGLEEANSYFQNITITKSMYMLIIFYCGIRRNDFETAALRT
LFRKIIDLNLQILINDSDSGDYSNAKSRSVNIMKFQLSLDCVAAMNGRKD
LTLKVGQTLPERLLIEHTCTIPVLTLQGLSFIIDLSCKNIKELDIRLNYL
SRQTPEAFQNLANSIQQNTSIKILRIFWEQLELMSSFFSRVCEKNQSINT
IEFFDESNHQYENFPQNVAFNIRNACKNMKSVEGFAFKDCIFPSLTHAII
RNIPDNLVSIDLSGCIFTIIACKDLAEKIIQSRQLKILKLEKIQIQSMAF
NTFIRSLCNNRTVIELNLSGIKMDNVCFFSLAEALKLNNRLEVLILLDII
INEHNCSEIAQVLRVNNTLKELRITESKVSSPGQIEMQKYAKTTKITGMS
LQKPKLPIKDKESELFNL*
back to top

protein sequence of SMED30032237-orf-2

>SMED30032237-orf-2 ID=SMED30032237-orf-2|Name=SMED30032237-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=103bp
MTSLWKTYFEVKFTFDEGAFLKIPNFVNLSASFTKVVASPCFMDSKDSSI
NVLKIRFTENRLSRSLSINFILIDVKKCSSIDDQEVRSILNFKSVIKQKK
EQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
Vocabulary: INTERPRO
TermDefinition
IPR041249HEPN_DZIP3
IPR007111NACHT_NTPase
IPR011029DEATH-like_dom_sf
IPR001315CARD
IPR027417P-loop_NTPase
IPR032675LRR_dom_sf
IPR025662Sigma_54_int_dom_ATP-bd_1
Vocabulary: biological process
TermDefinition
GO:0042981regulation of apoptotic process
Vocabulary: molecular function
TermDefinition
GO:0016874ligase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR041249DZIP3-like HEPN domainPFAMPF18738HEPN_DZIP3coord: 67..198
e-value: 9.5E-10
score: 38.4
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 963..1251
e-value: 1.6E-21
score: 78.2
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 386..585
e-value: 1.0E-24
score: 89.0
NoneNo IPR availableGENE3DG3DSA:1.10.533.10coord: 274..385
e-value: 2.5E-13
score: 51.8
NoneNo IPR availablePANTHERPTHR46844:SF1coord: 250..620
NoneNo IPR availablePANTHERPTHR46844FAMILY NOT NAMEDcoord: 250..620
NoneNo IPR availableCDDcd01671CARDcoord: 294..364
e-value: 1.02736E-8
score: 51.3633
NoneNo IPR availableSUPERFAMILYSSF52047RNI-likecoord: 980..1246
IPR007111NACHT nucleoside triphosphatasePFAMPF05729NACHTcoord: 454..594
e-value: 1.1E-11
score: 44.9
IPR001315CARD domainPFAMPF00619CARDcoord: 292..368
e-value: 1.5E-8
score: 34.6
IPR001315CARD domainPROSITEPS50209CARDcoord: 286..375
score: 13.921
IPR025662Sigma-54 interaction domain, ATP-binding site 1PROSITEPS00675SIGMA54_INTERACT_1coord: 456..469
IPR011029Death-like domain superfamilySUPERFAMILYSSF47986DEATH domaincoord: 288..372
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 443..620