Arachidonate 5-lipoxygenase

Overview
NameArachidonate 5-lipoxygenase
Smed IDSMED30032236
Length (bp)2684
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Arachidonate 5-lipoxygenase (SMED30032236) t-SNE clustered cells

Violin plots show distribution of expression levels for Arachidonate 5-lipoxygenase (SMED30032236) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Arachidonate 5-lipoxygenase (SMED30032236) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Arachidonate 5-lipoxygenase (SMED30032236) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Human
Match: ALOX5 (arachidonate 5-lipoxygenase [Source:HGNC Symbol;Acc:HGNC:435])

HSP 1 Score: 171.014 bits (432), Expect = 8.419e-44
Identity = 154/673 (22.88%), Postives = 297/673 (44.13%), Query Frame = 2
Query:  323 KLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDP---FSETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXXKFSKSEKWDIDNAKLDAINQRRLTD-------LYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLE-GWSVKHVIKARRLYIVDFKIMDGLNC-KPD----RIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDP-MQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQ-TSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARVTQS--VLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQYYCMDPSILPN 2278
            ++E  ++W ++      DWYL+ + ++   HG     +Y  FP ++WI G    +  D       +D      + R +E+  +Q+ +   + + GFP+ ++    +    +  ++D +      +N  +  +       ++  QS W+   +   ++ + + T    + N    D+ FG Q L GCNP++++ CTE+P+   VT E ++  LE   S++  ++   ++IVDF+++DG++  K D    + + AP+ L +     ++ P+AIQL Q   + N +FLPSD    WLLAK+W   +D   H  +  L+   ++  ++ + M R     HPI++LL  H    + ++ K +E +  + G   +       G  Q+V+RA K+ ++  +    + +++R +   + +  Y YRDD LL+  A   F  ++V ++Y     D +++E          DP +QD    +          +G  KS   R++    L   +F+   Q  +VNF                                 YD   +           +P+ P      P   +    ++Q+V  LPD+  +   L +V   ++  ++   LG +  ++  +    + +  FRK LEAI   I   NK + +   YY + P  +PN
Sbjct:   69 RIEKRKYWLND------DWYLKYITLKTP-HG-----DYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHK-DLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECGLFDKANATGGGGHVQMVQRAMKDLTY-ASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVVDIYY---EGDQVVEE----------DPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNFGQ-------------------------------YDWCSW-----------IPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQL--PYYYLSPDRIPN 670          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Human
Match: ALOX5 (arachidonate 5-lipoxygenase [Source:HGNC Symbol;Acc:HGNC:435])

HSP 1 Score: 171.014 bits (432), Expect = 8.419e-44
Identity = 154/673 (22.88%), Postives = 297/673 (44.13%), Query Frame = 2
Query:  323 KLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDP---FSETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXXKFSKSEKWDIDNAKLDAINQRRLTD-------LYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLE-GWSVKHVIKARRLYIVDFKIMDGLNC-KPD----RIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDP-MQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQ-TSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARVTQS--VLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQYYCMDPSILPN 2278
            ++E  ++W ++      DWYL+ + ++   HG     +Y  FP ++WI G    +  D       +D      + R +E+  +Q+ +   + + GFP+ ++    +    +  ++D +      +N  +  +       ++  QS W+   +   ++ + + T    + N    D+ FG Q L GCNP++++ CTE+P+   VT E ++  LE   S++  ++   ++IVDF+++DG++  K D    + + AP+ L +     ++ P+AIQL Q   + N +FLPSD    WLLAK+W   +D   H  +  L+   ++  ++ + M R     HPI++LL  H    + ++ K +E +  + G   +       G  Q+V+RA K+ ++  +    + +++R +   + +  Y YRDD LL+  A   F  ++V ++Y     D +++E          DP +QD    +          +G  KS   R++    L   +F+   Q  +VNF                                 YD   +           +P+ P      P   +    ++Q+V  LPD+  +   L +V   ++  ++   LG +  ++  +    + +  FRK LEAI   I   NK + +   YY + P  +PN
Sbjct:   69 RIEKRKYWLND------DWYLKYITLKTP-HG-----DYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHK-DLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECGLFDKANATGGGGHVQMVQRAMKDLTY-ASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVVDIYY---EGDQVVEE----------DPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNFGQ-------------------------------YDWCSW-----------IPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQL--PYYYLSPDRIPN 670          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Human
Match: ALOX5 (arachidonate 5-lipoxygenase [Source:HGNC Symbol;Acc:HGNC:435])

HSP 1 Score: 161.384 bits (407), Expect = 8.156e-41
Identity = 125/515 (24.27%), Postives = 244/515 (47.38%), Query Frame = 2
Query:  323 KLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDP---FSETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXXKFSKSEKWDIDNAKLDAINQRRLTD-------LYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLE-GWSVKHVIKARRLYIVDFKIMDGLNC-KPD----RIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDP-MQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQ-TSVNF 1810
            ++E  ++W ++      DWYL+ + ++   HG     +Y  FP ++WI G    +  D       +D      + R +E+  +Q+ +   + + GFP+ ++    +    +  ++D +      +N  +  +       ++  QS W+   +   ++ + + T    + N    D+ FG Q L GCNP++++ CTE+P+   VT E ++  LE   S++  ++   ++IVDF+++DG++  K D    + + AP+ L +     ++ P+AIQL Q   + N +FLPSD    WLLAK+W   +D   H  +  L+   ++  ++ + M R     HPI++LL  H    + ++ K +E +  + G   +       G  Q+V+RA K+ ++  +    + +++R +   + +  Y YRDD LL+  A   F  ++V ++Y     D +++E          DP +QD    +          +G  KS   R++    L   +F+   Q  +VNF
Sbjct:   69 RIEKRKYWLND------DWYLKYITLK-TPHG-----DYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHK-DLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECGLFDKANATGGGGHVQMVQRAMKDLTY-ASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVVDIYYEG---DQVVEE----------DPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNF 556          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Human
Match: ALOX5 (arachidonate 5-lipoxygenase [Source:HGNC Symbol;Acc:HGNC:435])

HSP 1 Score: 161.384 bits (407), Expect = 8.156e-41
Identity = 125/515 (24.27%), Postives = 244/515 (47.38%), Query Frame = 2
Query:  323 KLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDP---FSETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXXKFSKSEKWDIDNAKLDAINQRRLTD-------LYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLE-GWSVKHVIKARRLYIVDFKIMDGLNC-KPD----RIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDP-MQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQ-TSVNF 1810
            ++E  ++W ++      DWYL+ + ++   HG     +Y  FP ++WI G    +  D       +D      + R +E+  +Q+ +   + + GFP+ ++    +    +  ++D +      +N  +  +       ++  QS W+   +   ++ + + T    + N    D+ FG Q L GCNP++++ CTE+P+   VT E ++  LE   S++  ++   ++IVDF+++DG++  K D    + + AP+ L +     ++ P+AIQL Q   + N +FLPSD    WLLAK+W   +D   H  +  L+   ++  ++ + M R     HPI++LL  H    + ++ K +E +  + G   +       G  Q+V+RA K+ ++  +    + +++R +   + +  Y YRDD LL+  A   F  ++V ++Y     D +++E          DP +QD    +          +G  KS   R++    L   +F+   Q  +VNF
Sbjct:   69 RIEKRKYWLND------DWYLKYITLK-TPHG-----DYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHK-DLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECGLFDKANATGGGGHVQMVQRAMKDLTY-ASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVVDIYYEG---DQVVEE----------DPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNF 556          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Human
Match: ALOX12B (arachidonate 12-lipoxygenase, 12R type [Source:HGNC Symbol;Acc:HGNC:430])

HSP 1 Score: 157.147 bits (396), Expect = 4.227e-39
Identity = 125/514 (24.32%), Postives = 221/514 (43.00%), Query Frame = 2
Query:  731 WSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHL-EGWSVKHVIKARRLYIVDFKIMDGLNC----KPDRIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLI-NQMILENIYVCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQTSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARVT--QSVLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQY 2248
            W  L+++  ++          +      D  FG Q L G NP +++ CT IPD F VT + + P L EG  ++  ++   +Y+ D++IM+G+         +   AP+ L  F  E ++ P+AIQL+Q+      +FLPSD    WLLAK W   A+   H  +  L+   +I E   + + RN    HP+Y+LL PH    + ++   +  + ++ G  A+ + L  +G   ++ RA    ++D +  +  D   R V DL     Y YRDD+L + NA   +V +++  +YP+    +  D ELQ+W +E+                         +  L R+                 S  F   +    +L+  +T    + I  C +        ++       ++    +P+ P      P+Q +    L+  +  LPD  +T   L+ +   +R    +  LG F   +  +    + +E FR++L  I  DI + NK   I + Y
Sbjct:  233 WKRLKDIRKIFPGKKSVVSEYVAEHWAEDTFFGYQYLNGVNPGLIRRCTRIPDKFPVTDDMVAPFLGEGTCLQAELEKGNIYLADYRIMEGIPTVELSGRKQHHCAPLCLLHFGPEGKMMPIAIQLSQTPGPDCPIFLPSDSEWDWLLAKTWVRYAEFYSHEAIAHLLETHLIAEAFCLALLRNLPMCHPLYKLLIPHTRYTVQINSIGRAVLLNEGGLSAKGMSLGVEGFAGVMVRALSELTYD-SLYLPNDFVERGVQDLPG---YYYRDDSLAVWNALEKYVTEIITYYYPSD-AAVEGDPELQSWVQEIFK-----------------------ECLLGRE-----------------SSGFPRCLRTVPELIRYVT----IVIYTCSA--------KHAAVNTGQMEFTAWMPNFPASMRNPPIQTKGLTTLETFMDTLPDVKTTCITLLVLWTLSREPDDRRPLGHFPDIHFVEEAPRRSIEAFRQRLNQISHDIRQRNKCLPIPYYY 689          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Zebrafish
Match: alox5b.2 (arachidonate 5-lipoxygenase b, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-060623-19])

HSP 1 Score: 175.252 bits (443), Expect = 2.560e-45
Identity = 150/660 (22.73%), Postives = 291/660 (44.09%), Query Frame = 2
Query:  362 MMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDPFS---ETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXX-----XKFSKSEKWDIDNAKLDAINQRRLTDLYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLE-GWSVKHVIKARRLYIVDFKIMDGLNCKPDRIMPA-------PMALFFFTEEKQLKPLAIQLTQSSNEG--NLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQTSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARV--TQSVLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQYYCMDPSILPN 2278
            +++ DWY   + +           + F FP ++WI   +  +  +       ++  S   E R  E+ +++E F   +  SGF + ++           +F  ++  D       A     L  L      W    +   ++     TE   +  +   D  FG Q L GCNP+++K CT++PD F VT E ++  L+ G +++  +KA  +YI D++I++  + +P+   P+       P  LF+   + +  P+AIQL++ +  G  N VFLP+D    WLLAKMW   +D   H +V  L+   ++  ++ + M R     HP+Y+LL PH    + ++   +E + ++ G   +       GI+Q++++  +  ++  +    + ++ R V + + L NY YRDD +++  A   FV  +VK +Y +  + +  DEE+Q + +++               G +N  N                NG            F N +   E LV  LT I+  +     + +    +D Y +           +P+ P+     P   +   ++  ++ +LPD   +   L ++ + ++    +  LG +   Y  +  A++ +++FRK+L  +   I R N+  ++ + Y C  P  +PN
Sbjct:   76 LINDDWYCRSISVTAPTG------DCFEFPCYRWIADQKELVLPEGRGRLPQDEKLSILKECRHLELENRREKFRWNEWKSGFLMSIDANKSSELPLDVQFDTAKAVDFSLNAFKAAENLGLNKLESLFQSWKDFADFEKVFITIKNTESEYVMQNWTKDAVFGYQFLNGCNPVMIKKCTKLPDKFAVTQEMVENSLDRGTTLQEELKAGNIYIADYEILE--DVQPNDTDPSTQQYLATPFCLFYKNGQNEFIPIAIQLSRQTTPGEMNTVFLPTDDEYDWLLAKMWVKSSDYNVHQLVTHLLRTHLISEVFTIAMFRQLSAVHPVYKLLIPHVRFTIAINTAARETLINEGGVFGKVDSTGGIGIEQVIRKGMQTLTYK-SLCFPEAMKIRNVDNKEDLPNYYYRDDGMMVWEAVKIFVSDVVKFYY-SSDETVQEDEEIQAFVQDVCS------------YGMKNCPN----------------NGE-----------FPNALKTREQLVEYLT-IVIFTASAQHAAINFGQFDWYAW-----------IPNTPSTMRKPPPIEKGKVDMKYIMESLPDHGRSSLHLGTIWILSQFQDNELFLGVYPDKYFTEEPAMEAIKNFRKKLVDVTKTIRRRNETLELPYWYLC--PDRIPN 672          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Zebrafish
Match: alox5a (arachidonate 5-lipoxygenase a [Source:ZFIN;Acc:ZDB-GENE-090311-47])

HSP 1 Score: 165.622 bits (418), Expect = 3.958e-42
Identity = 154/667 (23.09%), Postives = 295/667 (44.23%), Query Frame = 2
Query:  323 KLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDPFS---ETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXXKFSKSEKWDIDNAKLDAIN-QRRLTDLYGDQ------SFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLE-GWSVKHVIKARRLYIVDFKIMDGLNCKPD-----RIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRREL-SDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQTSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARVTQS--VLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQYYCMDP 2263
            K+E  ++W      M  DWY + + ++        Y +Y  FP  +W+   +  I  D        D      + R +E+  +Q+ +   +   GFP+ ++    + +  +  ++D +      +N  + + +LY +Q      S W    +   ++ +   T    +      D  FG Q L GCNP+V+K CTEIPD F VT   ++  LE G +++  +K   ++I D++IMDG+          + + APM L +   + ++ P+AIQL Q   E N +FLPSD    WLLAK+W   +D   H  V  L+   ++  ++ + M R     HP+++LL PH    + ++ K +E +  + G   +       G  +LV+R+ K +++  +    +++++R +   + L  Y YRDD   +     +FV  +V ++Y +  + +  DEE+Q + +++ S  MQD                      LD+                     F  ++   E+LV  LT ++  +     + +    YD   +  N          S PT R   P++ + + +L  +V +LPD+  +   L +V   ++  ++   LG +  ++  +    +++  F K+L  +   I+  N+ + +   YY + P
Sbjct:   69 KIEKKKYW------MHDDWYCKYITVK------TPYGDYVEFPCFRWLVDDKEVILRDGRARLPQHDKTGVAKQHRRKELEQRQKTYRWKEWHPGFPMSIDCKAHK-ELPRDIQFDSEKGVDFVLNYSKAIENLYVNQFMHMFQSSWGDFADFERIFVRIKNTISEYVMEHWKEDFMFGYQYLNGCNPVVIKKCTEIPDKFPVTHNIVEDSLERGLTLEEELKEGNIFIADYEIMDGVTANSTDPCTLQYLAAPMCLLYKNSQNKIMPIAIQLHQKPGEDNPIFLPSDDEYDWLLAKIWVRSSDFHVHQTVTHLLRTHLISEVFGIAMFRQLPAVHPVFKLLLPHIRFTIAINTKAREQLICECGLFDKANGTGGGGHIELVQRSMKVFTYK-SLCFPENIKARGMDSQEELPYYFYRDDGCAVWETVKSFVSDVVDIYY-DKDETVQEDEEIQAFVKDVCSFGMQD----------------------LDQ-------------------CEFPKSLQTKEELVEYLTVVI-FTASAQHAAVNFGQYDWCSWIPN----------SPPTMRKPPPMK-KGEVDLQYIVESLPDRGRSCWHLGAVWALSQFQENELFLGMYPDEHFIEKPVKEVMVKFGKKLAEVSKTIKNRNEGKKL--PYYYLSP 665          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Zebrafish
Match: alox5a (arachidonate 5-lipoxygenase a [Source:ZFIN;Acc:ZDB-GENE-090311-47])

HSP 1 Score: 165.236 bits (417), Expect = 5.255e-42
Identity = 154/667 (23.09%), Postives = 294/667 (44.08%), Query Frame = 2
Query:  323 KLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDPFS---ETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXXKFSKSEKWDIDNAKLDAIN-QRRLTDLYGDQ------SFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLE-GWSVKHVIKARRLYIVDFKIMDGLNCKPD-----RIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRREL-SDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQTSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARVTQS--VLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQYYCMDP 2263
            K+E  ++W      M  DWY + + ++        Y +Y  FP  +W+   +  I  D        D      + R +E+  +Q+ +   +   GFP+ ++    + +  +  ++D +      +N  + + +LY +Q      S W    +   ++ +   T    +      D  FG Q L GCNP+V+K CTEIPD F VT   ++  LE G +++  +K   ++I D++IMDG+          + + APM L +   + ++ P+AIQL Q   E N +FLPSD    WLLAK+W   +D   H  V  L+   ++  ++ + M R     HP+++LL PH    + ++ K +E +  + G   +       G  +LV+R+ K +++  +    +++++R +   + L  Y YRDD   +     +FV  +V ++Y +  + +  DEE+Q + +++ S  MQD                      LD                      F  ++   E+LV  LT ++  +     + +    YD   +  N          S PT R   P++ + + +L  +V +LPD+  +   L +V   ++  ++   LG +  ++  +    +++  F K+L  +   I+  N+ + +   YY + P
Sbjct:   69 KIEKKKYW------MHDDWYCKYITVK------TPYGDYVEFPCFRWLVDDKEVILRDGRARLPQHDKTGVAKQHRRKELEQRQKTYRWKEWHPGFPMSIDCKAHK-ELPRDIQFDSEKGVDFVLNYSKAIENLYVNQFMHMFQSSWGDFADFERIFVRIKNTISEYVMEHWKEDFMFGYQYLNGCNPVVIKKCTEIPDKFPVTHNIVEDSLERGLTLEEELKEGNIFIADYEIMDGVTANSTDPCTLQYLAAPMCLLYKNSQNKIMPIAIQLHQKPGEDNPIFLPSDDEYDWLLAKIWVRSSDFHVHQTVTHLLRTHLISEVFGIAMFRQLPAVHPVFKLLLPHIRFTIAINTKAREQLICECGLFDKANGTGGGGHIELVQRSMKVFTYK-SLCFPENIKARGMDSQEELPYYFYRDDGCAVWETVKSFVSDVVDIYY-DKDETVQEDEEIQAFVKDVCSFGMQD----------------------LDH-------------------CEFPKSLQTKEELVEYLTVVI-FTASAQHAAVNFGQYDWCSWIPN----------SPPTMRKPPPMK-KGEVDLQYIVESLPDRGRSCWHLGAVWALSQFQENELFLGMYPDEHFIEKPVKEVMVKFGKKLAEVSKTIKNRNEGKKL--PYYYLSP 665          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Zebrafish
Match: si:dkey-17e16.9 (si:dkey-17e16.9 [Source:ZFIN;Acc:ZDB-GENE-091118-123])

HSP 1 Score: 162.54 bits (410), Expect = 3.598e-41
Identity = 154/644 (23.91%), Postives = 294/644 (45.65%), Query Frame = 2
Query:  374 DWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDPF---SETRLEEIRHKQEIFSLYQRSSGFXXXXX-----XXXXXXKFSKSEKWDIDNA--KLDAINQRRLTDLYGDQSFWSSLENLHNLY--SQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLE-GWSVKHVIKARRLYIVDFKIMDGLNCK----PDRIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIYVCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQTSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARVTQSV--LGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQY 2248
            DW+   V I+          +   FP ++W+         + +  K YE+ +    E R  E++  +E++      +G P +       +VP   +FS ++  DID+A  +  A+ + ++  L      W +++++   +  S+  I++ + L     +D   G Q L G NPL+L  C+E+P NF V+ + L P LE G S+   +K   +++ D+K +  L  +      + + AP+ L +  +E +L P+AIQL Q ++E + VFLPSD  + WL AK++   AD   H     L   ++ E   + + RN    HPI++LL PH    L ++  ++  +   DG ++Q   +  +G+  L+++A  + ++  +  + +D+  R+   L +L N+ YRDD L +      FVR +V+ FY N   D+  D ELQ+W  ++                     +G L+                     Q+S     + +  E+L+  LT ++  ++    + LR   +D YG             P+ P    + P   +   + + V+ ALPD +++ ++     + ++ +  +  LG++  DY  Q    K++ DF+ +L      +E  N +  + ++Y
Sbjct:   82 DWFCSLVNIKTPEK------DVISFPCYRWMTKREVIELREAKATKIYEEQYPQLKEHRQNELKLNKEVYRWTVFKAGLPQQAVFQDPLSVPSVVRFSFTK--DIDSAFNRSTALREIKMKKLAKKADQWPAIKHMKRAFWPSKTTISKYVYL--HWKDDDFLGYQLLNGPNPLMLHRCSELPLNFAVSDDMLLPFLESGTSLNVEMKQGNIFLCDYKRLADLPTQVINGKQQFVTAPLCLLYKNQEGKLLPIAIQLQQEASEHSPVFLPSDSELDWLTAKLYVRNADCLEHQAALHL-RSLLAETFTLSLLRNLPTVHPIHKLLVPHIRYTLQMNSLVRHRLIGPDGVLSQCTSIGHEGMMALMRKALSDLTYS-SLCLPEDISGRQ---LDSLPNFFYRDDGLRVWAFINDFVRSVVEFFYQND-SDVQKDTELQDWINDI-------------------FIHGFLE---------------------QSSSGIPQSFSTVEELIKFLTMMI-FTVSAQHAALRAGQFD-YG----------SWFPNTPGSLKSPPPACKGSSDKNTVLQALPDINTSANLASVFWLLSKPSADLVPLGQYPEDYFCQTAVRKMMRDFQAELAFFSEYVEDRNADLLVPYKY 657          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Zebrafish
Match: alox5b.1 (arachidonate 5-lipoxygenase b, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-131219-3])

HSP 1 Score: 161.77 bits (408), Expect = 8.074e-41
Identity = 127/503 (25.25%), Postives = 233/503 (46.32%), Query Frame = 2
Query:  362 MMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDPFS---ETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXX-----XKFSKSEKWDIDNAKLDAINQRRLTDLYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLE-GWSVKHVIKARRLYIVDFKIMDGL-----NCKPDRIMPAPMALFFFTEEKQLKPLAIQLTQSSNEG--NLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRREL-SDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYAD-LNGSVFSGGTQ-TSVNF 1810
            +++ DWY   + +           + F FP ++WI   +  +  +       ++  S   E R  E+ ++Q+ F   +   GFP+ ++           KF   +  D     L  I    L    G    W    +   ++     T    L      D  FG Q L GCNP+++K CTE+P  F VT E ++  L+ G +++  ++A  +YI D++I++ +     +    + + AP  LF+   + +  P+AIQL++ +  G  N VFLPSD    WLLAKMW    D   H +V  L+   ++  ++ + M R     HP+Y+LL PH    + ++   +E + +  G   +       G++Q++++A +  ++  +    + +++R V + + L NY YRDD +L+  A  +FV  +VK++Y +  + +  DEE+Q + +++ S  M++              KNG   S L   +   + L   +F+   Q  +VNF
Sbjct:   76 LINDDWYCRSISVTAPAG------DCFEFPCYRWIADQKELVLPEGRGRLPQDEKLSIVKECRHLELENRQKHFRWKEWKPGFPMSIDVNGSSELPLDVKFDTEKVVDFKLHFLKGIGNVGLNKCKGYYQSWKDFADFEKVFITIENTVSEHLMQRWKEDAVFGYQFLNGCNPVMIKKCTELPGKFVVTQEMVRNSLDKGTTLQDELQAGNIYIADYEILEDVQPNDTDPSTQQYLAAPFCLFYKNGQNKFIPIAIQLSREATPGQMNTVFLPSDNHYDWLLAKMWVKSCDFNVHQLVTHLLRTHLISEVFAIAMFRQLSAVHPVYKLLIPHVRFTIAINTAAREKLINDTGVFNEANSSGGIGLQQVIQKAMQTLTYK-SLCFPEAMKTRGVDNQEDLPNYYYRDDGMLVWEAVKSFVSDVVKIYY-SSDETVQGDEEIQAFVQDVCSSGMKNC------------PKNGEFPSALKTQEQLVEYLTVVIFTASAQHAAVNF 558          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Xenopus
Match: ALOX5 (arachidonate 5-lipoxygenase [Source:NCBI gene;Acc:100036609])

HSP 1 Score: 161.384 bits (407), Expect = 1.362e-40
Identity = 152/676 (22.49%), Postives = 296/676 (43.79%), Query Frame = 2
Query:  323 KLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDP---FSETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXXKFSKSEKWDIDNAKLDAINQRRLTD-------LYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLE-GWSVKHVIKARRLYIVDFKIMDGLNC-KPD----RIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSG-GTQTSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARVTQS--VLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQYYCMDPSILPNYPGV 2290
            K+E  ++W  +      DWY   + ++          +Y  FP ++WI   +  +  +       +D      + R +E++ +Q+++   +   GFP+ ++            ++D +      +N  +  +       ++  QS W+   +   ++ + + T    +      D  FG Q L GCNP+++K C +IP NF VT E ++  LE   +++  I+   ++IV+++++DG++  K D    + + AP+ L +   E ++ P+AIQL Q     N +FLPSD    WLLAK+W   +D   H  V  L+   +L  ++ + M R     HPI++LL  H    + ++ K +E +  + G   +       G  +L+ RA K ++++ +  + + ++ R +   + +  Y YRDDAL +  A   FV+ +V ++Y +  + +  DEELQ + +++                 +NT +G  K+   +DK    L   +F+  G   +VNF                                 YD   +           +P+ P      P + +    ++ ++ +LPD+  +   L +V   ++   +   LG +  ++  +    + +  FRK LE I   I+  NKN+ +   YY + P  +PN   V
Sbjct:   69 KIEKHKYWYKD------DWYCRHLTVKTPSG------DYLEFPCYRWITNDKEIVLREGTAKLSRDDVTQVLKQHRRKELQERQKLYRWKEWYPGFPLSIDAHSHS-DLPHDIQFDSEKGVDFVLNYTKAMENLFVNSFMHMFQSSWNDFADFEKIFVRISNTISEYVMQHWQEDFMFGYQFLNGCNPVMIKKCKQIPANFPVTNEMVECSLERNLTLEQEIEKGNIFIVNYELLDGISANKTDPCTMQYIAAPICLLYKNLENKIVPIAIQLNQEPGPENPIFLPSDTHYDWLLAKIWVRSSDFHVHQTVSHLLRSHLLSEVFAIAMYRQLPAVHPIFKLLIAHVRFTIAINTKAREQLICECGLFDKANATGGGGHVELLLRAMKYFTYE-SLCLPEAIQKRGMESKEDIPYYYYRDDALKVWEATLNFVKDVVNIYYASD-ETVCEDEELQAFVKDV-----------FVYGLRDNTDSGFPKAIKTKDKLTEYLTLVIFTASGQHAAVNFGQ-------------------------------YDWCSW-----------IPNSPPTMRQPPPKEKGVVTIEFIIESLPDRGRSCWHLGAVWALSQFQDNELFLGYYPDEHFVEKSVKEAMVKFRKNLEEIASFIQDRNKNKKL--PYYYLSPDRIPNSVAV 674          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Xenopus
Match: ALOX5 (arachidonate 5-lipoxygenase [Source:NCBI gene;Acc:100036609])

HSP 1 Score: 159.458 bits (402), Expect = 4.620e-40
Identity = 132/533 (24.77%), Postives = 242/533 (45.40%), Query Frame = 2
Query:  722 QSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLE-GWSVKHVIKARRLYIVDFKIMDGLNC-KPD----RIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSG-GTQTSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARV--TQSVLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQYYCMDPSILPNYPGV 2290
            QS W+   +   ++ + + T    +      D  FG Q L GCNP+++K C +IP NF VT E ++  LE   +++  I+   ++IV+++++DG++  K D    + + AP+ L +   E ++ P+AIQL Q     N +FLPSD    WLLAK+W   +D   H  V  L+   +L  ++ + M R     HPI++LL  H    + ++ K +E +  + G   +       G  +L+ RA K ++++ +  + + ++ R +   + +  Y YRDDAL +  A   FV+ +V ++Y +  + +  DEELQ + +++                 +NT +G  K+   +DK    L   +F+  G   +VNF                                 YD   +           +P+ P      P + +    ++ ++ +LPD+  +   L +V   ++    +  LG +  ++  +    + +  FRK LE I   I+  NKN+ +   YY + P  +PN   V
Sbjct:  179 QSSWNDFADFEKIFVRISNTISEYVMQHWQEDFMFGYQFLNGCNPVMIKKCKQIPANFPVTNEMVECSLERNLTLEQEIEKGNIFIVNYELLDGISANKTDPCTMQYIAAPICLLYKNLENKIVPIAIQLNQEPGPENPIFLPSDTHYDWLLAKIWVRSSDFHVHQTVSHLLRSHLLSEVFAIAMYRQLPAVHPIFKLLIAHVRFTIAINTKAREQLICECGLFDKANATGGGGHVELLLRAMKYFTYE-SLCLPEAIQKRGMESKEDIPYYYYRDDALKVWEATLNFVKDVVNIYYASD-ETVCEDEELQAFVKDV-----------FVYGLRDNTDSGFPKAIKTKDKLTEYLTLVIFTASGQHAAVNFGQ-------------------------------YDWCSW-----------IPNSPPTMRQPPPKEKGVVTIEFIIESLPDRGRSCWHLGAVWALSQFQDNELFLGYYPDEHFVEKSVKEAMVKFRKNLEEIASFIQDRNKNKKL--PYYYLSPDRIPNSVAV 654          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Xenopus
Match: ALOX5 (arachidonate 5-lipoxygenase [Source:NCBI gene;Acc:100036609])

HSP 1 Score: 156.762 bits (395), Expect = 1.493e-39
Identity = 128/502 (25.50%), Postives = 231/502 (46.02%), Query Frame = 2
Query:  815 DICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLE-GWSVKHVIKARRLYIVDFKIMDGLNC-KPD----RIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSG-GTQTSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARV--TQSVLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQYYCMDPSILPNYPGV 2290
            D  FG Q L GCNP+++K C +IP NF VT E ++  LE   +++  I+   ++IV+++++DG++  K D    + + AP+ L +   E ++ P+AIQL Q     N +FLPSD    WLLAK+W   +D   H  V  L+   +L  ++ + M R     HPI++LL  H    + ++ K +E +  + G   +       G  +L+ RA K ++++ +  + + ++ R +   + +  Y YRDDAL +  A   FV+ +V ++Y +  + +  DEELQ + +++                 +NT +G  K+   +DK    L   +F+  G   +VNF                                 YD   +           +P+ P      P + +    ++ ++ +LPD+  +   L +V   ++    +  LG +  ++  +    + +  FRK LE I   I+  NKN+ +   YY + P  +PN   V
Sbjct:  144 DFMFGYQFLNGCNPVMIKKCKQIPANFPVTNEMVECSLERNLTLEQEIEKGNIFIVNYELLDGISANKTDPCTMQYIAAPICLLYKNLENKIVPIAIQLNQEPGPENPIFLPSDTHYDWLLAKIWVRSSDFHVHQTVSHLLRSHLLSEVFAIAMYRQLPAVHPIFKLLIAHVRFTIAINTKAREQLICECGLFDKANATGGGGHVELLLRAMKYFTYE-SLCLPEAIQKRGMESKEDIPYYYYRDDALKVWEATLNFVKDVVNIYYASD-ETVCEDEELQAFVKDV-----------FVYGLRDNTDSGFPKAIKTKDKLTEYLTLVIFTASGQHAAVNFGQ-------------------------------YDWCSW-----------IPNSPPTMRQPPPKEKGVVTIEFIIESLPDRGRSCWHLGAVWALSQFQDNELFLGYYPDEHFVEKSVKEAMVKFRKNLEEIASFIQDRNKNKKL--PYYYLSPDRIPNSVAV 588          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Xenopus
Match: ALOX5 (arachidonate 5-lipoxygenase [Source:NCBI gene;Acc:100036609])

HSP 1 Score: 154.836 bits (390), Expect = 8.231e-39
Identity = 129/532 (24.25%), Postives = 247/532 (46.43%), Query Frame = 2
Query:  323 KLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDP---FSETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXXKFSKSEKWDIDNAKLDAINQRRLTD-------LYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLE-GWSVKHVIKARRLYIVDFKIMDGLNC-KPD----RIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSG-GTQTSVNFKNTINNPEDLVSLLTGIL 1864
            K+E  ++W  +      DWY   + ++          +Y  FP ++WI   +  +  +       +D      + R +E++ +Q+++   +   GFP+ ++            ++D +      +N  +  +       ++  QS W+   +   ++ + + T    +      D  FG Q L GCNP+++K C +IP NF VT E ++  LE   +++  I+   ++IV+++++DG++  K D    + + AP+ L +   E ++ P+AIQL Q     N +FLPSD    WLLAK+W   +D   H  V  L+   +L  ++ + M R     HPI++LL  H    + ++ K +E +  + G   +       G  +L+ RA K ++++ +  + + ++ R +   + +  Y YRDDAL +  A   FV+ +V ++Y +  + +  DEELQ + +++                 +NT +G  K+   +DK    L   +F+  G   +VNF            LL+GIL
Sbjct:   69 KIEKHKYWYKD------DWYCRHLTVKTPSG------DYLEFPCYRWITNDKEIVLREGTAKLSRDDVTQVLKQHRRKELQERQKLYRWKEWYPGFPLSIDAHSHS-DLPHDIQFDSEKGVDFVLNYTKAMENLFVNSFMHMFQSSWNDFADFEKIFVRISNTISEYVMQHWQEDFMFGYQFLNGCNPVMIKKCKQIPANFPVTNEMVECSLERNLTLEQEIEKGNIFIVNYELLDGISANKTDPCTMQYIAAPICLLYKNLENKIVPIAIQLNQEPGPENPIFLPSDTHYDWLLAKIWVRSSDFHVHQTVSHLLRSHLLSEVFAIAMYRQLPAVHPIFKLLIAHVRFTIAINTKAREQLICECGLFDKANATGGGGHVELLLRAMKYFTYE-SLCLPEAIQKRGMESKEDIPYYYYRDDALKVWEATLNFVKDVVNIYYASD-ETVCEDEELQAFVKDV-----------FVYGLRDNTDSGFPKAIKTKDKLTEYLTLVIFTASGQHAAVNFGQV----NQYFFLLSGIL 570          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Xenopus
Match: ALOX5 (arachidonate 5-lipoxygenase [Source:NCBI gene;Acc:100036609])

HSP 1 Score: 151.369 bits (381), Expect = 1.596e-37
Identity = 124/514 (24.12%), Postives = 241/514 (46.89%), Query Frame = 2
Query:  323 KLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDP---FSETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXXKFSKSEKWDIDNAKLDAINQRRLTD-------LYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLE-GWSVKHVIKARRLYIVDFKIMDGLNC-KPD----RIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSG-GTQTSVNF 1810
            K+E  ++W  +      DWY   + ++          +Y  FP ++WI   +  +  +       +D      + R +E++ +Q+++   +   GFP+ ++            ++D +      +N  +  +       ++  QS W+   +   ++ + + T    +      D  FG Q L GCNP+++K C +IP NF VT E ++  LE   +++  I+   ++IV+++++DG++  K D    + + AP+ L +   E ++ P+AIQL Q     N +FLPSD    WLLAK+W   +D   H  V  L+   +L  ++ + M R     HPI++LL  H    + ++ K +E +  + G   +       G  +L+ RA K ++++ +  + + ++ R +   + +  Y YRDDAL +  A   FV+ +V ++Y +  + +  DEELQ + +++                 +NT +G  K+   +DK    L   +F+  G   +VNF
Sbjct:   69 KIEKHKYWYKD------DWYCRHLTVKTPSG------DYLEFPCYRWITNDKEIVLREGTAKLSRDDVTQVLKQHRRKELQERQKLYRWKEWYPGFPLSIDAHSHS-DLPHDIQFDSEKGVDFVLNYTKAMENLFVNSFMHMFQSSWNDFADFEKIFVRISNTISEYVMQHWQEDFMFGYQFLNGCNPVMIKKCKQIPANFPVTNEMVECSLERNLTLEQEIEGN-IFIVNYELLDGISANKTDPCTMQYIAAPICLLYKNLENKIVPIAIQLNQEPGPENPIFLPSDTHYDWLLAKIWVRSSDFHVHQTVSHLLRSHLLSEVFAIAMYRQLPAVHPIFKLLIAHVRFTIAINTKAREQLICECGLFDKANATGGGGHVELLLRAMKYFTYE-SLCLPEAIQKRGMESKEDIPYYYYRDDALKVWEATLNFVKDVVNIYYASD-ETVCEDEELQAFVKDV-----------FVYGLRDNTDSGFPKAIKTKDKLTEYLTLVIFTASGQHAAVNF 555          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Mouse
Match: Alox5 (arachidonate 5-lipoxygenase [Source:MGI Symbol;Acc:MGI:87999])

HSP 1 Score: 172.555 bits (436), Expect = 1.931e-44
Identity = 155/672 (23.07%), Postives = 300/672 (44.64%), Query Frame = 2
Query:  323 KLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDP---FSETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXXKFSKSEKWDIDNAKLDAINQRRLTD-------LYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLE-GWSVKHVIKARRLYIVDFKIMDGLNC-KPD----RIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQ-TSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARVTQS--VLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQYYCMDPSILPN 2278
            K+E  ++W  +      DWYL+ + ++   HG     +Y  FP ++WI G    +  D       +D      + R +E+  +Q+ +   + + GFP+ ++    +    +  ++D +      +N  +  +       ++  QS W    +   ++ + + T    + N    D+ FG Q L GCNP+++K CT +P    VT E ++  LE   S++  ++   ++IVD++++DG++  K D    + + AP+ L +     ++ P+AIQL Q+  E N +FLP+D    WLLAK+W   +D   H  +  L+   ++  ++ + M R     HP+++LL  H    + ++ K +E +  + G   +       G  Q+V+RA ++ ++  +    + +++R +   + +  Y YRDD LL+  A  +F  ++V ++Y N   D +++E+     +EL D ++D  +            +G  KS   R+K    L   +F+   Q  +VNF                                 YD   +           +P+ P      P   +    ++Q+V  LPD+  +   L +V   ++  ++   LG +  ++  +    + +  FRK LEAI   I   NKN+ +   YY + P  +PN
Sbjct:   69 KIEKRKYWLHD------DWYLKYITLK-TPHG-----DYIEFPCYRWITGEGEIVLRDGRAKLARDDQIHILKQHRRKELEARQKQYRWMEWNPGFPLSIDAKCHK-DLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWHDFADFEKIFVKISNTISERVKNHWQEDLMFGYQFLNGCNPVLIKRCTALPPKLPVTTEMVECSLERQLSLEQEVQEGNIFIVDYELLDGIDANKTDPCTHQFLAAPICLLYKNLANKIVPIAIQLNQTPGESNPIFLPTDSKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPLFKLLVAHVRFTIAINTKAREQLICEYGLFDKANATGGGGHVQMVQRAVQDLTYS-SLCFPEAIKARGMDSTEDIPFYFYRDDGLLVWEAIQSFTMEVVSIYYEN---DQVVEED-----QELQDFVKDVYVYGMRG----KKASGFPKSIKSREKLSEYLTVVIFTASAQHAAVNFGQ-------------------------------YDWCSW-----------IPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMIRFRKNLEAIVSVIAERNKNKKL--PYYYLSPDRIPN 670          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Mouse
Match: Alox5 (arachidonate 5-lipoxygenase [Source:MGI Symbol;Acc:MGI:87999])

HSP 1 Score: 161.384 bits (407), Expect = 5.651e-41
Identity = 125/514 (24.32%), Postives = 246/514 (47.86%), Query Frame = 2
Query:  323 KLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDP---FSETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXXKFSKSEKWDIDNAKLDAINQRRLTD-------LYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLE-GWSVKHVIKARRLYIVDFKIMDGLNC-KPD----RIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQ-TSVNF 1810
            K+E  ++W  +      DWYL+ + ++   HG     +Y  FP ++WI G    +  D       +D      + R +E+  +Q+ +   + + GFP+ ++    +    +  ++D +      +N  +  +       ++  QS W    +   ++ + + T    + N    D+ FG Q L GCNP+++K CT +P    VT E ++  LE   S++  ++   ++IVD++++DG++  K D    + + AP+ L +     ++ P+AIQL Q+  E N +FLP+D    WLLAK+W   +D   H  +  L+   ++  ++ + M R     HP+++LL  H    + ++ K +E +  + G   +       G  Q+V+RA ++ ++  +    + +++R +   + +  Y YRDD LL+  A  +F  ++V ++Y N   D +++E+     +EL D ++D  +            +G  KS   R+K    L   +F+   Q  +VNF
Sbjct:   69 KIEKRKYWLHD------DWYLKYITLK-TPHG-----DYIEFPCYRWITGEGEIVLRDGRAKLARDDQIHILKQHRRKELEARQKQYRWMEWNPGFPLSIDAKCHK-DLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWHDFADFEKIFVKISNTISERVKNHWQEDLMFGYQFLNGCNPVLIKRCTALPPKLPVTTEMVECSLERQLSLEQEVQEGNIFIVDYELLDGIDANKTDPCTHQFLAAPICLLYKNLANKIVPIAIQLNQTPGESNPIFLPTDSKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPLFKLLVAHVRFTIAINTKAREQLICEYGLFDKANATGGGGHVQMVQRAVQDLTYS-SLCFPEAIKARGMDSTEDIPFYFYRDDGLLVWEAIQSFTMEVVSIYYEN---DQVVEED-----QELQDFVKDVYVYGMRG----KKASGFPKSIKSREKLSEYLTVVIFTASAQHAAVNF 556          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Mouse
Match: Alox12b (arachidonate 12-lipoxygenase, 12R type [Source:MGI Symbol;Acc:MGI:1274782])

HSP 1 Score: 151.754 bits (382), Expect = 1.724e-37
Identity = 130/526 (24.71%), Postives = 225/526 (42.78%), Query Frame = 2
Query:  698 RLTDLYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHL-EGWSVKHVIKARRLYIVDFKIMDG-----LNCKPDRIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLI-NQMILENIYVCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQTSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARVT--QSVLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQY 2248
            +L  L   +  W  L+++ N++          +      D  FG Q L G NP +++ CT+IPD F VT E + P L EG  ++  ++   +Y+ D++I+DG     LN +      APM L  F  +  + P+AIQL+Q+      +FLP+D    WLLAK W   A+   H  V  L+ + +I E   + + RN    HP+Y+LL PH    + ++   +  + +K G  A+ + L  +G  Q++ R     ++  +  I  D   R V DL     Y +RDD+L +  A   +V +++  +YPN    +  D ELQ W +E+                         +  L R+                 S  F   +    +L+  +T +++     C +         +    +  L+    +P+ P+     P+Q +    L   +  LPD  +T  VL+ +    R    +  LG F   +  +    + +E FR+ L  I  +I + NK   + + Y
Sbjct:  222 KLRGLVDRKRSWKRLKDIKNIFPATKSVVSEYVAEHWTEDSFFGYQYLNGINPGLIRRCTQIPDKFPVTDEMVAPFLGEGTCLQAELERGNIYLADYRILDGIPTVELNGQQQHHC-APMCLLHFGPDGNMMPIAIQLSQTPGPDCPIFLPNDSEWDWLLAKTWVRYAEFYSHEAVAHLLESHLIGEAFCLALLRNLPMCHPLYKLLIPHTRYNVQINSIGRALLLNKGGLSARAMSLGLEGFAQVMVRGLSELTYK-SLCIPNDFVERGVQDLPG---YYFRDDSLAVWYAMERYVTEIITYYYPNDAA-VEGDPELQCWVQEIFK-----------------------ECLLGRE-----------------SSGFPTCLRTIPELIEYVTMVMY----TCSA--------RHAAVNSGQLEYTSWMPNFPSSMRNPPMQTKGLTTLQTYMDTLPDVKTTCIVLLVLWTLCREPDDRRPLGHFPDIHFVEEGPRRSIEAFRQNLNQISHNIRQRNKCLTLPYYY 689          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Mouse
Match: Alox8 (arachidonate 8-lipoxygenase [Source:MGI Symbol;Acc:MGI:1098228])

HSP 1 Score: 151.369 bits (381), Expect = 1.806e-37
Identity = 113/418 (27.03%), Postives = 201/418 (48.09%), Query Frame = 2
Query:  446 FPVHQWIGGGRHYIFYDCETFKGYED---PFSETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXXKFSKSEKWDIDNAKL-----DAINQRRLTDLYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHL-EGWSVKHVIKARRLYIVDFKIMDG-----LNCKPDRIMPAPMALFFFTE-EKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRREL 1651
            FP +QW+ G    +  +      ++D      + R +E+  +Q+++S      G+P  +++   ++     +   + NAKL      A  + ++  L      W SL  +  L++         +      D  F +Q L G NP++++ C  +P+NF VT E + P L  G S++  ++   L++VD  I+ G     LN KP +   APM L   +     L P+AIQL Q+    N +FLPSD    WLLAK W   ++   H  V  L++  ++  ++ +   R   + HP+++LL PH    L ++   +E + +    + ++  L   G   L+KR  +  ++ V   + +D+ +R V D+     Y YRDD + I  A  +FV ++V ++YP+    +  D+ELQ W RE+
Sbjct:  105 FPCYQWLEGAGELVLREGAAKVSWQDHHPTLQDQRQKELESRQKMYSWKTYIEGWPRCLDHETVKDLDLNIKYSAMKNAKLFFKAHSAYTELKVKGLLDRTGLWRSLREMRRLFNFRKTPAAEYVFAHWQEDAFFASQFLNGINPVLIRRCHSLPNNFPVTDEMVAPVLGPGTSLQAELEKGSLFLVDHGILSGVHTNILNGKP-QFSAAPMTLLHQSSGSGPLLPIAIQLKQTPGPDNPIFLPSDDTWDWLLAKTWVRNSEFYIHEAVTHLLHAHLIPEVFALATLRQLPRCHPLFKLLIPHIRYTLHINTLARELLVAPGKLIDKSTGLGTGGFSDLIKRNMEQLNYSVLC-LPEDIRARGVEDIPG---YYYRDDGMQIWGAIKSFVSEIVSIYYPSD-TSVQDDQELQAWVREI 516          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Mouse
Match: Alox5 (arachidonate 5-lipoxygenase [Source:MGI Symbol;Acc:MGI:87999])

HSP 1 Score: 144.436 bits (363), Expect = 2.317e-35
Identity = 122/514 (23.74%), Postives = 233/514 (45.33%), Query Frame = 2
Query:  323 KLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDP---FSETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXXKFSKSEKWDIDNAKLDAINQRRLTD-------LYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLE-GWSVKHVIKARRLYIVDFKIMDGLNC-KPD----RIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQ-TSVNF 1810
            K+E  ++W  +      DWYL+ + ++   HG     +Y  FP ++WI G    +  D       +D      + R +E+  +Q+ +   + + GFP+ ++    +    +  ++D +      +N  +  +       ++  QS W    +   ++ + + T    + N    D+ FG Q L GCNP+++K CT +P    VT E ++  LE   S++  ++   ++IVD++++DG++  K D    + + AP+ L +     ++ P+AIQL Q+  E N +FLP+D    WLLAK+W   +D   H  +  L+   ++  ++ + M R     HP+++LL  H    + ++ K +E +  + G                         FD         ++R +   + +  Y YRDD LL+  A  +F  ++V ++Y N   D +++E+     +EL D ++D  +            +G  KS   R+K    L   +F+   Q  +VNF
Sbjct:   69 KIEKRKYWLHD------DWYLKYITLK-TPHG-----DYIEFPCYRWITGEGEIVLRDGRAKLARDDQIHILKQHRRKELEARQKQYRWMEWNPGFPLSIDAKCHK-DLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWHDFADFEKIFVKISNTISERVKNHWQEDLMFGYQFLNGCNPVLIKRCTALPPKLPVTTEMVECSLERQLSLEQEVQEGNIFIVDYELLDGIDANKTDPCTHQFLAAPICLLYKNLANKIVPIAIQLNQTPGESNPIFLPTDSKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPLFKLLVAHVRFTIAINTKAREQLICEYGL------------------------FD---------KARGMDSTEDIPFYFYRDDGLLVWEAIQSFTMEVVSIYYEN---DQVVEED-----QELQDFVKDVYVYGMRG----KKASGFPKSIKSREKLSEYLTVVIFTASAQHAAVNF 524          
BLAST of Arachidonate 5-lipoxygenase vs. UniProt/SwissProt
Match: sp|P51399|LOX5_MESAU (Arachidonate 5-lipoxygenase OS=Mesocricetus auratus OX=10036 GN=ALOX5 PE=2 SV=2)

HSP 1 Score: 173.711 bits (439), Expect = 5.024e-44
Identity = 151/655 (23.05%), Postives = 289/655 (44.12%), Query Frame = 2
Query:  374 DWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDP---FSETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXXKFSKSEKWDIDNAKLDAINQRRLTD-------LYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLE-GWSVKHVIKARRLYIVDFKIMDGLNC-KPD----RIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMAD-ACHHMIVGRLINQMILENIYVCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQ-TSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARVTQS--VLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQYYCMDPSILPN 2278
            DWYL+ + ++          +Y  FP ++WI G    +  D       +D      + R +E+  +Q+ +   + + GFP+ ++    +    +  ++D +      +N  +  +       ++  QS W+   +   ++ + + T    + N    D+ FG Q L GCNP+++K C E+P    VT E ++  LE   S++  ++   ++IVD++++DG++  K D    + + AP+ L +     ++ P+AIQL Q+  E N +FLPSD    WLLAK+W   +D   H  I   L   ++ E   + M R     HPI++LL  H    + ++ K +E +  + G   +       G  Q+V+RA ++ ++  +    + +++R +   + +  Y YRDD LL+  A  +F  ++V ++Y + +  ++ D+ELQ++ +++                     +G  KS   R+K    L   +F+   Q  +VNF                                 YD   +           +P+ P      P   +    ++Q+V  LPD+  +   L +V   ++  ++   LG +  ++  +    + +  FRK LEAI   I   NKN+ +   YY + P  +PN
Sbjct:   80 DWYLKYITLKTPT-------DYIEFPCYRWITGEGEIVLRDGRAKLARDDQIHILKQHRRKELEARQKQYRWMEWNPGFPLSIDAKCHK-DLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVKNHWQEDLMFGYQFLNGCNPVLIKRCRELPQKLPVTTEMVECSLERHLSLEQEVQEGNIFIVDYELLDGIDANKTDPCTHQFLAAPICLLYKNLANKIVPIAIQLNQAPGEKNPIFLPSDAKYDWLLAKIWVRSSDFHVHQTITHLLCTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICEYGLFDKANATGGGGHVQMVQRAVQDLTYS-SLCFPEAIKARGMDSTEDIPYYFYRDDGLLVWEAIQSFTSEVVSIYYEDDQV-VMEDQELQDFVKDV-----------YVYGMRGRKASGFPKSIKSREKLSEYLTVVIFTASAQHAAVNFGQ-------------------------------YDWCSW-----------IPNAPPTMRAPPATAKGVVTIEQIVATLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMTRFRKNLEAIVNVIAERNKNKKL--PYYYLSPDRIPN 669          
BLAST of Arachidonate 5-lipoxygenase vs. UniProt/SwissProt
Match: sp|P48999|LOX5_MOUSE (Arachidonate 5-lipoxygenase OS=Mus musculus OX=10090 GN=Alox5 PE=1 SV=3)

HSP 1 Score: 172.555 bits (436), Expect = 1.351e-43
Identity = 155/672 (23.07%), Postives = 300/672 (44.64%), Query Frame = 2
Query:  323 KLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDP---FSETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXXKFSKSEKWDIDNAKLDAINQRRLTD-------LYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLE-GWSVKHVIKARRLYIVDFKIMDGLNC-KPD----RIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQ-TSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARVTQS--VLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQYYCMDPSILPN 2278
            K+E  ++W  +      DWYL+ + ++   HG     +Y  FP ++WI G    +  D       +D      + R +E+  +Q+ +   + + GFP+ ++    +    +  ++D +      +N  +  +       ++  QS W    +   ++ + + T    + N    D+ FG Q L GCNP+++K CT +P    VT E ++  LE   S++  ++   ++IVD++++DG++  K D    + + AP+ L +     ++ P+AIQL Q+  E N +FLP+D    WLLAK+W   +D   H  +  L+   ++  ++ + M R     HP+++LL  H    + ++ K +E +  + G   +       G  Q+V+RA ++ ++  +    + +++R +   + +  Y YRDD LL+  A  +F  ++V ++Y N   D +++E+     +EL D ++D  +            +G  KS   R+K    L   +F+   Q  +VNF                                 YD   +           +P+ P      P   +    ++Q+V  LPD+  +   L +V   ++  ++   LG +  ++  +    + +  FRK LEAI   I   NKN+ +   YY + P  +PN
Sbjct:   69 KIEKRKYWLHD------DWYLKYITLK-TPHG-----DYIEFPCYRWITGEGEIVLRDGRAKLARDDQIHILKQHRRKELEARQKQYRWMEWNPGFPLSIDAKCHK-DLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWHDFADFEKIFVKISNTISERVKNHWQEDLMFGYQFLNGCNPVLIKRCTALPPKLPVTTEMVECSLERQLSLEQEVQEGNIFIVDYELLDGIDANKTDPCTHQFLAAPICLLYKNLANKIVPIAIQLNQTPGESNPIFLPTDSKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPLFKLLVAHVRFTIAINTKAREQLICEYGLFDKANATGGGGHVQMVQRAVQDLTYS-SLCFPEAIKARGMDSTEDIPFYFYRDDGLLVWEAIQSFTMEVVSIYYEN---DQVVEED-----QELQDFVKDVYVYGMRG----KKASGFPKSIKSREKLSEYLTVVIFTASAQHAAVNFGQ-------------------------------YDWCSW-----------IPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMIRFRKNLEAIVSVIAERNKNKKL--PYYYLSPDRIPN 670          
BLAST of Arachidonate 5-lipoxygenase vs. UniProt/SwissProt
Match: sp|P09917|LOX5_HUMAN (Arachidonate 5-lipoxygenase OS=Homo sapiens OX=9606 GN=ALOX5 PE=1 SV=2)

HSP 1 Score: 171.014 bits (432), Expect = 4.043e-43
Identity = 154/673 (22.88%), Postives = 297/673 (44.13%), Query Frame = 2
Query:  323 KLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDP---FSETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXXKFSKSEKWDIDNAKLDAINQRRLTD-------LYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLE-GWSVKHVIKARRLYIVDFKIMDGLNC-KPD----RIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDP-MQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQ-TSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARVTQS--VLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQYYCMDPSILPN 2278
            ++E  ++W ++      DWYL+ + ++   HG     +Y  FP ++WI G    +  D       +D      + R +E+  +Q+ +   + + GFP+ ++    +    +  ++D +      +N  +  +       ++  QS W+   +   ++ + + T    + N    D+ FG Q L GCNP++++ CTE+P+   VT E ++  LE   S++  ++   ++IVDF+++DG++  K D    + + AP+ L +     ++ P+AIQL Q   + N +FLPSD    WLLAK+W   +D   H  +  L+   ++  ++ + M R     HPI++LL  H    + ++ K +E +  + G   +       G  Q+V+RA K+ ++  +    + +++R +   + +  Y YRDD LL+  A   F  ++V ++Y     D +++E          DP +QD    +          +G  KS   R++    L   +F+   Q  +VNF                                 YD   +           +P+ P      P   +    ++Q+V  LPD+  +   L +V   ++  ++   LG +  ++  +    + +  FRK LEAI   I   NK + +   YY + P  +PN
Sbjct:   69 RIEKRKYWLND------DWYLKYITLKTP-HG-----DYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHK-DLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECGLFDKANATGGGGHVQMVQRAMKDLTY-ASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVVDIYY---EGDQVVEE----------DPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNFGQ-------------------------------YDWCSW-----------IPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQL--PYYYLSPDRIPN 670          
BLAST of Arachidonate 5-lipoxygenase vs. UniProt/SwissProt
Match: sp|P12527|LOX5_RAT (Arachidonate 5-lipoxygenase OS=Rattus norvegicus OX=10116 GN=Alox5 PE=1 SV=3)

HSP 1 Score: 168.703 bits (426), Expect = 2.658e-42
Identity = 150/655 (22.90%), Postives = 293/655 (44.73%), Query Frame = 2
Query:  374 DWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDP---FSETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXXKFSKSEKWDIDNAKLDAINQRRLTD-------LYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLE-GWSVKHVIKARRLYIVDFKIMDGLNC-KPD----RIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQ-TSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARVTQS--VLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQYYCMDPSILPN 2278
            DWYL+ + ++          +Y  FP ++WI G    +  D       +D      + R +E+  +Q+ +   + + GFP+ ++    +    +  ++D +      +N  +  +       ++  QS W    +   ++ + + T    + N    D+ FG Q L GCNP+++K CTE+P    VT E ++  LE   S++  ++   ++IVD++++DG++  K D    + + AP+ L +     ++ P+AIQL Q+  E N +FLP+D    WLLAK+W   +D   H  +  L+   ++  ++ + M R     HP+++LL  H    + ++ K +E +  + G   +       G  Q+V+RA ++ ++  +    + +++R + + + +  Y YRDD LL+  A  +F  ++V ++Y +   D +++E+     +EL D ++D  +            +G  KS   R+K    L   +F+   Q  +VNF                                 YD   +           +P+ P      P   +    ++Q+V  LPD+  +   L +V   ++  ++   LG +  ++  +    + +  FRK LEAI   I   NKN+ +   YY + P  +PN
Sbjct:   80 DWYLKYITLKTPH-------DYIEFPCYRWITGEGEIVLRDGCAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHK-DLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWHDFADFEKIFVKISNTISERVKNHWQEDLMFGYQFLNGCNPVLIKRCTELPKKLPVTTEMVECSLERQLSLEQEVQEGNIFIVDYELLDGIDANKTDPCTHQFLAAPICLLYKNLANKIVPIAIQLNQTPGEKNPIFLPTDSKYDWLLAKIWVRSSDFHIHQTITHLLRTHLVSEVFGIAMYRQLPAVHPLFKLLVAHVRFTIAINTKAREQLNCEYGLFDKANATGGGGHVQMVQRAVQDLTYS-SLCFPEAIKARGMDNTEDIPYYFYRDDGLLVWEAIQSFTTEVVSIYYED---DQVVEED-----QELQDFVKDVYVYGMRG----RKASGFPKSIKSREKLSEYLTVVIFTASAQHAAVNFGQ-------------------------------YDWCSW-----------IPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMIRFRKNLEAIVSVIAERNKNKKL--PYYYLSPDRIPN 669          
BLAST of Arachidonate 5-lipoxygenase vs. UniProt/SwissProt
Match: sp|O75342|LX12B_HUMAN (Arachidonate 12-lipoxygenase, 12R-type OS=Homo sapiens OX=9606 GN=ALOX12B PE=1 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 2.030e-38
Identity = 125/514 (24.32%), Postives = 221/514 (43.00%), Query Frame = 2
Query:  731 WSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHL-EGWSVKHVIKARRLYIVDFKIMDGLNC----KPDRIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLI-NQMILENIYVCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQTSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARVT--QSVLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQY 2248
            W  L+++  ++          +      D  FG Q L G NP +++ CT IPD F VT + + P L EG  ++  ++   +Y+ D++IM+G+         +   AP+ L  F  E ++ P+AIQL+Q+      +FLPSD    WLLAK W   A+   H  +  L+   +I E   + + RN    HP+Y+LL PH    + ++   +  + ++ G  A+ + L  +G   ++ RA    ++D +  +  D   R V DL     Y YRDD+L + NA   +V +++  +YP+    +  D ELQ+W +E+                         +  L R+                 S  F   +    +L+  +T    + I  C +        ++       ++    +P+ P      P+Q +    L+  +  LPD  +T   L+ +   +R    +  LG F   +  +    + +E FR++L  I  DI + NK   I + Y
Sbjct:  233 WKRLKDIRKIFPGKKSVVSEYVAEHWAEDTFFGYQYLNGVNPGLIRRCTRIPDKFPVTDDMVAPFLGEGTCLQAELEKGNIYLADYRIMEGIPTVELSGRKQHHCAPLCLLHFGPEGKMMPIAIQLSQTPGPDCPIFLPSDSEWDWLLAKTWVRYAEFYSHEAIAHLLETHLIAEAFCLALLRNLPMCHPLYKLLIPHTRYTVQINSIGRAVLLNEGGLSAKGMSLGVEGFAGVMVRALSELTYD-SLYLPNDFVERGVQDLPG---YYYRDDSLAVWNALEKYVTEIITYYYPSD-AAVEGDPELQSWVQEIFK-----------------------ECLLGRE-----------------SSGFPRCLRTVPELIRYVT----IVIYTCSA--------KHAAVNTGQMEFTAWMPNFPASMRNPPIQTKGLTTLETFMDTLPDVKTTCITLLVLWTLSREPDDRRPLGHFPDIHFVEEAPRRSIEAFRQRLNQISHDIRQRNKCLPIPYYY 689          
BLAST of Arachidonate 5-lipoxygenase vs. TrEMBL
Match: A0A0X3NXQ1 (Allene oxide synthase-lipoxygenase protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=AOSL PE=4 SV=1)

HSP 1 Score: 726.087 bits (1873), Expect = 0.000e+0
Identity = 369/745 (49.53%), Postives = 510/745 (68.46%), Query Frame = 2
Query:   80 NFVNVLKMGSNKSKIAFEICIVSGDYKEIEDPPSIFMVLFDEQQRQSPTLSYTNLIQDDEGKIQAKFSIENKPWCKIRNFNKLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDPFSETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXXKFSKSEKWDIDNAKLDAINQRRLTDLYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLEGWSVKHVIKARRLYIVDFKIMDGLNCKPDRIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIYVCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXE-NTKNGVLKSTLDRDKAYADLNGSVFSGGTQTSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLP--SDPTERT-----TDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARVTQSVLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQYYCMDPSILPNYPGV 2290
            + +    MG   SK+AFE+C+ S DY+     PS+ MV+FD    QSPT++  NL Q++    QAKF+I+ + W K + F +L HIEFWR++       W+L++V+IRDRRHGL G W+YFFFPVH WI     Y+ +DCETF   ++PF E R  +I  +Q++ +  QR+ G PVE+  VP  E FS   KW+I+   L+ I Q  L++ Y  +  W SL++L  LY Q+NITEP+ L+  +VND+ FGAQRLKGCNP V++LCT +P + E   EW+KPHLEGW+++  I A+RLYIVDF IM GL+C+P R++ AP+ALFF+TE++QLKPLAI +   S++  L+FL +D    WL AK+WFN+ADACHHMI GRL+  ++LE+IYV MRRN  QSHPIYQLLAPHF + L V+ KLK+ IF K GW+A+NIQLSKKGIKQL+KRA+K W FDV AN++ + ESR VYD K L NYPYRDDA L++  F  F+ K +++FYP G  DLL D ELQ WR+ELSDPM+DGG+GI+GIP G+   +NGV++      K Y+  N S+ S    TSV+F   +   E+  S + GI+HL +IV GS LRLPM+DEYG+  +Y L L G  P  SD  ER+     +    I     LD+ + ALP++  T+++++  R+ +RV QSVLGK+D ++I  P A+ LLE+F+K LE     +   N+ RD++H+Y+ +DP ++PN+PG+
Sbjct:   10 SLIQTWPMGETNSKVAFELCVSSEDYQGNNLGPSVNMVMFDANNAQSPTIAIANLFQNEVDFKQAKFTIDLQSWSKPKIFGRLHHIEFWRTDGGPFASPWFLDRVVIRDRRHGLTGEWDYFFFPVHDWILPDAQYVVHDCETFLPQDEPFPELRDAQIARRQQLLTFTQRAKGLPVEILEVPTTELFSYDAKWNIEELVLELIEQAGLSEKYSSEMPWDSLDSLGALYKQHNITEPLSLSYWMVNDVAFGAQRLKGCNPFVIELCTNLPPSMECIREWIKPHLEGWTLQQTIVAKRLYIVDFAIMRGLHCRPGRVLAAPLALFFYTEKRQLKPLAIHMDADSSDRRLLFLFTDSSEDWLQAKLWFNLADACHHMIAGRLLTHLLLESIYVSMRRNLAQSHPIYQLLAPHFRSLLAVNSKLKDWIFDK-GWIARNIQLSKKGIKQLLKRAFKQWRFDVKANVYAECESRGVYDRKGLGNYPYRDDAFLVYGIFDRFIVKFLRIFYPRGPVDLLADVELQAWRKELSDPMEDGGLGIEGIPCGKARIRNGVVRPV---GKNYSS-NESMIS---DTSVDFVYGLTTIEETKSFVLGIIHLLVIVAGSALRLPMFDEYGFTPHYPLSLFGQPPFHSDYGERSRRMNGSSVSGISSSSGLDRTIAALPNQRMTVEMILFTRVCSRVRQSVLGKYDSNFIVDPRAVALLEEFQKNLEEASQQVAAHNRMRDLHHKYFALDPLVMPNFPGI 746          
BLAST of Arachidonate 5-lipoxygenase vs. TrEMBL
Match: A0A4Z2DLH6 (Allene oxide synthase-lipoxygenase protein OS=Schistosoma japonicum OX=6182 GN=EWB00_011208 PE=4 SV=1)

HSP 1 Score: 705.671 bits (1820), Expect = 0.000e+0
Identity = 341/738 (46.21%), Postives = 500/738 (67.75%), Query Frame = 2
Query:  101 MGSNKSKIAFEICIVSGDYKEIEDPPSIFMVLFDEQQRQSPTLSYTNLIQDDEGKIQAKFSIENKPWCKIRNFNKLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDPFSETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXXKFSKSEKWDIDNAKLDAINQRRLTDLYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLEGWSVKHVIKARRLYIVDFKIMDGLNCKPDRIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIYVCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQTSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQD--------QNLDQVVLALPDKHSTLDVLISVRMAARVTQSVLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQYYCMDPSILPNYPGV 2290
            MG   +KIAFE+C+V+GDY   E  P + MV+FD +  QSPT++  ++ Q+D    QAKF+I+ + W ++  F +L HIEFW + ++     W+L++VIIRDRR G+   W+YFFFPVH+WI     Y+ +DCE +    +PF E R EE+  + + F+ +QRS G PVE++ +P  E FS   +WDI+   L+ I +  L D Y  +  W+SL+ L N Y +YNITEP+ L   ++NDICFGAQR++GCNP  +++C  +P +FE+    LKP+LEGW+++ ++ A RLYI+DF IM GL+CK  R + AP+A+FF+TE++QL PLAIQL ++S + N + LP+DP   WL AK+W N+ADACHHMIVGRL+  +ILE+IYV +RRN  QSHPIY L+APHF + L V++KLKE  F ++GW+++NIQLS+KGIKQL++RA+K W FDVNANI+++LESR VYD   L NYPYR+DALLI++    FV   V+LFYPNG + ++ D ELQ+WR E++ PM++GG+G+           GV  ST+ + ++ +  N  ++   T+            E++V  L GIL+L +IV GS LRLPM+DEYG+P  Y L L G+ P D    +   L    D          L++V+ +LP++  T++ ++  R+++RV QSVLG+F+ D+I++ +A+ LL+ FR QLE +   I+ +N  RD++HQY  +DPS++PNYPG+
Sbjct:    1 MGGTSTKIAFEVCVVTGDYSGDELGPGVNMVMFDHRGNQSPTITLDSIFQNDIDYTQAKFTIDLQAWSRLTVFKRLHHIEFWCTTQSYPPPAWFLDRVIIRDRRFGMTAEWKYFFFPVHKWINQDHQYVVHDCEAWIPQLEPFPELREEEVGRRMQFFTFFQRSKGLPVELQEIPPSELFSTDSRWDIEPLVLEVIERTGLADEYTSEQSWNSLDTLGNFYKKYNITEPVSLQFWMMNDICFGAQRVRGCNPFTIQICRTLPKSFEMAANTLKPYLEGWTLRQMVSANRLYILDFHIMQGLSCKRGRELCAPLAIFFYTEKRQLTPLAIQLNRNSTDTNAIILPTDPSSIWLQAKLWVNLADACHHMIVGRLLTHLILESIYVSLRRNMSQSHPIYHLVAPHFRSILPVTRKLKEWTF-ENGWISRNIQLSRKGIKQLLRRAFKKWRFDVNANIYRELESRGVYDPNGLGNYPYREDALLIYHTLEQFVSSYVRLFYPNGTEQIIHDNELQSWRHEIASPMEEGGLGLI----------GVPGSTI-KIRSNSRSNNCLYDSPTEEIFGLITV----EEVVKFLMGILYLDVIVAGSALRLPMFDEYGFPAQYPLSLFGSPPLDRNAFSDGTLHGVHDSVFSFSSVHGLERVLASLPNRQMTVETVLYTRLSSRVQQSVLGQFESDFIFKKKAVILLDQFRHQLEEMAKQIDMNNTARDMHHQYRALDPSLMPNYPGI 722          
BLAST of Arachidonate 5-lipoxygenase vs. TrEMBL
Match: A0A183STJ9 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS7547 PE=4 SV=1)

HSP 1 Score: 705.286 bits (1819), Expect = 0.000e+0
Identity = 350/737 (47.49%), Postives = 484/737 (65.67%), Query Frame = 2
Query:  101 MGSNKSKIAFEICIVSGDYKEIEDPPSIFMVLFDEQQRQSPTLSYTNLIQDDEGKIQAKFSIENKPWCKIRNFNKLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDPFSETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXXKFSKSEKWDIDNAKLDAINQRRLTDLYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLEGWSVKHVIKARRLYIVDFKIMDGLNCKPDRIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIYVCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQTSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLP--SDPTERT-----TDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARVTQSVLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQYYCMDPSILPNYPGV 2290
            MG   SK+AFE+C+ S DY+     PS+ MV+FD    QSPT++  NL Q++    QAKF+I+ + W K + F +L HIEFWR++       W+L++V+IRDRRHGL G W+YFFFPVH WI     Y+ +DCETF   ++PF E R  +I  +Q++ +  QR+ G PV               +W+I+   L+ I Q  L++ Y  +  W SL++L  LY Q+NITEP+ L+  +VND+ FGAQRLKGCNP V++LCT +P + E   EW+KPHLEGW+++  I A+RLYIVDF IM GL+C+P R++ AP+ALFF+TE++QLKPLAI +   S++  L+FL +D    WL AK+WFN+ADACHHMI GRL+  ++LE+IYV MRRN  QSHPIYQLLAPHF + L V+ KLK+ IF K GW+A+NIQLSKKGIKQL+KRA+K W FDV AN++ + ESR VYD K L NYPYRDDA L++  F  F+ K +++FYP G  DLL D ELQ WR+ELSDPM+D      G  G E    G  +S +                 + TSV+F   +   E+  S + GI+HL +IV GS LRLPM+DEYG+  +Y L L G  P  SD  ER+     +    I     LD+ + ALP++  T+++++  R+ +RV QSVLGK+D ++I    A+ LLE+F+K LE     +   N+ RD++H+Y+ +DP ++PN+PG+
Sbjct:    1 MGETNSKVAFELCVSSEDYQGNNLGPSVNMVMFDANNAQSPTIAIANLFQNEVDFKQAKFTIDLQSWSKPKIFGRLHHIEFWRTDGGPFASPWFLDRVVIRDRRHGLTGEWDYFFFPVHDWILPDAQYVVHDCETFLPQDEPFPELRDAQIARRQQLLTFTQRAKGLPV---------------EWNIEELVLELIEQTGLSEKYSSEMPWDSLDSLGALYKQHNITEPLSLSYWMVNDVAFGAQRLKGCNPFVIELCTNLPPSMECIREWIKPHLEGWTLQQTIVAKRLYIVDFAIMRGLHCRPGRVLAAPLALFFYTEKRQLKPLAIHMDADSSDRRLLFLFTDSSEDWLQAKLWFNLADACHHMIAGRLLTHLLLESIYVSMRRNLAQSHPIYQLLAPHFRSLLAVNSKLKDWIFDK-GWIARNIQLSKKGIKQLLKRAFKQWRFDVKANVYAECESRGVYDRKGLGNYPYRDDAFLVYGIFDRFIVKFLRIFYPRGPVDLLADVELQAWRKELSDPMED------GGLGIEGIPCGKARSMI-----------------SDTSVDFVYGLTTIEETKSFVLGIIHLLVIVAGSALRLPMFDEYGFTPHYPLSLFGQPPFHSDYGERSRRMNGSSVSGISSSSGLDRTIAALPNQRMTVEMILFTRVCSRVRQSVLGKYDSNFIVDLRAVALLEEFQKNLEEASQQVAAHNRMRDLHHKYFALDPLVMPNFPGI 698          
BLAST of Arachidonate 5-lipoxygenase vs. TrEMBL
Match: A0A5K4F252 (Putative 12-lipoxygenase OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 703.36 bits (1814), Expect = 0.000e+0
Identity = 339/740 (45.81%), Postives = 496/740 (67.03%), Query Frame = 2
Query:  101 MGSNKSKIAFEICIVSGDYKEIEDPPSIFMVLFDEQQRQSPTLSYTNLIQDDEGKIQAKFSIENKPWCKIRNFNKLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDPFSETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXXKFSKSEKWDIDNAKLDAINQRRLTDLYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLEGWSVKHVIKARRLYIVDFKIMDGLNCKPDRIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIYVCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQD--XXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQTSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPL--------QIEQDQNLDQVVLALPDKHSTLDVLISVRMAARVTQSVLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQYYCMDPSILPNYPGV 2290
            MG   +KIAFE+C+V+GDY   E  P + MV+FD    QSPT++  N+ Q+D    QAKF+I+ + W +++ F +L HIEFW + ++     W+L++VIIRDRR G+   W+YFFFPVHQWI     Y+ +DCE +    +PF E R EE+  +   F+L+QRS G PVE++ +P  E FS   +WDI+   L+ I +  L + Y  +  W SL+ L N Y +YNITEP+ L   ++NDICFGAQR++GCNP  +++C  +P +FE+    LKP+LEGW+++ ++ A RLY++DF IM GL+CK  R + AP+A+FF+TE++QLKP+AIQL ++SN+ + + LP+DP   WL AK+W N+ADACHHMIVGRL+  +ILE+IYV +RRN  QSHPIY L+APHF + L V+KKLKE  F ++GW+++NIQLS+KGIKQL++RA+K W FDVNANI+++LESR V+D  +L NYPYR+DA+LI++A   F    V+LFYP G + ++ D ELQ+WR E++ PM++   G+        +   N  L++ L  D    ++ G                +N  E++V  L GIL+LSIIV GS LRLPM+DEYG+P  Y L L G+ P D    +   L             Q LD+V+ +LP++  T++ ++  R+A+RV QSVLG+++ D+I++ +A+ LL+ FR  LE +   ++ +N  RD++HQY  +DPS++PNYPG+
Sbjct:    1 MGGTSTKIAFEVCVVTGDYSGDELGPGVNMVMFDHCGNQSPTITLDNIFQNDVDYTQAKFTIDLQAWSRLKVFKRLHHIEFWCTTQSYPPPAWFLDRVIIRDRRFGMTAEWKYFFFPVHQWISQDHQYVVHDCEAWIPQLEPFPELREEEVSRRMHFFTLFQRSKGLPVELQEIPPSELFSSDSRWDIEPLVLEVIERTGLAEEYTSEESWDSLDTLGNFYKKYNITEPVSLQFWMMNDICFGAQRIRGCNPFTIQICRTLPKSFEMVANSLKPYLEGWTLRQMVSANRLYLLDFHIMQGLSCKRGRELCAPLAIFFYTEKRQLKPIAIQLNRNSNDASGIILPTDPTSIWLQAKLWVNLADACHHMIVGRLLTHLILESIYVSLRRNVSQSHPIYHLVAPHFRSILPVTKKLKEWTF-ENGWISRNIQLSRKGIKQLLRRAFKKWRFDVNANIYRELESRGVFDPNSLGNYPYREDAMLIYHALEQFTSNYVRLFYPGGTEQIIHDNELQSWRHEIASPMEEGGLGLVGVPGSTIKLRTNSGLENCL-HDNVTEEIFG----------------LNTVEEVVKFLMGILYLSIIVTGSALRLPMFDEYGFPAQYPLSLFGSPPLDRNTFSDGTLNGAHGSVFSFSNVQGLDRVLASLPNRQMTVETVLYTRLASRVQQSVLGQYESDFIFKKKAVVLLDQFRHDLEDVARQVDINNGARDMHHQYRALDPSLMPNYPGI 722          
BLAST of Arachidonate 5-lipoxygenase vs. TrEMBL
Match: A0A4E0RKH3 (Arachidonate 5-lipoxygenase OS=Fasciola hepatica OX=6192 GN=D915_007426 PE=4 SV=1)

HSP 1 Score: 694.115 bits (1790), Expect = 0.000e+0
Identity = 335/739 (45.33%), Postives = 490/739 (66.31%), Query Frame = 2
Query:  101 MGSNKSKIAFEICIVSGDYKEIEDPPSIFMVLFDEQQRQSPTLSYTNLIQDDEGKIQAKFSIENKPWCKIRNFNKLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDPFSETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXXKFSKSEKWDIDNAKLDAINQRRLTDLYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLEGWSVKHVIKARRLYIVDFKIMDGLNCKPDRIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIYVCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQTSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDP---------TERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARVTQSVLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQYYCMDPSILPNYPGV 2290
            MG N +KIAFE+C+VSGDY   E  P + MV+FD    QSPT++  ++ Q++    QAKF+I+ +PW K++ F +L HIEFW + ET     W+L++VIIRDRR G+   W+YFFFPVHQWI     Y+ +DCE++   +DPF + R  E+  + + F+L+QR+ G PVE+ ++P  E F+   +W+I++  L+ I +  L   Y  +  WSSL+ L + Y +YN+TEP+ L   +VNDICFGAQR++GCNP +++LC ++P++F     W+KPHLEGW++K +  A RLY++D++IM GL+CK  R + AP+ L   TE++QL+P+AIQL     + + +FLP+DP   WL AK+W N++DACHHMIVGRL+  MILE++YV +RRN  QSHPIYQLLAPHF + L V+ KLKE  F ++GW+A++IQL+ KGIKQL+KRA+K W FD+ AN++++LESR VY+   L NYPYR DALLIH     +V K V+  YP G +DLL D ELQ+WR E++ PM++         GG         ST  R+   A    S F       V    TI+   + V  L G+LHL +IV GS LRLPM+DEYG+P +Y L L G  PSDP         +   +    +      +++V +LP++  T+++++  R+A+RV QSVLG+++ D++++ +A+ +LE+FRK L      I+ +N +RD++HQY  +DPS++PNYPG+
Sbjct:   13 MGGNSTKIAFEVCVVSGDYTGDELGPGVNMVMFDSVGNQSPTITLASIFQNESDYTQAKFTIDCQPWSKLKVFRRLHHIEFWCTTETDPPPAWFLDRVIIRDRRFGMTAEWKYFFFPVHQWISPDHQYVVHDCESWLPVQDPFPDLRDTELTMRLQFFTLFQRAKGLPVELRDIPPSEYFTSDSRWNIESLVLEVIERYGLAPEYTSEQPWSSLDELGSFYKKYNVTEPMSLQFWMVNDICFGAQRIRGCNPFMIRLCQQLPESFAAAATWIKPHLEGWTLKQLTSANRLYLLDYEIMQGLSCKRGRALCAPLVLLLHTEKRQLRPIAIQLRHEPKDTSPIFLPTDPVHIWLQAKLWVNLSDACHHMIVGRLLTHMILESVYVSLRRNLAQSHPIYQLLAPHFRSILPVTHKLKEWTF-ENGWIARSIQLNHKGIKQLLKRAFKQWRFDIQANLYRELESRGVYNPHGLGNYPYRQDALLIHRILEKYVNKFVRYVYPRGTEDLLQDTELQSWRHEIASPMEE---------GGLGLVGVPGSSTKFRNPGDA---MSEFGYPDFPEVFGLITID---ETVKFLVGLLHLIVIVAGSALRLPMFDEYGFPAHYPLSLFGAPPSDPGVSESGLLNSRVASSASSLSNILGTERIVASLPNRQMTVEIVLYSRLASRVQQSVLGQYESDFMFKQQAVTILEEFRKDLAEAAQQIDSNNLSRDMHHQYRALDPSVMPNYPGI 735          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Cavefish
Match: alox5a (arachidonate 5-lipoxygenase [Source:NCBI gene;Acc:103035394])

HSP 1 Score: 160.614 bits (405), Expect = 1.877e-40
Identity = 154/668 (23.05%), Postives = 293/668 (43.86%), Query Frame = 2
Query:  323 KLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDP---FSETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXXKFSKSEKWDIDNAKLDAIN-QRRLTDLYGDQ------SFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLE-GWSVKHVIKARRLYIVDFKIMDGLN------CKPDRIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRREL-SDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQTSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARVTQS--VLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQYYCMDP 2263
            K+E  ++W  +      DWY + + ++          +Y  FP  +W+   +  I  D       +D      + R +E+  +Q+ F   +   GFP+ ++    + +  +  ++D +      +N  + + +LY +Q      S W    +   ++ +   T    +      D  FG Q L GCNP++++ CT+IP  F VT E +   LE   +++  +KA  LYI D++IM+ +       C P + + AP+ L +   + ++ P+AIQL+QS  E + ++LPSD    WLLAK+W   +D   H  V  L+   ++  ++ + M R     HP Y+LL PH    + ++ K +E +  ++G   +       G  QLV++A K +++  +    + +++R +   + L  Y YRDD   +  A  +FV  M+ ++Y +  + +  DEE+Q + +++ S  MQD                                              F  ++   E LV  LT ++  +     + +    YD   +        + N P  PT R   P +  Q  ++  +V +LPD+  +   L +V   ++  ++   LG +  ++  +    K LE FR++L  +   I+  N+ + +   YY + P
Sbjct:   99 KIEKKKYWVHD------DWYCKYITVKTPSG------DYIEFPCFRWLVDDKEVILRDGRARLPQDDKTRVAKQHRRKELETRQKTFRWKEWHPGFPMSIDAKAHK-ELPRDIQFDSEKGVDFILNYSKAIENLYVNQFMHMFQSSWGDFSDFERIFMRIKNTISEYVMQHWKEDFMFGYQFLNGCNPVMIQKCTQIPKKFPVTHEMVADCLERDLTLEEELKAGNLYIADYEIMEDITANATDPCTP-QYLAAPICLLYKNSQNKILPIAIQLSQSPGEDSPIYLPSDDQHDWLLAKIWVRSSDFHVHQTVTHLLRTHLISEVFGIAMFRQLSAVHPAYKLLLPHIRFTIAINTKAREQLICENGLFDKANGTGGGGHVQLVQKAMKTFTYK-SLCFPESIKARGMESQEELPYYYYRDDGNKVWEAIKSFVTDMINIYYASD-ETVQEDEEIQAFVKDVCSFGMQDFDY-----------------------------------------CEFPKSVQTLEQLVEYLTVVI-FTASAQHAAINFGQYDWCSW--------IPNAP--PTMRNPPPTKKGQ-TDMKLIVESLPDRGRSCWHLGAVWALSQFQENELFLGMYPDEHFIEKPVKKALETFREKLTEVSKLIKNRNEGKKL--PYYYLSP 695          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Cavefish
Match: alox12 (arachidonate 12-lipoxygenase, 12S-type [Source:NCBI gene;Acc:103037595])

HSP 1 Score: 159.073 bits (401), Expect = 4.769e-40
Identity = 151/665 (22.71%), Postives = 287/665 (43.16%), Query Frame = 2
Query:  323 KLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDPFSET---RLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXX-----KFSKSEKWDIDNA---KLDAINQRRLTDLYGDQSFWSSLENLHNLYSQYNITEPIG--LTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLE-GWSVKHVIKARRLYIVDFKIMDGLNCKPDRIM----PAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLI-NQMILENIYVCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQTSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPD-KHSTLDVLISVRMAARVTQSV-LGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQYYC 2254
            +LE   +W      ++ +W+   V++  +  G         FP + W+ G       +    K  +D   +    R  E++ +QE +     + G P  ++   E E     +F+  ++ D + +    L  ++ ++L   +G    W+ L++   ++  + +  PI          D  FG Q + G NP +++  T++P NF V+ + ++  L    ++   +KA  +Y+VD  I+DG+     R M     APM L +   E  L P+AIQL Q+  +   +FLP+DPP++WLLAKMW   A+     ++  L+   +++E I V   R+    HPIY+LL PH    L ++ + +  + S +G   + +     G+  L +R YK  ++      + D   R V  LK    Y YRD +L++ +A   +V  MV L+Y +   ++  D ELQ W +++                               D+ + D+                N +   E+ V+LL+ ++ +S              ++    N        +P+ P      P   +    +  ++  LPD   S + + I+  +      ++ +G++   +  +PEAL+ +E FR+ L+ I   I + N+  ++ + Y C
Sbjct:   67 RLEKQRYW------VEDNWFCRYVLVTPKEGGSTQT-----FPCYCWLVGDMKVEVREGTAKKLSDDVLPKELAHRKAELKQRQETYRWIAWAPGIPKCIDAKTEAELPQDDRFANEKRSDFEGSLHYALLELSLKKLAIRFGKS--WNDLDDFKRIF--WKLRSPIAEYAMEHWKEDWFFGYQFMNGSNPRMIQKVTKLPTNFPVSGDMVQAFLSPNTTLDKELKAGNVYLVDHGIVDGIPANVIRNMQQYIAAPMCLLYEHPESGLIPIAIQLEQNPGKDTPIFLPNDPPLAWLLAKMWVRHAEFQVFQLLSHLLRTHLVVEVICVSTLRHLPAVHPIYKLLTPHLKYTLEINCRGRTQLISPEGIFKRVVSTGGTGLLVLAQREYKILTYRSLQPTY-DFLDRGVTKLK---KYFYRDYSLMLWDAIHKYVSSMVSLYY-SSDSEVQQDSELQAWIKDIV------------------------------DEGFVDV----------PEFGLPNELKGKEEFVTLLSVVIFISTA------------QHAATNNGQFDWCAWVPNTPCTMRQPPPNDKDAVTMGLIMDTLPDISQSCVQMAITWHLGRAQPDAIPMGQYAEQFFTEPEALQAIESFRQDLKDIDEQIVKQNEGLELQYLYLC 659          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Cavefish
Match: alox5a (arachidonate 5-lipoxygenase [Source:NCBI gene;Acc:103035394])

HSP 1 Score: 157.532 bits (397), Expect = 7.366e-40
Identity = 120/468 (25.64%), Postives = 226/468 (48.29%), Query Frame = 2
Query:  323 KLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDP---FSETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXXKFSKSEKWDIDNAKLDAIN-QRRLTDLYGDQ------SFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLE-GWSVKHVIKARRLYIVDFKIMDGLN------CKPDRIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRREL-SDPMQD 1669
            K+E  ++W  +      DWY + + ++          +Y  FP  +W+   +  I  D       +D      + R +E+  +Q+ F   +   GFP+ ++    + +  +  ++D +      +N  + + +LY +Q      S W    +   ++ +   T    +      D  FG Q L GCNP++++ CT+IP  F VT E +   LE   +++  +KA  LYI D++IM+ +       C P + + AP+ L +   + ++ P+AIQL+QS  E + ++LPSD    WLLAK+W   +D   H  V  L+   ++  ++ + M R     HP Y+LL PH    + ++ K +E +  ++G   +       G  QLV++A K +++  +    + +++R +   + L  Y YRDD   +  A  +FV  M+ ++Y +  + +  DEE+Q + +++ S  MQD
Sbjct:   69 KIEKKKYWVHD------DWYCKYITVKTPSG------DYIEFPCFRWLVDDKEVILRDGRARLPQDDKTRVAKQHRRKELETRQKTFRWKEWHPGFPMSIDAKAHK-ELPRDIQFDSEKGVDFILNYSKAIENLYVNQFMHMFQSSWGDFSDFERIFMRIKNTISEYVMQHWKEDFMFGYQFLNGCNPVMIQKCTQIPKKFPVTHEMVADCLERDLTLEEELKAGNLYIADYEIMEDITANATDPCTP-QYLAAPICLLYKNSQNKILPIAIQLSQSPGEDSPIYLPSDDQHDWLLAKIWVRSSDFHVHQTVTHLLRTHLISEVFGIAMFRQLSAVHPAYKLLLPHIRFTIAINTKAREQLICENGLFDKANGTGGGGHVQLVQKAMKTFTYK-SLCFPESIKARGMESQEELPYYYYRDDGNKVWEAIKSFVTDMINIYYASD-ETVQEDEEIQAFVKDVCSFGMQD 520          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Cavefish
Match: ENSAMXT00000046181.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:18032762:18048964:-1 gene:ENSAMXG00000037527.1 transcript:ENSAMXT00000046181.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 152.525 bits (384), Expect = 2.758e-38
Identity = 121/530 (22.83%), Postives = 234/530 (44.15%), Query Frame = 2
Query:  686 INQRRLTDLYGDQS------FWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLEGWSVKHVIKARRLYIVDFKIMDGLNCKPDRI----MPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQTSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARVTQSV--LGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDI 2236
            IN+R+L  L           +WS L     L    N+     L      D  FG Q L G NP V++ C  +PDNF VT   ++  +E  S+   I   ++++ D+ ++DG+      +    + AP+ L +  +  +L P+AIQ  Q + E N +F+P D    WLLAK++   AD   H +   L+   +L  +Y +C   N    HP+Y+LL PH    L ++   +E + +KDG + +   +SK+G+  ++++A  +  +     + +D+E+R    LK + N+ YRDD   + +  T +V  +++ +YP+   ++  D ELQ W  ++                        L   L  +K+                 N      + ++L+  +T ++  ++    S L    +D  G+           +P+ P    + P +++       ++  LPD + ++  + +V    R  +    LG     Y  +P+ + ++   + +L+ +   I++ N+ +D+
Sbjct:   98 INERQLVYLREGTGKTILHIWWSQLA--EGLPHTLNVDNVKDLPEHWKEDEFFGYQFLNGANPTVVRQCRRLPDNFPVTDSMVQASMEDSSLTTEIMKGKIFLCDYALLDGVQANTVNLRRQYVGAPLCLLYQNKNDKLIPIAIQCNQPAGEENPIFVPGDSKEDWLLAKLYVRAADFLIHQLDAHLLRTHLLVEVYTLCTLHNLPAVHPVYKLLIPHTQYTLHINTLARERLLAKDGLIIKYSAVSKEGLNTVLRKALDSLQYSALC-LPEDIEAR---GLKDIPNFFYRDDGQEVWDIITKYVGGVLQFYYPSD-IEVAADVELQKWIGDI-----------------------FLHGFLGNEKS-----------------NIPKAFRSKDELIKFVTMVI-FTMTAQHSALNSGQFDFGGW-----------IPNSPPSLQSPPRKVKGRATEGTLLHTLPDVNVSVQSMAAVWGLTRKPEEFVSLGNHTEQYFTEPDVVAVINVMKDELKQLSEKIKKRNEGKDL 568          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Cavefish
Match: ENSAMXT00000046619.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000924.1:26844:39215:1 gene:ENSAMXG00000029118.1 transcript:ENSAMXT00000046619.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 146.747 bits (369), Expect = 2.479e-36
Identity = 129/527 (24.48%), Postives = 241/527 (45.73%), Query Frame = 2
Query:  692 QRRLTDLYGDQSFWSSLENLHNLYSQYNITEPIGLTNSI----VNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHL-EGWSVKHVIKARRLYIVDFKIMDGLNCKPDRIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQTSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARVTQS--VLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQY 2248
            + +L   + ++  W+++  L ++ + +NI  P+ LT  +    + D  FG Q L G NP ++K C+E+P+NF VT + +K  L E  +++  I+   +++ D+K +        + + AP+ L F T E +L P+AIQL Q     N +FLPSD    WLLAK++   A+   H +   L+   +L  ++ + + RN    HP+++LL PH    L ++   +  + S DG  +Q   +  K + + +KRA  + ++  +  +  ++  R V   + + NY YRDD L + N   +FV  ++  +Y    +D+  D+ELQ W  E+ +               E +K G  +S +  ++    +   +F+   Q +      +NN +                         +D   +           +P+ P+     P   + D   D ++  LPD  +TL+++  V + +R +     LG F      +   L L+  F++ L  +   IE+ NK  D+ + Y
Sbjct:  144 ELKLGTEFNNKDRWNNIGEL-SIIALFNIFMPV-LTEYVEKNWMRDDFFGYQFLNGLNPTMIKRCSELPENFPVTNDMVKRSLPEKSTLEMEIEKGNIFLCDYKRLK-------QYLSAPLCLLFSTPENKLTPIAIQLDQKPGARNPIFLPSDNEKDWLLAKIFVRGAEFNEHELNFHLLRTHLLGEVFTMAVLRNLPSCHPLFKLLVPHVRYNLQINIMARNLLVSPDGVFSQYTAIGNKPMTEFLKRAASSLTYS-SLCLPDNIRERGV---EKIPNYYYRDDGLDLWNIIYSFVHGVLSFYY--NDEDVQKDKELQAWIDEIVE-----------NCFQEKSKTGFPQSFVTVEELSKFVTMVIFTVSAQHA-----AVNNGQ-------------------------FDFGAW-----------MPNFPSSLQCPPPIRKGDTTDDTILKTLPDVSTTLNIMAVVYLLSRESSDRYPLGYFPEALFREDTPLDLIAKFQEDLRVLDKKIEKRNKKLDLPYTY 603          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004004.1 (pep scaffold:Pmarinus_7.0:GL480279:6425:26929:-1 gene:ENSPMAG00000003663.1 transcript:ENSPMAT00000004004.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 153.295 bits (386), Expect = 4.412e-40
Identity = 92/282 (32.62%), Postives = 146/282 (51.77%), Query Frame = 2
Query:  815 DICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLE-GWSVKHVIKARRLYIVDFKIMDGLNCKPD-----RIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNW 1639
            D  FG Q L GCNP+V K CTEIP    VT E ++  LE   S++   K   ++I D+ IMDG+          + + AP+ L +    K+L P+AIQL Q+    N +FLP+D    W+LAKMW    D   H  V  L++  ++  ++ + M R     HPI++LL  H    + ++ K +E +  K G   +       G  QLV+RA K   ++ +    K+++ R V   ++L  Y YR D   + N    FV++++ ++YP+  K + +D E+Q W
Sbjct:   10 DFMFGYQFLNGCNPVVFKKCTEIPAKLPVTHEMVEACLERSISLEEEAKQGNIFIADYSIMDGIQANSTDPCTMQYVAAPICLLYNNVNKKLVPIAIQLQQTPGSDNPIFLPTDSNNDWMLAKMWARSCDFHVHQTVSHLLHTHLISEVFGIAMFRQLPAVHPIFKLLVHHTRFTIAINTKAREELICKCGLFDKANATGGGGHVQLVQRAVKELKYE-HLQFPKNIQMRGVDSEESLPYYFYRKDGQQVWNCTAQFVKEVLAVYYPDD-KTVKMDSEVQAW 289          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006734.1 (pep scaffold:Pmarinus_7.0:GL476592:109075:119405:-1 gene:ENSPMAG00000006039.1 transcript:ENSPMAT00000006734.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 140.584 bits (353), Expect = 3.398e-35
Identity = 129/514 (25.10%), Postives = 220/514 (42.80%), Query Frame = 2
Query:  719 DQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHL-EGWSVKHVIKARRLYIVDFKIMDGL-----NCKPDRIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQTSVNFKNTINNPEDLVSLLTGILHLSIIVCG---SGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKH-STLDVLISVRMAARVTQSVLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKN 2227
            D   W+ +E+   L+++        +++    D  FG Q + G NP+++K CT++P+NF VT   +K  L    S++  IK   +YIVD++ +DG+     N      + APM L +  ++ QL P+AIQL Q  +  N +FLPSD    W+LAKMW    D   H I   L+   +L  ++ +   R     HP++++L     N LV+  K+        G +   + +   G  +L  +  K  ++  +  I KD+  R V DL +   Y YRDDA  I      FV K++ +FY    +D+  D ELQ +                                        D+N ++ S       N  N        VS L+  L + + +C    S +    +D Y +           +P+ P+     P   +   ++  ++  LPD   S + + ++  ++    +  LG F  +    P+ALK +++++  LE I   I   NK 
Sbjct:   89 DGMSWTKIEDFRRLFTRVKSEIAEYISHHWDQDWFFGYQFMNGVNPVLIKRCTKLPENFPVTTNMVKSSLVRECSLEDEIKHGNVYIVDYQCLDGIPGNTFNHSKPFYLAAPMCLLYVNKQGQLLPIAIQLQQKPSADNPIFLPSDSAHDWMLAKMWVRSMDFQIHEISTHLLKTHLLAEVFTMATLRQLSTMHPVHKILP----NTLVIFVKVNFYTCGLCGTILPALSIGGGGHFKLGGKGLKALTYR-HLCILKDVADRGVGDLPS---YYYRDDACSIWKTIHKFVDKILAIFY-KSDEDVRGDAELQAF--------------------------------------VDDINHALLS-------NPSNGFPTKFTCVSELSEFLTMVVFLCSAQHSAVNYGQFDFYAW-----------IPNAPSAMRKPPPATKGVVDMPFILQTLPDVQVSCVSMALTWVLSRSAAEKTLGTFQDEPFQNPDALKAMQEYQSDLEVITKSIVERNKT 537          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Sea Lamprey
Match: zgc:152891 (zgc:152891 [Source:ZFIN;Acc:ZDB-GENE-061013-229])

HSP 1 Score: 133.265 bits (334), Expect = 6.757e-33
Identity = 127/523 (24.28%), Postives = 214/523 (40.92%), Query Frame = 2
Query:  719 DQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHL-EGWSVKHVIKARRLYIVDFKIMDGL-----NCKPDRIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQ-LLAPHFTN--------CLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQTSVNFKNTINNPEDLVSLLTGILHLSIIVCG---SGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKH-STLDVLISVRMAARVTQSVLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKN 2227
            D   W+ +E+   L+++        +++    D  FG Q + G NP+++K CT++P+NF VT   +K  L    S++  IK   +YIVD++ +DG+     N      + APM L +  ++ QL P+AIQL Q  +  N +FLPSD    W+LAKMW    D   H I   L+   +L  ++ +   R     HP+++ ++ P   N        C V +  +  +I     +      L     + L               I KD+  R V DL +   Y YRDDA  I      FV K++ +FY    +D+  D ELQ +                                        D+N ++ S       N  N        V+ L+  L + + +C    S +    +D Y +           +P+ P+     P   +   ++  ++  LPD   S + + I+  ++    +  LG F  +    P+ALK +++++  LE I   I   NK 
Sbjct:   71 DGMSWTKIEDFRRLFTRVKSEIAEYISHHWDQDWFFGYQFMNGVNPVLIKRCTKLPENFPVTTNMVKSSLVRECSLEDEIKHGNVYIVDYQCLDGIPGNTFNHSKPFYLAAPMCLLYVNKQGQLLPIAIQLQQKPSADNPIFLPSDSAHDWMLAKMWVRSMDFQIHEISTHLLKTHLLAEVFTMATLRQLSTMHPVHKNVVTPFLVNLYPNTFPQCHVHTVTMALSIGGGGHFKLGGKGLKTLTYRHLC--------------ILKDVADRGVGDLPS---YYYRDDACSIWKTIHKFVDKILAIFYKRD-EDVRGDAELQAF--------------------------------------VDDINHALLS-------NPSNGFPTKFTCVAELSEFLTMVVFLCSAQHSAVNYGQFDFYAW-----------IPNAPSAMRKPPPTTKGVVDMPFILQTLPDVQVSCISMAITWVLSRSAAEKTLGTFPDEPFQNPDALKAMQEYQSDLEVITKSIVERNKT 519          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003097.1 (pep scaffold:Pmarinus_7.0:GL477262:63996:70580:-1 gene:ENSPMAG00000002831.1 transcript:ENSPMAT00000003097.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.7962 bits (190), Expect = 7.785e-16
Identity = 64/287 (22.30%), Postives = 136/287 (47.39%), Query Frame = 2
Query:  845 GCNPLVLKLCT---EIPDNFEVTVEWLKPHLEGWSVKHVIKARRLYIVDFKIMDG-----LNCKPDRIMPAPMALFFFT----EEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRL-INQMILENIYVCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQN-IQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLK--ALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSD 1657
            G NP+++K+C+   ++P +    +       +  +++ ++  RRL+IVD+K + G          ++   AP+ L +         +L PL IQLT++  E      P+     +L AK+    A+   H  V  L +  +++E   + +    G  H + +LL PH T+ + ++   +  + +  G +  +   +   G  +L   +++ + F +  +  ++L +R   + +   L ++ YRDD   + +   A+VR++V   Y +   D+L D+ LQ++   L+D
Sbjct:    1 GANPMLIKVCSSVDQVPPDMRCLLG------QDRTLEELMSERRLFIVDYKALAGESRSRTRGTQEKKFYAPVVLLYREMCPDGTGRLMPLGIQLTRNPRELRWRHTPTSRAWDYLFAKIHVGCAENQMHQFVSHLALTHLLMEPFAIAVHNYLGPKHVLGRLLRPHCTDTIGINYVARHTLIAAVGPLTNSTFAVGTVGGLRLAVASFQRYDF-MEWSFPRELHNRGFDEARDDGLEDFLYRDDGFKLWHVLGAYVREVVCRHY-HTDADVLHDKGLQDFAAALAD 279          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003100.1 (pep scaffold:Pmarinus_7.0:GL477262:65962:71085:-1 gene:ENSPMAG00000002831.1 transcript:ENSPMAT00000003100.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.4034 bits (176), Expect = 4.967e-14
Identity = 58/268 (21.64%), Postives = 125/268 (46.64%), Query Frame = 2
Query:  827 GAQRLKGCNPLVLKLCT---EIPDNFEVTVEWLKPHLEGWSVKHVIKARRLYIVDFKIMDGLNC--KPDRIMPAPMALFFFT----EEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRL-INQMILENIYVCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQN-IQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLK--ALNNYPYRDDALLIHNAFTAFVRKMVKLFY 1591
            G     G NP+++K+C+   ++P +    +       +  +++ ++  RRL+IVD+K +  L+     ++   AP+ L +         +L PL IQLT++  E      P+     +L AK+    A+   H  V  L +  +++E   + +    G  H + +LL PH T+ + ++   +  + +  G +  +   +   G  +L   +++ + F +  +  ++L +R   + +   L ++ YRDD   + +   A+VR++V   Y
Sbjct:   16 GVSTAAGANPMLIKVCSSVDQVPPDMRCLLG------QDRTLEELMSERRLFIVDYKALAVLHIPLHQEKKFYAPVVLLYREMCPDGTGRLMPLGIQLTRNPRELRWRHTPTSRAWDYLFAKIHVGCAENQMHQFVSHLALTHLLMEPFAIAVHNYLGPKHVLGRLLRPHCTDTIGINYVARHTLIAAVGPLTNSTFAVGTVGGLRLAVASFQRYDF-MEWSFPRELHNRGFDEARDDGLEDFLYRDDGFKLWHVLGAYVREVVCRHY 276          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Nematostella
Match: EDO42509 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1H7])

HSP 1 Score: 267.314 bits (682), Expect = 8.824e-79
Identity = 163/480 (33.96%), Postives = 252/480 (52.50%), Query Frame = 2
Query:  128 FEICIVSGDYKEIEDPPSIFMVLFDEQQRQSPTLSYTNLIQDD--EGKIQAKFSIENKPWCKIRNFNKLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIF--YDCETFKGYEDPFSETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXXKFSKSEKWDIDNAKLDAINQRRLTDLYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLEGWSVKHVIKARRLYIVDFKIMDGLNCKPDRIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRL-INQMILENIYVCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNA 1552
            +EI + +GD K      +++  L      +S         ++D  +G + + F + N           L+ IE WR +  + D DWY+E + +++    L    E   FP H+W+   R  I   YDC   +  + P  E R  E+  K+E++ L +++ G                 ++W+I   K     + +LT L  D   W  LE+L N+Y + ++ +P GL N    D  F  QRL+GCNP +++LC EIP+NF VT E ++P L+G +++  I A+R+YI +   +  + C+ +R++  PMALFF    K+L P+AIQL Q   E N VFLPSDP  +W+LAKM++N ADA  H     L    ++ E I V   R    SHP+++LLAPHF   L ++      + S +GW+   +Q   +G+  L   ++K W  +VN  + K+L+ R V D +AL NYPYRDDALLIH  
Sbjct:   11 YEIIVKTGDVKGAGTDANVYCALVAVNGTRSRDFHLDCRWKNDFEKGNVDS-FKVANG-----TAIGPLKKIEIWRDDSGLGD-DWYVEWIKVKNI---LEPNSELDVFPCHRWVKAERKLILTKYDCMLPQFDDHP--EQRKRELEEKRELYRLVRKAPGI---------------PKQWNIQQTKYKLAVKCKLTKLTSDP--WEKLEDLDNVY-KGSMGKPYGLYN-WKEDSAFSRQRLQGCNPTMIELCREIPENFAVTSEMVEPFLDGMTLEEAINAKRIYICNLITLSDIVCRFNRLISKPMALFFVNNSKELMPIAIQLFQKPAEDNPVFLPSDPKYTWMLAKMYYNNADAAFHQSCTHLGFTHLVAETICVGTHRQVSPSHPVFRLLAPHFLYLLAINSLALARLVSPNGWIDICMQTGAEGLMGLCGASWKKWRMNVNGWLPKELKERGVDDAEALPNYPYRDDALLIHQG 459          

HSP 2 Score: 68.9366 bits (167), Expect = 4.869e-12
Identity = 44/149 (29.53%), Postives = 75/149 (50.34%), Query Frame = 2
Query: 1832 EDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARVTQSVLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQYYCMDPSILPN 2278
            EDL+  +T I+ +S  V  +      YDEY +P NY   L G  P+   E T      E+D     ++  +P K  TLD+++  ++ +    + LG F++ Y Y P   K +E+FR++L  +   ++  NK R   + Y  ++P  +PN
Sbjct:  470 EDLIKTVTSIIFISS-VGHAAANFAQYDEYAFPPNYPAFLRGKPPTSKEELT------EKD-----IIDHIPLKDMTLDIMLVTKILSDRGTNPLGDFEVQYQYDPIGTKAVENFRRKLTEVSAVLDERNKTRPFPYPY--LNPKEIPN 604          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Nematostella
Match: EDO29209 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4A3])

HSP 1 Score: 157.532 bits (397), Expect = 2.623e-41
Identity = 132/484 (27.27%), Postives = 214/484 (44.21%), Query Frame = 2
Query:  812 NDICFGAQRLKGCNPLVLKLCTEIPDNFE-VTVEWLKPHLEGWSVKHVIKARRLYIVDFKI-------MDGLNCKPDRIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGR-LINQMILENIYVCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQL-SKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQTSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARVTQS--VLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKN 2227
            +D  FG Q + G NPLVL  C + P+N   +          G S+   +K   +Y VD+KI       M G     +R M  P+ALF+  +   L P+AIQL Q   EGN V+ P D P+ WL AKMW   AD   H ++ R L+  ++ E   V   R     HP+++LL  H  N L ++   +  +  KDG +AQ + +   + + QL+++ YK ++++ + ++   L+ + + D   L  Y YRDDAL + NA   FVR+ + +FY    KD+  D E+Q W  ++S                    NG           +  L G            F N I     LV LLT +    I  C          ++    +  L++   +P+ P      P   +   +L+ ++LALP K  T   L  + + ++  +     GK       +PE   ++E ++ +L+ I   I + N+ 
Sbjct:    3 DDHVFGMQFMNGVNPLVLDRCDKFPENLAPLDGLVDDLLDRGKSLYREMKDGHIYKVDYKILEEIPRHMQGSGKDKERYMAEPIALFYANKSGDLIPIAIQLYQKPGEGNPVWTPHDAPLDWLYAKMWLKNADIQAHQVIHRLLLTHVMTEPFTVATWRQLPSIHPVHRLLFSHMRNTLALNVTARNELIGKDGILAQTLSIGGGESLVQLMQKFYKKFNWE-DMDVPNLLKRKGLDDKTKLQGYFYRDDALSLWNALKNFVREFLGVFY-KSDKDVTDDTEIQAWLSDIS-------------------TNG-----------FPTLQG-------HQDHKFPNMIRTRYQLVHLLTCV----IFNCTC--------QFAAVNSGQLEMSLFMPNAPCCLHLPPPTTKGVVDLETIMLALPTKKETAVHLGLMHVFSKCAEDEVSFGKNLCCQFQEPEVSTIIERYQNELQKISESIRKRNEG 435          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Nematostella
Match: EDO42294 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S208])

HSP 1 Score: 89.7373 bits (221), Expect = 2.075e-18
Identity = 87/313 (27.80%), Postives = 133/313 (42.49%), Query Frame = 2
Query:  815 DICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEW------LKPHLE-----------GWSVKHVIKARRLYIVDFKIMDGLNCKPDRIMPA-----------PMALFFFTE----EKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLI-NQMILENIYVCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELS 1654
            D  F   RL G NP+ L   T   D+    V+W      L P  +              V  +I    +++  F   D L   PD IM A           P+ALF        E Q+ PLAIQL   S + + V+ P D  + W LAK  F + D  +  +V  L+   +++E   V ++R+    HP+ Q+L  H    L  +K     +     ++ Q   +   G  QL+ RAY   ++  + +    + +R + D   +  +PYRDD  LI+ A   FV   +  +Y N R D+  D ELQ    E+S
Sbjct:  246 DQVFSEMRLAGLNPMCLTKVTG--DHESNGVKWSELRRRLNPQFDWEKMLQVAASRSAPVSMIINDGSVFVCQFPEFDNLPTVPD-IMEARSFRRMWKPKSPIALFMSRPGRGGEAQVVPLAIQL--DSVQDSPVYTPEDGDL-WTLAKESFEVTDYAYVEMVEHLLKTHLMMEPFCVTIKRHLATDHPLQQILRYHCRGLLPTNKIGLPKLVDDKAYMHQLFAIGNSGAVQLLVRAYMTMTWK-DTDFRGKIRARGMDDTDNVPYFPYRDDGELIYAAIEKFVGGYLNHYYGNDR-DVEDDHELQAMANEMS 550          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Nematostella
Match: EDO33210 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSW5])

HSP 1 Score: 76.6406 bits (187), Expect = 4.862e-16
Identity = 41/124 (33.06%), Postives = 64/124 (51.61%), Query Frame = 2
Query: 1076 PLAIQLTQSSNEGNLV--------FLPSDPPVSWLLAKMWFNMADACHHMIVGRL-INQMILENIYVCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVK 1420
            P+AIQL Q  +  N V        FLP DP  +W LAKMWFN A+A +H     +    +++E+I +   R    SHPI++LLAP   + + ++      + +   W+  +  L  KGI  L++
Sbjct:    2 PIAIQLFQEKSANNPVRMSFNNPVFLPGDPWYTWSLAKMWFNHAEAQYHRACALIGFTHLVIESIAIATHRQLSPSHPIFRLLAPFIRDVIAINSFEVNELLAPGSWLDSSTSLGSKGIVDLLQ 125          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Nematostella
Match: EDO44999 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUD1])

HSP 1 Score: 80.4925 bits (197), Expect = 2.428e-15
Identity = 74/313 (23.64%), Postives = 129/313 (41.21%), Query Frame = 2
Query:  752 HNLYSQYNITEPI-GLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHL------------------EGWSVKHVIKARRLYIVDFKIMDGLNCKP-------DRIMP--APMALFFFTEE----KQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADA-CHHMIVGRLINQMILENIYVCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFY 1591
            H  YS  +  + +  + ++   D CF  QRL G NP  +   T    N  V  + L   L                  +  ++   I A ++Y+  +  ++GLN            + P  AP+A+F   E     K+L P+AIQ       G       +    W  AK     AD    HMI  RL   + L+     + + F + HP++Q+L  H    L  +K  +  ++ +   + + + +      ++V + Y    F    ++ ++L+ R V D K L  YPYRDD   +++    FV + ++L+Y
Sbjct:  327 HKKYSAMSALKRVPSIEDNFYKDRCFADQRLAGANPFQIWRVTRSSANVGVGWDTLYEKLLNRDFDWHKAFRKVLETDDNDALDKAIDAGQMYVTFYPELEGLNATKLQDLKFNHTVSPLTAPIAMFVVKEAEPGVKRLTPVAIQ---GDAHGKATVYTPEEGKGWFYAKAMVQRADINVLHMIKKRLKTHLYLDAPCTLVEKYFSEYHPLHQMLRYHCRANLETNKLFELKLYGEKAPIYKALSIDYDNSVRMVNKEYGKMDFS-EIDLVEELKKRGVDDDKLLPYYPYRDDGKKLYSKIKEFVHQYIRLYY 635          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Medaka
Match: alox12 (arachidonate 5-lipoxygenase [Source:NCBI gene;Acc:101174953])

HSP 1 Score: 164.466 bits (415), Expect = 3.322e-42
Identity = 153/665 (23.01%), Postives = 293/665 (44.06%), Query Frame = 2
Query:  323 KLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYD--CETFKGYEDP-FSETRLEEIRHKQEIFSLYQRSSGF-----XXXXXXXXXXXKFSKSEKWDIDNA---KLDAINQRRLTDLYGDQSFWSSLENLHNLYSQYNITEPIG--LTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHL-EGWSVKHVIKARRLYIVDFKIMDGL-----NCKPDRIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLI-NQMILENIYVCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQ-TSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPD-KHSTLDVLISVRMAARVTQSV-LGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQY 2248
            +LE   +W      ++ +W+   V +     G     +   FP ++W  G       +    T K    P   E R +E++ ++E +     ++G           ++P++ +F   ++ D +++    L  ++ ++ T  +G    W+ LE+   ++  + +  PI     +    D  FG Q L G NP +++ C ++PDNF VT   ++  + +G ++   +KA  +Y++D+ IM+G+       KP + + AP+ L +   +  L P+AIQL Q+      +FLPSDPP++WLLAKMW   A+     ++  L+   +++E   V   R     HPIY+LLAPH    L ++ + +  + S+ G   + +    +G+  L +R YK  ++  +     D   R V  +    NY YRD +L++ +A  +FV  MV L+YP   +D+  D ELQ W R+++                                           G TQ  +   K+ +++ E+L +LL  ++                 ++    N        +P+ P      P   +    ++ ++  LPD   S + + I+  +      ++ LG++   +  +  AL++++ FRK+L+ I   I   N   D+ + +
Sbjct:    4 RLEKQRYW------VEDNWFCRYVTVEPEDGG-----KMQIFPCYRWFVGDSKIEIREGKATTVKDDTSPKLLEHRKKELQERRETYRWITWAAGIPRCIDAKTEADLPQDARFENEKRSDFEHSLHYALLELSLKKFTIRFGKS--WNDLEDFKRIF--WKLRSPIAEYCMDHWKEDWLFGYQCLNGSNPRMIQRCQKLPDNFPVTAGMVQSSMADGTTLNKELKAGNIYLLDYAIMEGIPTNTIKGKP-QFIAAPLCLLYQHPDDGLIPIAIQLEQTPGLDTPIFLPSDPPLAWLLAKMWVRHAEFQVFQLLSHLLRTHLVVEVFCVATLRQLPAVHPIYKLLAPHQRYTLEINCRGRTQLLSETGIFKRVVSTGGEGLLVLAQREYKVLTYR-SLQPRFDFIDRGVTQIP---NYFYRDHSLMLWDAIHSFVTGMVDLYYPTD-QDVQKDAELQAWIRDVTQ-----------------------------------------EGFTQLPNFGLKSKLSSREELSTLLAVVIFTPTA------------QHAATNNGQFDWCAWVPNTPCTMRLPPPTDKDAVTMEMIMATLPDVSQSCVQMAITWHLGRAQPDAIPLGQYPEQHFTERRALEMIDSFRKELKKIEEQILDQNAGLDLQYLF 594          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Medaka
Match: si:dkey-17e16.9 (hydroperoxide isomerase ALOXE3-like [Source:NCBI gene;Acc:101165367])

HSP 1 Score: 164.466 bits (415), Expect = 9.018e-42
Identity = 164/657 (24.96%), Postives = 288/657 (43.84%), Query Frame = 2
Query:  362 MMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDP---FSETRLEEIRHKQEIFSLYQRSSG--------FXXXXXXXXXXXKFSKSEKWDIDNAKLDAINQRRLTDLYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHL-EGWSVKHVIKARRLYIVDFKIMDGLNCKPDRI-------MPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQTSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAA-------RVTQSV-LGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQY 2248
            ++D  WY  KV +      +    E   FP  +WI  G        +  K +E+      + R +E++ ++   SLYQ + G           ++  +P E + S+    +I ++K     +     L G    W S+E+L  ++     +    ++     D  FG Q L G NP  +K C+++P NF VT E +KP L  G ++K  ++   +++ D +IM+G+   P R+       M A + LF+   E +L PLAIQL Q ++  N +FLP+DP   WLLAK++F  AD     +V  L+    L  ++ V   R F   HP+++LL PHF   L ++   +EA+   DG +  +     +G+ +L+ R     ++     + +++ +R    L ++ N+ YRDDAL + +   +FV  +VK  YP+   D+  D ELQ W  E+                 EN ++GV  S                              +  E++V  +T ++  ++ V  + +    +D + +  N SLQL              P   +    ++  + ALP      +V  SV+ AA       + T  V LG F  +   +P   ++++DF+ +L  +  +I   N    + + Y
Sbjct:  114 LLDDRWYCCKVEV------MTPEGEEIAFPCFRWISSGEEVELRGGKALKVFEEEHPLLIDHRNKELKLRK---SLYQWAVGDKKLPRHIHFTDISELPAEVQLSELRSDEIHHSKRKMNTELMFKGLAGSCKEWKSIEDLEKVFKSRKTSMSEYVSKHWKEDDFFGYQFLNGTNPNAIKRCSKLPPNFPVTEEMVKPCLPNGLTLKDEMEKGNIFLCDQRIMEGI---PTRVKDGNPLHMTAGLCLFYMNPEGKLMPLAIQLNQKASAENPIFLPTDPEKDWLLAKLFFKSADLLECEVVHHLLITHFLSEVFAVATLRCFPTIHPLHKLLIPHFRFTLHINIMGREALLGPDGALCAS-SFGLEGLMELMGRGLSETTYSALC-LPENITAR---GLDSIPNFYYRDDALKLWDVIESFVSSVVKDHYPSD-DDVFKDTELQEWIDEI-----------FTQGFLENKQSGVPAS-----------------------------FHTVEEVVKFVTMVI-FTVSVQHAAVNNGQFDFHSWIPNGSLQL-----------QKPPPTFKGQSRMNTFLQALP------NVGDSVKFAAMFWMLSDKYTDMVPLGAFPEERFSEPHLKQMIKDFQAELSYLSEEISLRNSKLQVPYAY 694          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Medaka
Match: alox12 (arachidonate 5-lipoxygenase [Source:NCBI gene;Acc:101174953])

HSP 1 Score: 164.851 bits (416), Expect = 9.519e-42
Identity = 153/665 (23.01%), Postives = 293/665 (44.06%), Query Frame = 2
Query:  323 KLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYD--CETFKGYEDP-FSETRLEEIRHKQEIFSLYQRSSGF-----XXXXXXXXXXXKFSKSEKWDIDNA---KLDAINQRRLTDLYGDQSFWSSLENLHNLYSQYNITEPIG--LTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHL-EGWSVKHVIKARRLYIVDFKIMDGL-----NCKPDRIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLI-NQMILENIYVCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQ-TSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPD-KHSTLDVLISVRMAARVTQSV-LGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQY 2248
            +LE   +W      ++ +W+   V +     G     +   FP ++W  G       +    T K    P   E R +E++ ++E +     ++G           ++P++ +F   ++ D +++    L  ++ ++ T  +G    W+ LE+   ++  + +  PI     +    D  FG Q L G NP +++ C ++PDNF VT   ++  + +G ++   +KA  +Y++D+ IM+G+       KP + + AP+ L +   +  L P+AIQL Q+      +FLPSDPP++WLLAKMW   A+     ++  L+   +++E   V   R     HPIY+LLAPH    L ++ + +  + S+ G   + +    +G+  L +R YK  ++  +     D   R V  +    NY YRD +L++ +A  +FV  MV L+YP   +D+  D ELQ W R+++                                           G TQ  +   K+ +++ E+L +LL  ++                 ++    N        +P+ P      P   +    ++ ++  LPD   S + + I+  +      ++ LG++   +  +  AL++++ FRK+L+ I   I   N   D+ + +
Sbjct:  137 RLEKQRYW------VEDNWFCRYVTVEPEDGG-----KMQIFPCYRWFVGDSKIEIREGKATTVKDDTSPKLLEHRKKELQERRETYRWITWAAGIPRCIDAKTEADLPQDARFENEKRSDFEHSLHYALLELSLKKFTIRFGKS--WNDLEDFKRIF--WKLRSPIAEYCMDHWKEDWLFGYQCLNGSNPRMIQRCQKLPDNFPVTAGMVQSSMADGTTLNKELKAGNIYLLDYAIMEGIPTNTIKGKP-QFIAAPLCLLYQHPDDGLIPIAIQLEQTPGLDTPIFLPSDPPLAWLLAKMWVRHAEFQVFQLLSHLLRTHLVVEVFCVATLRQLPAVHPIYKLLAPHQRYTLEINCRGRTQLLSETGIFKRVVSTGGEGLLVLAQREYKVLTYR-SLQPRFDFIDRGVTQIP---NYFYRDHSLMLWDAIHSFVTGMVDLYYPTD-QDVQKDAELQAWIRDVTQ-----------------------------------------EGFTQLPNFGLKSKLSSREELSTLLAVVIFTPTA------------QHAATNNGQFDWCAWVPNTPCTMRLPPPTDKDAVTMEMIMATLPDVSQSCVQMAITWHLGRAQPDAIPLGQYPEQHFTERRALEMIDSFRKELKKIEEQILDQNAGLDLQYLF 727          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Medaka
Match: alox5a (arachidonate 5-lipoxygenase [Source:NCBI gene;Acc:101160835])

HSP 1 Score: 157.532 bits (397), Expect = 1.229e-39
Identity = 147/668 (22.01%), Postives = 289/668 (43.26%), Query Frame = 2
Query:  317 FNKLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDPFS---ETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXXKFSKSEKWDIDNAKLDAINQRRLTD-------LYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLE-GWSVKHVIKARRLYIVDFKIMDGLNCKPD-----RIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRREL-SDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQTSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARVTQS--VLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQYYCMD 2260
            F KLE  ++W  +      DWY   + ++          +Y  FP  +W+      +  D   F   +D  S   + R +E+  +++I+   +   GFP+ +     + +  +  ++D +      +N  +  +       ++  QS WS   +   ++ +   T    +      D  FG Q L GCNP++++ C ++PD F VT E +   LE   +++  ++A  +YIVD +++DG++         + + AP+ L +   +K++ P+AIQL Q   E N +FLP+D    WLLAK+W   +D   H  V  L+   ++  ++ + M R     HP+Y+LL PH    + ++ K +E +  + G   +       G  QL+++A K  ++  +    + ++SR + D++ +  Y YRDD   +  A   FV  +V ++Y    + +  DEE+Q + +++ S  MQD                                              F  ++   E+L+  LT ++  +     + +    YD   +           +P+ P      P   +   N++ ++ +LPD+  +   L +V   ++  ++   LG +  ++  +    + +E FRKQL  I   I++ N  + + + Y   D
Sbjct:   67 FVKLEKKKYWVQD------DWYCRYITVKTPSG------DYLEFPCFRWLVDDSEVVLRDGRAFLPQDDKTSLVKQHRQKELETRRKIYKWKEWQPGFPMSINANKHK-ELPRDIQFDSEKGMDFLLNYSKAIENLCVNQFMHMFQSSWSDFGDFEKIFVRIKNTISEYVMEHWKEDFMFGYQFLNGCNPVLIRKCHKLPDKFPVTDEMVSVSLERELTLEQEMEAGNVYIVDCELLDGISANSTDPCTLQYLAAPICLLYKNNQKKIMPIAIQLGQDPKE-NPIFLPTDSEYDWLLAKIWVRSSDFQIHQTVTHLLRTHLMTEVFGIAMFRQLPAVHPVYKLLIPHIRFTIAINTKAREQLICECGIFDKANATGGGGHVQLIQKAMKTLTYK-SLCFPEMIKSRNMDDVEEMPTYFYRDDGYKVWEATKNFVSDVVSIYYTCDER-VQEDEEIQAFIKDVCSFGMQDF-----------------------------------------DHCEFPKSVKTCEELIEYLTVVV-FTASSQHAAVNFGQYDWCSW-----------IPNAPPTMRKPPPNEKGLANVNLIIDSLPDRGRSSWHLGAVWALSQFQENELYLGMYPDEHFIEKPVKQAMEKFRKQLTEISSFIKKRNDGKKLPYAYLSPD 665          
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Medaka
Match: ENSORLT00000035939.1 (arachidonate 15-lipoxygenase B-like [Source:NCBI gene;Acc:101165945])

HSP 1 Score: 151.754 bits (382), Expect = 1.055e-37
Identity = 151/645 (23.41%), Postives = 279/645 (43.26%), Query Frame = 2
Query:  377 WYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDPFS---ETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXX-------KFSKSEKWDIDNAKLDAINQRRLTDLYGDQSFWSSLENLHNLY--SQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLEGWSVKHVIKARRLYIVDFKIMDG-----LNCKPDRIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIY-VCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGG--TQTSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYD---EYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARVTQSV--LGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDI 2236
            W+L  V ++        Y + F FPVH+WI     + F +    +  +D       +R +E++ ++E +  +  + G P  ++              F+KS ++    A      + +  D    +  W+++ ++  ++   Q +I + +        D  FG Q L G NP++++ CTE+P NF VT   L P  +  S+   I+   +++ D+K +DG     +N K   +M AP+ L   T +++L P+AIQL Q+  E N +FLP+D    WLLAK++   AD   H +   L+   +L  +Y V + RN    HP+Y+LL PH    L ++   +  + S++G   Q      +G+  +++R+    ++  +  I  D+  R + D+    NY YRDD L +      FV+ +++ +Y N  +++  D E+Q W   +SD                                       +F  G  +Q S     +     +LV  +T      +IV GS     +     +YG            +P+ P      P   + + N   ++  LPD + T+  + +V + ++ +     LG +   +  +    K ++ F+ QLE +  DI   NK  ++
Sbjct:   84 WFLSMVEVKS------PYGDTFTFPVHRWISDSNVHRFREAAALRVLDDKHHLGRYSREQELKVREEAYRWHVYTEGLPHCIKAEDLTSLPCEVQFSFTKSTEFAFTAASGLLELKLKGLD--NCKKGWTNIHDIDQVFCCKQTDIADYV--QKHWKEDSFFGIQYLNGVNPILIRRCTELPKNFPVTDSMLFPSGQ-MSLDAEIQKGNIFLCDYKHLDGVKTNTINGKTQYLM-APLVLLQKTADEKLMPIAIQLKQTPAEDNPIFLPTDSEYDWLLAKIFVRSADFSEHQLNTHLLRAHLLAEVYAVSLLRNVPMVHPLYKLLIPHTRYTLQINFLARNLLISENGSFTQFSASGGEGMLTILRRSLSAVTYS-SLCITDDIAERGMQDVP---NYFYRDDGLRLWYIIYRFVKGVIEYYYKND-QEVQQDTEIQKW---ISD---------------------------------------IFEHGFLSQASTGIPQSFTTLAELVKFVT-----MVIVTGSSQHAAVNSGQFDYG----------SWMPNTPISLKRPPPTKKGEANETTMLETLPDVNVTVQGMATVWLLSQQSSDFVPLGVYPEQHFTEETPRKFIKIFQAQLEELSNDIIARNKKLEV 654          
BLAST of Arachidonate 5-lipoxygenase vs. Planmine SMEST
Match: SMESG000077360.1 (SMESG000077360.1)

HSP 1 Score: 1463.74 bits (3788), Expect = 0.000e+0
Identity = 730/730 (100.00%), Postives = 730/730 (100.00%), Query Frame = 2
Query:  101 MGSNKSKIAFEICIVSGDYKEIEDPPSIFMVLFDEQQRQSPTLSYTNLIQDDEGKIQAKFSIENKPWCKIRNFNKLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDPFSETRLEEIRHKQEIFSLYQRSSGFXXXXXXXXXXXKFSKSEKWDIDNAKLDAINQRRLTDLYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLEGWSVKHVIKARRLYIVDFKIMDGLNCKPDRIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIYVCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDXXXXXXXXXXXENTKNGVLKSTLDRDKAYADLNGSVFSGGTQTSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARVTQSVLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQYYCMDPSILPNYPGV 2290
            MGSNKSKIAFEICIVSGDYKEIEDPPSIFMVLFDEQQRQSPTLSYTNLIQDDEGKIQAKFSIENKPWCKIRNFNKLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDPFSETRLEEIRHKQEIFSLYQRSSGFPVEVENVPEEEKFSKSEKWDIDNAKLDAINQRRLTDLYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLEGWSVKHVIKARRLYIVDFKIMDGLNCKPDRIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIYVCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDGGMGIKGIPGGENTKNGVLKSTLDRDKAYADLNGSVFSGGTQTSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARVTQSVLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQYYCMDPSILPNYPGV
Sbjct:    1 MGSNKSKIAFEICIVSGDYKEIEDPPSIFMVLFDEQQRQSPTLSYTNLIQDDEGKIQAKFSIENKPWCKIRNFNKLEHIEFWRSNETMMDYDWYLEKVIIRDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDPFSETRLEEIRHKQEIFSLYQRSSGFPVEVENVPEEEKFSKSEKWDIDNAKLDAINQRRLTDLYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGCNPLVLKLCTEIPDNFEVTVEWLKPHLEGWSVKHVIKARRLYIVDFKIMDGLNCKPDRIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVSWLLAKMWFNMADACHHMIVGRLINQMILENIYVCMRRNFGQSHPIYQLLAPHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDVNANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNGRKDLLLDEELQNWRRELSDPMQDGGMGIKGIPGGENTKNGVLKSTLDRDKAYADLNGSVFSGGTQTSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLRLPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPDKHSTLDVLISVRMAARVTQSVLGKFDIDYIYQPEALKLLEDFRKQLEAIRLDIERSNKNRDIYHQYYCMDPSILPNYPGV 730          
The following BLAST results are available for this feature:
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ALOX58.419e-4422.88arachidonate 5-lipoxygenase [Source:HGNC Symbol;Ac... [more]
ALOX58.419e-4422.88arachidonate 5-lipoxygenase [Source:HGNC Symbol;Ac... [more]
ALOX58.156e-4124.27arachidonate 5-lipoxygenase [Source:HGNC Symbol;Ac... [more]
ALOX58.156e-4124.27arachidonate 5-lipoxygenase [Source:HGNC Symbol;Ac... [more]
ALOX12B4.227e-3924.32arachidonate 12-lipoxygenase, 12R type [Source:HGN... [more]
back to top
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alox5b.22.560e-4522.73arachidonate 5-lipoxygenase b, tandem duplicate 2 ... [more]
alox5a3.958e-4223.09arachidonate 5-lipoxygenase a [Source:ZFIN;Acc:ZDB... [more]
alox5a5.255e-4223.09arachidonate 5-lipoxygenase a [Source:ZFIN;Acc:ZDB... [more]
si:dkey-17e16.93.598e-4123.91si:dkey-17e16.9 [Source:ZFIN;Acc:ZDB-GENE-091118-1... [more]
alox5b.18.074e-4125.25arachidonate 5-lipoxygenase b, tandem duplicate 1 ... [more]
back to top
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ALOX51.362e-4022.49arachidonate 5-lipoxygenase [Source:NCBI gene;Acc:... [more]
ALOX54.620e-4024.77arachidonate 5-lipoxygenase [Source:NCBI gene;Acc:... [more]
ALOX51.493e-3925.50arachidonate 5-lipoxygenase [Source:NCBI gene;Acc:... [more]
ALOX58.231e-3924.25arachidonate 5-lipoxygenase [Source:NCBI gene;Acc:... [more]
ALOX51.596e-3724.12arachidonate 5-lipoxygenase [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Alox51.931e-4423.07arachidonate 5-lipoxygenase [Source:MGI Symbol;Acc... [more]
Alox55.651e-4124.32arachidonate 5-lipoxygenase [Source:MGI Symbol;Acc... [more]
Alox12b1.724e-3724.71arachidonate 12-lipoxygenase, 12R type [Source:MGI... [more]
Alox81.806e-3727.03arachidonate 8-lipoxygenase [Source:MGI Symbol;Acc... [more]
Alox52.317e-3523.74arachidonate 5-lipoxygenase [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Arachidonate 5-lipoxygenase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P51399|LOX5_MESAU5.024e-4423.05Arachidonate 5-lipoxygenase OS=Mesocricetus auratu... [more]
sp|P48999|LOX5_MOUSE1.351e-4323.07Arachidonate 5-lipoxygenase OS=Mus musculus OX=100... [more]
sp|P09917|LOX5_HUMAN4.043e-4322.88Arachidonate 5-lipoxygenase OS=Homo sapiens OX=960... [more]
sp|P12527|LOX5_RAT2.658e-4222.90Arachidonate 5-lipoxygenase OS=Rattus norvegicus O... [more]
sp|O75342|LX12B_HUMAN2.030e-3824.32Arachidonate 12-lipoxygenase, 12R-type OS=Homo sap... [more]
back to top
BLAST of Arachidonate 5-lipoxygenase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3NXQ10.000e+049.53Allene oxide synthase-lipoxygenase protein (Fragme... [more]
A0A4Z2DLH60.000e+046.21Allene oxide synthase-lipoxygenase protein OS=Schi... [more]
A0A183STJ90.000e+047.49Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A5K4F2520.000e+045.81Putative 12-lipoxygenase OS=Schistosoma mansoni OX... [more]
A0A4E0RKH30.000e+045.33Arachidonate 5-lipoxygenase OS=Fasciola hepatica O... [more]
back to top
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alox5a1.877e-4023.05arachidonate 5-lipoxygenase [Source:NCBI gene;Acc:... [more]
alox124.769e-4022.71arachidonate 12-lipoxygenase, 12S-type [Source:NCB... [more]
alox5a7.366e-4025.64arachidonate 5-lipoxygenase [Source:NCBI gene;Acc:... [more]
ENSAMXT00000046181.12.758e-3822.83pep primary_assembly:Astyanax_mexicanus-2.0:15:180... [more]
ENSAMXT00000046619.12.479e-3624.48pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004004.14.412e-4032.62pep scaffold:Pmarinus_7.0:GL480279:6425:26929:-1 g... [more]
ENSPMAT00000006734.13.398e-3525.10pep scaffold:Pmarinus_7.0:GL476592:109075:119405:-... [more]
zgc:1528916.757e-3324.28zgc:152891 [Source:ZFIN;Acc:ZDB-GENE-061013-229][more]
ENSPMAT00000003097.17.785e-1622.30pep scaffold:Pmarinus_7.0:GL477262:63996:70580:-1 ... [more]
ENSPMAT00000003100.14.967e-1421.64pep scaffold:Pmarinus_7.0:GL477262:65962:71085:-1 ... [more]
back to top
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO425098.824e-7933.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO292092.623e-4127.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422942.075e-1827.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332104.862e-1633.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449992.428e-1523.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Arachidonate 5-lipoxygenase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alox123.322e-4223.01arachidonate 5-lipoxygenase [Source:NCBI gene;Acc:... [more]
si:dkey-17e16.99.018e-4224.96hydroperoxide isomerase ALOXE3-like [Source:NCBI g... [more]
alox129.519e-4223.01arachidonate 5-lipoxygenase [Source:NCBI gene;Acc:... [more]
alox5a1.229e-3922.01arachidonate 5-lipoxygenase [Source:NCBI gene;Acc:... [more]
ENSORLT00000035939.11.055e-3723.41arachidonate 15-lipoxygenase B-like [Source:NCBI g... [more]
back to top
BLAST of Arachidonate 5-lipoxygenase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000077360.10.000e+0100.00SMESG000077360.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032236 ID=SMED30032236|Name=Arachidonate 5-lipoxygenase|organism=Schmidtea mediterranea sexual|type=transcript|length=2684bp
AAAAAATACTTGTTTTAAGGAAATATAAAATAATTTTATTCAATCTTTTT
AAAATATACTTTTAGAATAAATTATTTTTAATTTTGTAAACGTTTTAAAA
ATGGGGAGTAATAAATCAAAAATAGCATTCGAAATATGTATAGTTTCTGG
AGACTATAAAGAAATAGAAGATCCCCCGTCCATATTTATGGTTTTATTCG
ATGAACAACAAAGACAGTCACCAACACTCTCATATACGAATCTTATTCAA
GATGATGAAGGTAAAATTCAGGCAAAATTTTCTATAGAAAATAAACCTTG
GTGTAAAATTAGAAATTTCAATAAATTGGAACACATAGAATTCTGGCGAT
CGAATGAAACTATGATGGATTACGATTGGTATTTGGAGAAAGTTATTATC
CGCGATCGAAGACATGGATTGCGTGGATATTGGGAATATTTCTTTTTCCC
AGTCCACCAATGGATTGGAGGCGGACGGCATTACATTTTTTATGACTGTG
AGACCTTTAAGGGTTATGAAGATCCATTTTCAGAAACCCGATTAGAAGAA
ATTAGACATAAACAAGAAATTTTTTCTTTATATCAAAGGTCCAGTGGATT
TCCTGTAGAGGTAGAAAACGTTCCAGAAGAAGAAAAGTTCAGTAAAAGTG
AAAAATGGGACATCGACAACGCCAAACTTGACGCTATCAATCAAAGGCGC
CTCACAGACTTGTATGGGGATCAATCTTTCTGGAGTTCACTTGAAAATTT
ACACAATCTCTATTCTCAATATAACATCACAGAACCAATTGGATTAACAA
ATTCTATCGTGAATGACATTTGTTTTGGTGCACAACGATTGAAAGGGTGC
AATCCATTAGTTTTGAAATTATGCACTGAAATTCCTGACAATTTTGAGGT
GACGGTGGAATGGTTGAAACCTCATCTTGAGGGTTGGTCAGTAAAACATG
TCATTAAAGCTCGTCGATTATACATAGTTGACTTTAAAATTATGGATGGA
TTAAATTGTAAACCAGATCGAATTATGCCAGCTCCAATGGCATTATTTTT
CTTCACTGAAGAAAAACAACTGAAACCGTTAGCGATTCAATTAACTCAAT
CATCAAATGAAGGAAATTTAGTTTTCTTACCAAGCGATCCGCCGGTGTCG
TGGCTATTAGCCAAAATGTGGTTCAACATGGCCGACGCGTGCCACCATAT
GATAGTTGGGCGATTAATAAATCAAATGATCTTAGAAAACATATACGTCT
GTATGCGTCGAAATTTTGGCCAGTCTCATCCCATATATCAACTATTAGCT
CCTCATTTCACAAATTGTCTTGTTGTATCAAAGAAATTGAAAGAAGCCAT
ATTTTCAAAAGACGGTTGGGTAGCCCAAAATATTCAACTATCTAAAAAAG
GAATCAAGCAACTTGTTAAAAGAGCTTATAAAAATTGGTCATTTGACGTC
AATGCGAATATTCACAAGGATCTCGAGTCTCGTAAAGTTTACGATTTAAA
AGCTTTGAACAATTATCCATATAGAGATGATGCTTTACTTATTCATAACG
CATTTACAGCATTTGTGAGAAAAATGGTCAAACTATTTTACCCAAATGGT
CGTAAGGACCTACTTTTGGATGAGGAGCTTCAGAATTGGCGTCGAGAGTT
GTCGGACCCAATGCAAGATGGTGGCATGGGTATAAAAGGTATTCCTGGAG
GAGAAAATACTAAAAATGGTGTTTTGAAGAGTACGCTTGATAGAGATAAA
GCTTATGCTGACTTAAATGGAAGTGTATTTAGTGGAGGGACTCAAACTTC
TGTAAACTTTAAAAACACAATAAACAATCCAGAAGATTTAGTATCATTAC
TTACGGGAATTCTGCACTTATCTATTATCGTTTGTGGATCAGGTTTACGG
TTGCCTATGTATGATGAATATGGATATCCTCTCAATTATTCACTACAGCT
CTTGGGCAACTTACCTTCGGATCCCACCGAAAGAACCACTGATCCTTTGC
AAATAGAACAAGATCAAAATTTGGATCAAGTCGTATTAGCCTTACCTGAT
AAGCATTCAACGCTTGATGTACTAATTAGTGTACGTATGGCTGCCCGAGT
TACCCAATCAGTGCTCGGTAAATTCGATATAGATTATATCTACCAACCAG
AAGCGTTAAAACTGTTAGAAGACTTCCGCAAACAACTGGAAGCCATCCGG
CTGGACATAGAAAGAAGCAATAAGAATCGAGATATTTATCATCAATATTA
TTGTATGGATCCGAGCATCCTTCCGAATTATCCCGGAGTATGATATCATC
GTATCGTTTTATTGTCGCACCCGATCCAATGAAATGTGATTTCTGTATAA
CGGCAAATTCATTCGAGAGTGGTTTGATTATCAACTGTGAGTGCTCATTG
CTTTTGTATACCTTTCAATTATCTGTTTCTACATATCCTTTTTTCGTAAA
TGATATTTTAGACTGTATTTTCAGCGATATGTATTTGTATTCAATGAATC
CCTTTGGCTGTGAACTACAACACATATCTTCATTGTTTTTATTCGCGACA
GTTTTTTGTAAAAACCGGGCTACCCAATTTCAGATTTAGAATGTTTTAAA
AATTTGTTTTAAATAAAGTCAATGATTTTTTTTAATCTGTTTAACTCTGA
CTTTTGTCATTTTCTTTTCGTCGGTGATTTCAAG
back to top

protein sequence of SMED30032236-orf-1

>SMED30032236-orf-1 ID=SMED30032236-orf-1|Name=SMED30032236-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=731bp
MGSNKSKIAFEICIVSGDYKEIEDPPSIFMVLFDEQQRQSPTLSYTNLIQ
DDEGKIQAKFSIENKPWCKIRNFNKLEHIEFWRSNETMMDYDWYLEKVII
RDRRHGLRGYWEYFFFPVHQWIGGGRHYIFYDCETFKGYEDPFSETRLEE
IRHKQEIFSLYQRSSGFPVEVENVPEEEKFSKSEKWDIDNAKLDAINQRR
LTDLYGDQSFWSSLENLHNLYSQYNITEPIGLTNSIVNDICFGAQRLKGC
NPLVLKLCTEIPDNFEVTVEWLKPHLEGWSVKHVIKARRLYIVDFKIMDG
LNCKPDRIMPAPMALFFFTEEKQLKPLAIQLTQSSNEGNLVFLPSDPPVS
WLLAKMWFNMADACHHMIVGRLINQMILENIYVCMRRNFGQSHPIYQLLA
PHFTNCLVVSKKLKEAIFSKDGWVAQNIQLSKKGIKQLVKRAYKNWSFDV
NANIHKDLESRKVYDLKALNNYPYRDDALLIHNAFTAFVRKMVKLFYPNG
RKDLLLDEELQNWRRELSDPMQDGGMGIKGIPGGENTKNGVLKSTLDRDK
AYADLNGSVFSGGTQTSVNFKNTINNPEDLVSLLTGILHLSIIVCGSGLR
LPMYDEYGYPLNYSLQLLGNLPSDPTERTTDPLQIEQDQNLDQVVLALPD
KHSTLDVLISVRMAARVTQSVLGKFDIDYIYQPEALKLLEDFRKQLEAIR
LDIERSNKNRDIYHQYYCMDPSILPNYPGV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000907LipOase
IPR036226LipOase_C_sf
IPR036392PLAT/LH2_dom_sf
IPR013819LipOase_C
IPR001024PLAT/LH2_dom
IPR020834LipOase_CS
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0016702oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
GO:0005515protein binding
GO:0016491oxidoreductase activity
GO:0051213dioxygenase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 689..709
NoneNo IPR availableGENE3DG3DSA:2.60.60.20coord: 1..132
e-value: 4.7E-8
score: 34.7
NoneNo IPR availableGENE3DG3DSA:3.10.450.60coord: 258..362
e-value: 1.5E-31
score: 111.3
NoneNo IPR availableGENE3DG3DSA:1.20.245.10coord: 363..545
e-value: 2.9E-38
score: 133.9
NoneNo IPR availableGENE3DG3DSA:1.20.245.10coord: 553..727
e-value: 6.5E-17
score: 63.4
coord: 137..257
e-value: 6.4E-9
score: 37.1
NoneNo IPR availablePANTHERPTHR11771:SF97coord: 85..726
IPR013819Lipoxygenase, C-terminalPFAMPF00305Lipoxygenasecoord: 237..518
e-value: 2.3E-35
score: 122.2
IPR013819Lipoxygenase, C-terminalPROSITEPS51393LIPOXYGENASE_3coord: 133..730
score: 57.111
IPR000907LipoxygenasePANTHERPTHR11771LIPOXYGENASEcoord: 85..726
IPR020834Lipoxygenase, conserved sitePROSITEPS00081LIPOXYGENASE_2coord: 392..402
IPR001024PLAT/LH2 domainPROSITEPS50095PLATcoord: 8..136
score: 10.322
IPR036226Lipoxigenase, C-terminal domain superfamilySUPERFAMILYSSF48484Lipoxigenasecoord: 145..519
IPR036226Lipoxigenase, C-terminal domain superfamilySUPERFAMILYSSF48484Lipoxigenasecoord: 564..726
IPR036392PLAT/LH2 domain superfamilySUPERFAMILYSSF49723Lipase/lipooxygenase domain (PLAT/LH2 domain)coord: 7..128