SMED30032233

Overview
NameSMED30032233
Smed IDSMED30032233
Length (bp)2585
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30032233 (SMED30032233) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30032233 (SMED30032233) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30032233 (SMED30032233) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30032233 (SMED30032233) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032233

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30032233SMESG000080577.1 SmedASXL_014379SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30032233SMESG000080577.1 dd_Smed_v4_19517_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30032233SMESG000080577.1 dd_Smed_v4_19517_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30032233SMESG000080577.1 dd_Smed_v4_19517_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032233SMESG000080577.1 dd_Smed_v4_19517_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30032233SMESG000080577.1 dd_Smed_v6_19517_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30032233 vs. Ensembl Human
Match: GFRA1 (GDNF family receptor alpha 1 [Source:HGNC Symbol;Acc:HGNC:4243])

HSP 1 Score: 53.9138 bits (128), Expect = 1.029e-6
Identity = 75/306 (24.51%), Postives = 117/306 (38.24%), Query Frame = 3
Query:  714 AETSFGKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCD-------KTGDQCVVSYEQLRHYGMFDCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRIMYQTLTFGSND----------NSRKTD-----PGTDNMPKQLQSLSKEIPNCLYLYQLCTQSSACLQRYMEIEKHCS------ICQNYTACLEATRSFYSK-PDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFCIKKGQRPIINCLILMQACLNNTSCLDSFTVFNQLCSPIMNKTLKC-PNNYFRCLDAYRTIWGSILT 1541
            AE S G  + C++    C   Q CST + + +        +       +  D+C  + E L+   +++C C    + +    K CL I  S              MYQ+L    ND          NSR +D     P   ++ +Q++ + K   NCL   + C     C +        C+      +C N   C +A R F+ K P   S   + C C   +  +   R++Q   P C  + +R   NCL L  +C  N  C      F   C P       C   NY  CL AY  + G+++T
Sbjct:   19 AEVSGGDRLDCVKASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKDECRSAMEALKQKSLYNCRCKRGMKKE----KNCLRIYWS--------------MYQSLQ--GNDLLEDSPYEPVNSRLSDIFRVVPFISDVFQQVEHIPKG-NNCLDAAKACNLDDICKKYRSAYITPCTTSVSNDVC-NRRKCHKALRQFFDKVPAKHSYGMLFCSCRDIACTE---RRRQTIVPVCSYE-EREKPNCLNLQDSCKTNYICRSRLADFFTNCQPESRSVSSCLKENYADCLLAYSGLIGTVMT 298          
BLAST of SMED30032233 vs. Ensembl Human
Match: GFRA1 (GDNF family receptor alpha 1 [Source:HGNC Symbol;Acc:HGNC:4243])

HSP 1 Score: 53.9138 bits (128), Expect = 1.029e-6
Identity = 75/306 (24.51%), Postives = 117/306 (38.24%), Query Frame = 3
Query:  714 AETSFGKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCD-------KTGDQCVVSYEQLRHYGMFDCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRIMYQTLTFGSND----------NSRKTD-----PGTDNMPKQLQSLSKEIPNCLYLYQLCTQSSACLQRYMEIEKHCS------ICQNYTACLEATRSFYSK-PDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFCIKKGQRPIINCLILMQACLNNTSCLDSFTVFNQLCSPIMNKTLKC-PNNYFRCLDAYRTIWGSILT 1541
            AE S G  + C++    C   Q CST + + +        +       +  D+C  + E L+   +++C C    + +    K CL I  S              MYQ+L    ND          NSR +D     P   ++ +Q++ + K   NCL   + C     C +        C+      +C N   C +A R F+ K P   S   + C C   +  +   R++Q   P C  + +R   NCL L  +C  N  C      F   C P       C   NY  CL AY  + G+++T
Sbjct:   19 AEVSGGDRLDCVKASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKDECRSAMEALKQKSLYNCRCKRGMKKE----KNCLRIYWS--------------MYQSLQ--GNDLLEDSPYEPVNSRLSDIFRVVPFISDVFQQVEHIPKG-NNCLDAAKACNLDDICKKYRSAYITPCTTSVSNDVC-NRRKCHKALRQFFDKVPAKHSYGMLFCSCRDIACTE---RRRQTIVPVCSYE-EREKPNCLNLQDSCKTNYICRSRLADFFTNCQPESRSVSSCLKENYADCLLAYSGLIGTVMT 298          
BLAST of SMED30032233 vs. Ensembl Human
Match: GFRA1 (GDNF family receptor alpha 1 [Source:HGNC Symbol;Acc:HGNC:4243])

HSP 1 Score: 52.7582 bits (125), Expect = 2.343e-6
Identity = 70/302 (23.18%), Postives = 111/302 (36.75%), Query Frame = 3
Query:  714 AETSFGKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCD-------KTGDQCVVSYEQLRHYGMFDCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRIMYQTLTFGSNDNSRKTDPGTDNMPKQLQSLSKEIP-----------NCLYLYQLCTQSSACLQRYMEIEKHCS------ICQNYTACLEATRSFYSK-PDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFCIKKGQRPIINCLILMQACLNNTSCLDSFTVFNQLCSPIMNKTLKC-PNNYFRCLDAYRTIWGSILT 1541
            AE S G  + C++    C   Q CST + + +        +       +  D+C  + E L+   +++C C    + +    K CL I  S              MYQ+L      N    D   + +  +L  + + +P           NCL   + C     C +        C+      +C N   C +A R F+ K P   S   + C C   +  +   R++Q   P C  + +R   NCL L  +C  N  C      F   C P       C   NY  CL AY  + G+++T
Sbjct:   19 AEVSGGDRLDCVKASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKDECRSAMEALKQKSLYNCRCKRGMKKE----KNCLRIYWS--------------MYQSL----QGNDLLEDSPYEPVNSRLSDIFRVVPFISVEHIPKGNNCLDAAKACNLDDICKKYRSAYITPCTTSVSNDVC-NRRKCHKALRQFFDKVPAKHSYGMLFCSCRDIACTE---RRRQTIVPVCSYE-EREKPNCLNLQDSCKTNYICRSRLADFFTNCQPESRSVSSCLKENYADCLLAYSGLIGTVMT 293          
BLAST of SMED30032233 vs. Ensembl Human
Match: GFRA1 (GDNF family receptor alpha 1 [Source:HGNC Symbol;Acc:HGNC:4243])

HSP 1 Score: 52.7582 bits (125), Expect = 2.343e-6
Identity = 70/302 (23.18%), Postives = 111/302 (36.75%), Query Frame = 3
Query:  714 AETSFGKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCD-------KTGDQCVVSYEQLRHYGMFDCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRIMYQTLTFGSNDNSRKTDPGTDNMPKQLQSLSKEIP-----------NCLYLYQLCTQSSACLQRYMEIEKHCS------ICQNYTACLEATRSFYSK-PDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFCIKKGQRPIINCLILMQACLNNTSCLDSFTVFNQLCSPIMNKTLKC-PNNYFRCLDAYRTIWGSILT 1541
            AE S G  + C++    C   Q CST + + +        +       +  D+C  + E L+   +++C C    + +    K CL I  S              MYQ+L      N    D   + +  +L  + + +P           NCL   + C     C +        C+      +C N   C +A R F+ K P   S   + C C   +  +   R++Q   P C  + +R   NCL L  +C  N  C      F   C P       C   NY  CL AY  + G+++T
Sbjct:   19 AEVSGGDRLDCVKASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKDECRSAMEALKQKSLYNCRCKRGMKKE----KNCLRIYWS--------------MYQSL----QGNDLLEDSPYEPVNSRLSDIFRVVPFISVEHIPKGNNCLDAAKACNLDDICKKYRSAYITPCTTSVSNDVC-NRRKCHKALRQFFDKVPAKHSYGMLFCSCRDIACTE---RRRQTIVPVCSYE-EREKPNCLNLQDSCKTNYICRSRLADFFTNCQPESRSVSSCLKENYADCLLAYSGLIGTVMT 293          
BLAST of SMED30032233 vs. Ensembl Mouse
Match: Gfra1 (glial cell line derived neurotrophic factor family receptor alpha 1 [Source:MGI Symbol;Acc:MGI:1100842])

HSP 1 Score: 58.151 bits (139), Expect = 2.812e-8
Identity = 78/313 (24.92%), Postives = 121/313 (38.66%), Query Frame = 3
Query:  693 LGSLGLFAETSFGKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCD-------KTGDQCVVSYEQLRHYGMFDCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRIMYQTLTFGSND----------NSRKTD-----PGTDNMPKQLQSLSKEIPNCLYLYQLCTQSSACLQRYMEIEKHCSICQ-----NYTACLEATRSFYSK-PDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFC-IKKGQRPIINCLILMQACLNNTSCLDSFTVFNQLCSPIMNKTLKC-PNNYFRCLDAYRTIWGSILT 1541
            L  L + AE S G  + C++    C   Q CST + + +        +       +  D+C  + E L+   +++C C    + +    K CL I  S              MYQ+L    ND          NSR +D     P   ++ +Q++ +SK   NCL   + C     C +        C+        N   C +A R F+ K P   S   + C C   +  +   R++Q   P C  ++ +RP  NCL L  +C  N  C      F   C P       C   NY  CL AY  + G+++T
Sbjct:   12 LLDLLMSAEVSGGDRLDCVKASDQCLKEQSCSTKYRTLRQCVAGKETNFSLTSGLEAKDECRSAMEALKQKSLYNCRCKRGMKKE----KNCLRIYWS--------------MYQSLQ--GNDLLEDSPYEPVNSRLSDIFRAVPFISDVFQQVEHISKG-NNCLDAAKACNLDDTCKKYRSAYITPCTTSMSNEVCNRRKCHKALRQFFDKVPAKHSYGMLFCSCRDVACTE---RRRQTIVPVCSYEERERP--NCLNLQDSCKTNYICRSRLADFFTNCQPESRSVSNCLKENYADCLLAYSGLIGTVMT 298          
BLAST of SMED30032233 vs. Ensembl Mouse
Match: Gfra1 (glial cell line derived neurotrophic factor family receptor alpha 1 [Source:MGI Symbol;Acc:MGI:1100842])

HSP 1 Score: 57.7658 bits (138), Expect = 4.290e-8
Identity = 78/313 (24.92%), Postives = 121/313 (38.66%), Query Frame = 3
Query:  693 LGSLGLFAETSFGKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCD-------KTGDQCVVSYEQLRHYGMFDCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRIMYQTLTFGSND----------NSRKTD-----PGTDNMPKQLQSLSKEIPNCLYLYQLCTQSSACLQRYMEIEKHCSICQ-----NYTACLEATRSFYSK-PDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFC-IKKGQRPIINCLILMQACLNNTSCLDSFTVFNQLCSPIMNKTLKC-PNNYFRCLDAYRTIWGSILT 1541
            L  L + AE S G  + C++    C   Q CST + + +        +       +  D+C  + E L+   +++C C    + +    K CL I  S              MYQ+L    ND          NSR +D     P   ++ +Q++ +SK   NCL   + C     C +        C+        N   C +A R F+ K P   S   + C C   +  +   R++Q   P C  ++ +RP  NCL L  +C  N  C      F   C P       C   NY  CL AY  + G+++T
Sbjct:   12 LLDLLMSAEVSGGDRLDCVKASDQCLKEQSCSTKYRTLRQCVAGKETNFSLTSGLEAKDECRSAMEALKQKSLYNCRCKRGMKKE----KNCLRIYWS--------------MYQSLQ--GNDLLEDSPYEPVNSRLSDIFRAVPFISDVFQQVEHISKG-NNCLDAAKACNLDDTCKKYRSAYITPCTTSMSNEVCNRRKCHKALRQFFDKVPAKHSYGMLFCSCRDVACTE---RRRQTIVPVCSYEERERP--NCLNLQDSCKTNYICRSRLADFFTNCQPESRSVSNCLKENYADCLLAYSGLIGTVMT 298          
BLAST of SMED30032233 vs. Ensembl Mouse
Match: Gfra1 (glial cell line derived neurotrophic factor family receptor alpha 1 [Source:MGI Symbol;Acc:MGI:1100842])

HSP 1 Score: 57.7658 bits (138), Expect = 4.290e-8
Identity = 78/313 (24.92%), Postives = 121/313 (38.66%), Query Frame = 3
Query:  693 LGSLGLFAETSFGKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCD-------KTGDQCVVSYEQLRHYGMFDCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRIMYQTLTFGSND----------NSRKTD-----PGTDNMPKQLQSLSKEIPNCLYLYQLCTQSSACLQRYMEIEKHCSICQ-----NYTACLEATRSFYSK-PDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFC-IKKGQRPIINCLILMQACLNNTSCLDSFTVFNQLCSPIMNKTLKC-PNNYFRCLDAYRTIWGSILT 1541
            L  L + AE S G  + C++    C   Q CST + + +        +       +  D+C  + E L+   +++C C    + +    K CL I  S              MYQ+L    ND          NSR +D     P   ++ +Q++ +SK   NCL   + C     C +        C+        N   C +A R F+ K P   S   + C C   +  +   R++Q   P C  ++ +RP  NCL L  +C  N  C      F   C P       C   NY  CL AY  + G+++T
Sbjct:   12 LLDLLMSAEVSGGDRLDCVKASDQCLKEQSCSTKYRTLRQCVAGKETNFSLTSGLEAKDECRSAMEALKQKSLYNCRCKRGMKKE----KNCLRIYWS--------------MYQSLQ--GNDLLEDSPYEPVNSRLSDIFRAVPFISDVFQQVEHISKG-NNCLDAAKACNLDDTCKKYRSAYITPCTTSMSNEVCNRRKCHKALRQFFDKVPAKHSYGMLFCSCRDVACTE---RRRQTIVPVCSYEERERP--NCLNLQDSCKTNYICRSRLADFFTNCQPESRSVSNCLKENYADCLLAYSGLIGTVMT 298          
BLAST of SMED30032233 vs. Ensembl Mouse
Match: Gfra1 (glial cell line derived neurotrophic factor family receptor alpha 1 [Source:MGI Symbol;Acc:MGI:1100842])

HSP 1 Score: 57.7658 bits (138), Expect = 4.290e-8
Identity = 78/313 (24.92%), Postives = 121/313 (38.66%), Query Frame = 3
Query:  693 LGSLGLFAETSFGKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCD-------KTGDQCVVSYEQLRHYGMFDCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRIMYQTLTFGSND----------NSRKTD-----PGTDNMPKQLQSLSKEIPNCLYLYQLCTQSSACLQRYMEIEKHCSICQ-----NYTACLEATRSFYSK-PDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFC-IKKGQRPIINCLILMQACLNNTSCLDSFTVFNQLCSPIMNKTLKC-PNNYFRCLDAYRTIWGSILT 1541
            L  L + AE S G  + C++    C   Q CST + + +        +       +  D+C  + E L+   +++C C    + +    K CL I  S              MYQ+L    ND          NSR +D     P   ++ +Q++ +SK   NCL   + C     C +        C+        N   C +A R F+ K P   S   + C C   +  +   R++Q   P C  ++ +RP  NCL L  +C  N  C      F   C P       C   NY  CL AY  + G+++T
Sbjct:   12 LLDLLMSAEVSGGDRLDCVKASDQCLKEQSCSTKYRTLRQCVAGKETNFSLTSGLEAKDECRSAMEALKQKSLYNCRCKRGMKKE----KNCLRIYWS--------------MYQSLQ--GNDLLEDSPYEPVNSRLSDIFRAVPFISDVFQQVEHISKG-NNCLDAAKACNLDDTCKKYRSAYITPCTTSMSNEVCNRRKCHKALRQFFDKVPAKHSYGMLFCSCRDVACTE---RRRQTIVPVCSYEERERP--NCLNLQDSCKTNYICRSRLADFFTNCQPESRSVSNCLKENYADCLLAYSGLIGTVMT 298          
BLAST of SMED30032233 vs. Ensembl Mouse
Match: Gfra1 (glial cell line derived neurotrophic factor family receptor alpha 1 [Source:MGI Symbol;Acc:MGI:1100842])

HSP 1 Score: 55.4546 bits (132), Expect = 2.058e-7
Identity = 72/309 (23.30%), Postives = 114/309 (36.89%), Query Frame = 3
Query:  693 LGSLGLFAETSFGKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCD-------KTGDQCVVSYEQLRHYGMFDCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRIMYQTLTFGSNDNSRKTDPGTDNMPKQLQSLSKEIP-----------NCLYLYQLCTQSSACLQRYMEIEKHCSICQ-----NYTACLEATRSFYSK-PDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFC-IKKGQRPIINCLILMQACLNNTSCLDSFTVFNQLCSPIMNKTLKC-PNNYFRCLDAYRTIWGSILT 1541
            L  L + AE S G  + C++    C   Q CST + + +        +       +  D+C  + E L+   +++C C    + +    K CL I  S              MYQ+L      N    D   + +  +L  + + +P           NCL   + C     C +        C+        N   C +A R F+ K P   S   + C C   +  +   R++Q   P C  ++ +RP  NCL L  +C  N  C      F   C P       C   NY  CL AY  + G+++T
Sbjct:   12 LLDLLMSAEVSGGDRLDCVKASDQCLKEQSCSTKYRTLRQCVAGKETNFSLTSGLEAKDECRSAMEALKQKSLYNCRCKRGMKKE----KNCLRIYWS--------------MYQSL----QGNDLLEDSPYEPVNSRLSDIFRAVPFISVEHISKGNNCLDAAKACNLDDTCKKYRSAYITPCTTSMSNEVCNRRKCHKALRQFFDKVPAKHSYGMLFCSCRDVACTE---RRRQTIVPVCSYEERERP--NCLNLQDSCKTNYICRSRLADFFTNCQPESRSVSNCLKENYADCLLAYSGLIGTVMT 293          
BLAST of SMED30032233 vs. UniProt/SwissProt
Match: sp|P97785|GFRA1_MOUSE (GDNF family receptor alpha-1 OS=Mus musculus OX=10090 GN=Gfra1 PE=1 SV=2)

HSP 1 Score: 57.7658 bits (138), Expect = 3.001e-7
Identity = 78/313 (24.92%), Postives = 121/313 (38.66%), Query Frame = 3
Query:  693 LGSLGLFAETSFGKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCD-------KTGDQCVVSYEQLRHYGMFDCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRIMYQTLTFGSND----------NSRKTD-----PGTDNMPKQLQSLSKEIPNCLYLYQLCTQSSACLQRYMEIEKHCSICQ-----NYTACLEATRSFYSK-PDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFC-IKKGQRPIINCLILMQACLNNTSCLDSFTVFNQLCSPIMNKTLKC-PNNYFRCLDAYRTIWGSILT 1541
            L  L + AE S G  + C++    C   Q CST + + +        +       +  D+C  + E L+   +++C C    + +    K CL I  S              MYQ+L    ND          NSR +D     P   ++ +Q++ +SK   NCL   + C     C +        C+        N   C +A R F+ K P   S   + C C   +  +   R++Q   P C  ++ +RP  NCL L  +C  N  C      F   C P       C   NY  CL AY  + G+++T
Sbjct:   12 LLDLLMSAEVSGGDRLDCVKASDQCLKEQSCSTKYRTLRQCVAGKETNFSLTSGLEAKDECRSAMEALKQKSLYNCRCKRGMKKE----KNCLRIYWS--------------MYQSLQ--GNDLLEDSPYEPVNSRLSDIFRAVPFISDVFQQVEHISKG-NNCLDAAKACNLDDTCKKYRSAYITPCTTSMSNEVCNRRKCHKALRQFFDKVPAKHSYGMLFCSCRDVACTE---RRRQTIVPVCSYEERERP--NCLNLQDSCKTNYICRSRLADFFTNCQPESRSVSNCLKENYADCLLAYSGLIGTVMT 298          
BLAST of SMED30032233 vs. UniProt/SwissProt
Match: sp|Q62997|GFRA1_RAT (GDNF family receptor alpha-1 OS=Rattus norvegicus OX=10116 GN=Gfra1 PE=1 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 3.054e-7
Identity = 78/313 (24.92%), Postives = 121/313 (38.66%), Query Frame = 3
Query:  693 LGSLGLFAETSFGKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCD-------KTGDQCVVSYEQLRHYGMFDCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRIMYQTLTFGSND----------NSRKTD-----PGTDNMPKQLQSLSKEIPNCLYLYQLCTQSSACLQRYMEIEKHCSICQ-----NYTACLEATRSFYSK-PDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFC-IKKGQRPIINCLILMQACLNNTSCLDSFTVFNQLCSPIMNKTLKC-PNNYFRCLDAYRTIWGSILT 1541
            L  L + AE S G  + C++    C   Q CST + + +        +       +  D+C  + E L+   +++C C    + +    K CL I  S              MYQ+L    ND          NSR +D     P   ++ +Q++ +SK   NCL   + C     C +        C+        N   C +A R F+ K P   S   + C C   +  +   R++Q   P C  ++ +RP  NCL L  +C  N  C      F   C P       C   NY  CL AY  + G+++T
Sbjct:   12 LLDLLMSAEVSGGDRLDCVKASDQCLKEQSCSTKYRTLRQCVAGKETNFSLTSGLEAKDECRSAMEALKQKSLYNCRCKRGMKKE----KNCLRIYWS--------------MYQSLQ--GNDLLEDSPYEPVNSRLSDIFRAVPFISDVFQQVEHISKG-NNCLDAAKACNLDDTCKKYRSAYITPCTTSMSNEVCNRRKCHKALRQFFDKVPAKHSYGMLFCSCRDIACTE---RRRQTIVPVCSYEERERP--NCLSLQDSCKTNYICRSRLADFFTNCQPESRSVSNCLKENYADCLLAYSGLIGTVMT 298          
BLAST of SMED30032233 vs. UniProt/SwissProt
Match: sp|P56159|GFRA1_HUMAN (GDNF family receptor alpha-1 OS=Homo sapiens OX=9606 GN=GFRA1 PE=1 SV=2)

HSP 1 Score: 53.9138 bits (128), Expect = 4.944e-6
Identity = 75/306 (24.51%), Postives = 117/306 (38.24%), Query Frame = 3
Query:  714 AETSFGKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCD-------KTGDQCVVSYEQLRHYGMFDCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRIMYQTLTFGSND----------NSRKTD-----PGTDNMPKQLQSLSKEIPNCLYLYQLCTQSSACLQRYMEIEKHCS------ICQNYTACLEATRSFYSK-PDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFCIKKGQRPIINCLILMQACLNNTSCLDSFTVFNQLCSPIMNKTLKC-PNNYFRCLDAYRTIWGSILT 1541
            AE S G  + C++    C   Q CST + + +        +       +  D+C  + E L+   +++C C    + +    K CL I  S              MYQ+L    ND          NSR +D     P   ++ +Q++ + K   NCL   + C     C +        C+      +C N   C +A R F+ K P   S   + C C   +  +   R++Q   P C  + +R   NCL L  +C  N  C      F   C P       C   NY  CL AY  + G+++T
Sbjct:   19 AEVSGGDRLDCVKASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKDECRSAMEALKQKSLYNCRCKRGMKKE----KNCLRIYWS--------------MYQSLQ--GNDLLEDSPYEPVNSRLSDIFRVVPFISDVFQQVEHIPKG-NNCLDAAKACNLDDICKKYRSAYITPCTTSVSNDVC-NRRKCHKALRQFFDKVPAKHSYGMLFCSCRDIACTE---RRRQTIVPVCSYE-EREKPNCLNLQDSCKTNYICRSRLADFFTNCQPESRSVSSCLKENYADCLLAYSGLIGTVMT 298          
BLAST of SMED30032233 vs. TrEMBL
Match: G4VIA0 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 GN=Smp_149270 PE=4 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 2.671e-29
Identity = 174/836 (20.81%), Postives = 310/836 (37.08%), Query Frame = 3
Query:  168 NCFQMYESCDISQNNCQLDIIIMKKMCGDFLIDGCFILPRIYSEFQNPNITTFIIQYTVFNGCNKQNELSCQGAIRTLN-TKHGFKGCYCPTHYRTSKASTHYCEMLMKMLNAHPCLLNPPIYLSDRKSIGIEINRNSKKPTEIELDKIFKNHQASQEEISYKKY-------------DILIKNSLRVCLGSLGLFAETSF----------GKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCDKTGDQCVVSYEQLRHYGM-FDCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRIMYQTLTFGSNDNSRKTDPGTDNMPKQLQSLSKEIPNCLYLYQLCTQSSACLQRYMEIEKHCS-------ICQNYTACLEATRSFYSKPDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFCIKKGQRPIINCLILMQACLNNTSCLDSFTVFNQLCSPIMNKTLKCPNNYFRCLDAYRTIWGSILTRECSCDAKEISRILSNNNSWAQNPTKICKFFQNMLSKPVCIFPDEASSKKHXXXXXXXXXXXXXDPCLILSKHNLPNKDFIRIESFSK----------CPMVCKCGESCKILPCSHXXXXXXXXXXXXXXXXE------------------------------ECQC-NNLKITCNKHKRKNEAWQYIDSGYKLLIQFNKKELILIIN----------QNFVDGIQSIISSLNSLMKMSTGLKHCRLI---FHSVHDLYF------------------TFILEINLLRSNDQQNQFPYKYWSPSNEERIGHLTAECVLSAKLLQLMINRRYPEIQHNLPLSVLQKA 2363
            +C +   +C+     C++D+ I K  CGD+  +   +                        GC ++    CQ A++T+N  + G K C C +    S      C +L K LN HPCL  PPI+L +  + G     N +   + EL    K  Q++    +  K               I +  +  + + +L     ++            +N SC++  ++C     C+   N +++ C   TCDK   QC+ + ++   +    +C C    +      ++CL  + S++DN+C+                 DN+ +                     C  ++  C     CLQ ++ +   C+        C+N   C+ +   FY + +++   +I C C  +  +  C + Q +F P CI++     ++C      C N+  C  S+ +   L S        C  N   CL++YR +W       CSC+  +     SNN          C  F  +L++P C+   E + K H+ +   +        C I+ K  +P +DF+R+ S             C ++C C   C+   C      +     L   +++                               C C  N  + CN    KN   QY  +GYKLLI F+ K     I+            F   I  +   L + +    G + CRLI   + ++ D +F                   ++L INL  S   +N+                 T+ C+   ++L +MIN +YP+I++++  S  QK+
Sbjct:   90 DCLEALHNCESFSGICKVDVEIFKTFCGDWTDERSLM------------------------GCQRKYLRECQSALKTMNLGRPGLKYCICDSRSSRSIDDLTKCNLLRKNLNNHPCLAEPPIFLRELHTSG-----NFRHEPKKELKPESKATQSANNMNTNMKRLNTTSLLTEPVVSSIPMTTASPITMNTLSSMGSSNIELVDQHLNKNKENTSCLDLLENCTKLPACAIALNKYRALCTIRTCDKLKSQCLEASKKFLQFKTHMNCDCKS--EINEGRYRRCLDYKESVIDNKCV-----------------DNNME---------------------CYSIFYECLHEPVCLQHFVNLRYGCAQMNRQFNACRNPNQCINSLERFYKETNSLVNKAISCTCTVNDLD--CQQMQNVFVPRCIRQSYGLRMDCYQAWVKCQNDPVCRTSYDL---LVSECQTSNGLCHLNPSACLNSYRRLWSGPWAGGCSCEVTQPKLNPSNNVLTG------CSEFGRILTQPPCV---EITPKTHQPENPALTHKPLY--CTIMKKLQIPFEDFVRMPSLRDYQEEGQFARNCSLLCNCHVGCRYEMCYGTEIKIWHAYSLSNRTSQIVTFPTRIQTINIYQPNLSLGCLYLPKFNRHCTCYANDHVVCNVFSLKN---QYFVTGYKLLIDFDVKMYSTTIDLLADDKSLSEYEFYGSIVQLEFLLTNFLAHLFGQESCRLILSAYQTIDDKHFWSKQHSSNSNSNKLLKRLEYLLAINLDTSFPTENK-----------------TSLCINLLEVLTIMINDQYPQIRYHIKFSTFQKS 820          
BLAST of SMED30032233 vs. TrEMBL
Match: A0A3R7JTB1 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CSKR_4306s PE=4 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 6.702e-25
Identity = 184/888 (20.72%), Postives = 331/888 (37.27%), Query Frame = 3
Query:  159 TSKNCFQMYESCDISQNNCQLDIIIMKKMCGDFLIDGCFILPRIYSEFQNPNITTFIIQYTVFNGCNKQNELSCQGAIRTLNTKHG---FKGCYCPTHYRTSKASTHYCEMLMKMLNAHPCLLNPPIYLSDRKSIGIEIN---------RNSKKPTEI----ELDKIFKNHQAS--------------------------QEEISYKKYDILIKNSLRVCLGSLGLFAE-----TSFGKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCDKTGDQCVVSYEQLRHYGMF-DCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRIM--YQTLTFGSND------------------------NSRKTDPGTDNMPKQLQSLSKEIPNCLYLYQLCTQSSACLQRYMEIEKHCSICQNY-----TACLEATRSFYSKPDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFCIKKGQRPIIN-CLILMQACLNNTSCLDSFTVFNQLCSPIMNKTLKCPNNYFRCLDAYRTIWGSI-LTRECSCDAKEISRILSNNNSWAQNPTKICKFFQNMLSKPVCIFPD---EASSKKHXXXXXXXXXXXXXDPCLILSKHNLPNKDFIR----------IESFSKCPMVCKCGESCKILPCSHXXXXXXXXXXXXXXXXEECQCN---NLKITCNKHKRKNEAWQYIDSG------------------------YKLLIQFNKKELILII---NQNFV-------DGIQSIISSLNSLMKMSTGLKHCRLIF--HSVHDLYFTFILEINLLRSNDQQNQFPYK-----------------YW-SP-SNEERIGHLTAECVLSAKLLQLMINRRYPEIQHNLPLSVLQKAE 2366
            T+K+C +   +C+  +  C++D+ I K+ CGD+  +   I                        GC++Q    C+ A++T+N  HG    + C C      S      C +L + LN+HPC+  PP+   +  +  + +          R+S  P E     E  ++F    A+                           E+I+ ++   L  ++  V  G            +S     SC+   + C     C+   N +++ C   +C+K   QC++++  +  YG   +C C    +   +  ++CL  + S++ NQC+A           T  F S +                         +  T PG        +  +  + NC   Y+LC ++  CLQ Y+++   CS    Y     + C    + FYS+       ++ C C+ S  +  C  Q  +F+P  I   Q    + C  L   C  N +C  +       C+        C     +C++AYR  W S+     C C   E+ R+ S+  S     +  C   +  + KP C+  +   EA    H N ++          C + ++  L     IR          +   S+C  +C C   C+   C+   +    + +  ++S E  + +   + KIT        +    IDS                         ++ +++++++EL+ ++    +N V       +G+ SI   L  +++ STG + C L+   H +    F       L    D  +                      +W SP  N +      ++CV S KLL+LM+NRRY EI+    LSVL++AE
Sbjct:   74 TAKDCLESLRTCETQRGICRVDLEIFKQFCGDWRNERSLI------------------------GCHRQFVKECRSALKTVN--HGRPNLRHCTCDGQVSRSIEDLSKCNLLRRNLNSHPCIQEPPLLYREITNFNLNVEHRLKDSAEKRDSATPIEQTSTQESSELFSGANAAPQITTNSSHPGAGSSDEKAELPFVGYSEQITTQEPSKLTADNQPVSQGMEQRLENVNLTFSSVANTTSCLVLLEQCTNQPSCARTLNRYRALCTPRSCNKLRSQCLLAHRAIERYGTHGNCSC--DTEDDQVRKRRCLDYEESVILNQCVALATEETADSKSTHDFSSVELPKLIETQVESQQQGISLHNQQYFKAVATSPGWLTSSSNPEGATTNVSNCYDAYRLCIRNRKCLQVYLQLAITCSNAGTYLLSPTSTCSNRLKEFYSQATAYVHRALSCTCSESDHD--CQTQLMIFRPQRIGLDQTNYEDSCSALWNNCQENRNCRANIKYLLLDCA---RNGAACSLYPEKCIEAYR-WWRSMDPLSNCRCMETELFRLTSSEGS----HSFTCDTLKQSVIKPPCVMKNYLLEAQRTLHSNPHSVA--------CFVTARLELSPTTAIRVLANETQTNLVTKSSECSYLCSCSGGCQHRLCALEQRRFENDRRFKEVSPEGSRRDVTVDEKITRGNSPFPCQYASLIDSSCTCRVNGDVWCDVFQNIGPNILLDFQFVLRYDRRELVSVVQLLTENLVNSELQYFNGLISIGRLLVGILRNSTGDQDCGLVLNEHRIEADAFHDSSTPRLFGGADAPDSADRGKTGYLVYAITTRPSLLIHWQSPHPNRDSDQDARSQCVESVKLLKLMVNRRYGEIRFPAVLSVLKRAE 915          
BLAST of SMED30032233 vs. TrEMBL
Match: A0A5K4FFG0 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 7.662e-25
Identity = 164/798 (20.55%), Postives = 293/798 (36.72%), Query Frame = 3
Query:  168 NCFQMYESCDISQNNCQLDIIIMKKMCGDFLIDGCFILPRIYSEFQNPNITTFIIQYTVFNGCNKQNELSCQGAIRTLN-TKHGFKGCYCPTHYRTSKASTHYCEMLMKMLNAHPCLLNPPIYLSDRKSIGIEINRNSKKPTEIELDKIFKNHQ-ASQEEISYKKYD------------ILIKNSLRVCLGSLGLFAETSF----------GKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCDKTGDQCVVSYEQLRHYGM-FDCVCVPFYQHQPMLMKKCLIIQTSLLDNQCL------------------AFLNNRIMYQTLTF--------GSNDNSRKTDPGTDNMPKQLQSLSKEIPN----------------------CLYLYQLCTQSSACLQRYMEIEKHCS-------ICQNYTACLEATRSFYSKPDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFCIKKGQRPIINCLILMQACLNNTSCLDSFTVFNQLCSPIMNKTLKCPNNYFRCLDAYRTIWGSILTRECSCDAKEISRILSNNNSWAQNPTKICKFFQNMLSKPVCIFPDEASSKKHXXXXXXXXXXXXXDPCLILSKHNLPNKDFIRIESFSK----------CPMVCKCGESCKILPCSHXXXXXXXXXXXXXXXXE------------------------------ECQC-NNLKITCNKHKRKNEAWQYIDSGYKLLIQFNKKELILIIN----------QNFVDGIQSIISSLNSLMKMSTGLKHCRLI---FHSVHDLYF 2159
            +C +   +C+     C++D+ I K  CGD+  +   +                        GC ++    CQ A++T+N  + G K C C +    S      C +L K LN HPCL  PPI+L +  + G     N +   + EL    K  Q A+    + K+ +            I +  +  + + +L     ++            +N SC++  ++C     C+   N +++ C   TCDK   QC+ + ++   +    +C C    +      ++CL  + S++DN+C+                  +F+N  +    +T            +NS+  + GT  +  Q   ++  I                        C  ++  C     CLQ ++ +   C+        C+N   C+ +   FY + +++   +I C C  +  +  C + Q +F P CI++     ++C      C N+  C  S+ +   L S        C  N   CL++YR +W       CSC+  +     SNN          C  F  +L++P C+   E + K H+ +   +        C I+ K  +P +DF+R+ S             C ++C C   C+   C      +     L   +++                               C C  N  + CN    KN   QY  +GYKLLI F+ K     I+            F   I  +   L + +    G + CRLI   + ++ D +F
Sbjct:   90 DCLEALHNCESFSGICKVDVEIFKTFCGDWTDERSLM------------------------GCQRKYLRECQSALKTMNLGRPGLKYCICDSRSSRSIDDLTKCNLLRKNLNNHPCLAEPPIFLRELHTSG-----NFRHEPKKELKPESKATQSANNMNTNMKRLNTTSLLTEPVVSSIPMTTASPITMNTLSSMGSSNIELVDQHLNKNKENTSCLDLLENCTKLPACAIALNKYRALCTIRTCDKLKSQCLEASKKFLQFKTHMNCDCKS--EINEGRYRRCLDYKESVIDNKCVEISSNQQVNSVNGNEMEYSFVNMNLEKNLVTIPVSPDYHTAVQNNSKNLENGTLPVLYQSHFITSNISGQTLNELTDIETIVSETWDNNMECYSIFYECLHEPVCLQHFVNLRYGCAQMNRQFNACRNPNQCINSLERFYKETNSLVNKAISCTCTVNDLD--CQQMQNVFVPRCIRQSYGLRMDCYQAWVKCQNDPVCRTSYDL---LVSECQTSNGLCHLNPSACLNSYRRLWSGPWAGGCSCEVTQPKLNPSNNVLTG------CSEFGRILTQPPCV---EITPKTHQPENPALTHKPLY--CTIMKKLQIPFEDFVRMPSLRDYQEEGQFARNCSLLCNCHVGCRYEMCYGTEIKIWHAYSLSNRTSQIVTFPTRIQTINIYQPNLSLGCLYLPKFNRHCTCYANDHVVCNVFSLKN---QYFVTGYKLLIDFDVKMYSTTIDLLADDKSLSEYEFYGSIVQLEFLLTNFLAHLFGQESCRLILSAYQTIDDKHF 837          
BLAST of SMED30032233 vs. TrEMBL
Match: A0A4Z2DUM5 (Uncharacterized protein OS=Schistosoma japonicum OX=6182 GN=EWB00_004526 PE=4 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 8.952e-25
Identity = 192/891 (21.55%), Postives = 330/891 (37.04%), Query Frame = 3
Query:  153 QLTSKNCFQMYESCDISQNNCQLDIIIMKKMCGDFLIDGCFILPRIYSEFQNPNITTFIIQYTVFNGCNKQNELSCQGAIRTLN-TKHGFKGCYCPTHYRTSKASTHYCEMLMKMLNAHPCLLNPPIYLSDRKSIG---------IEINRNSKKPT--------EIELDKIFKNHQASQEEISYKKYDILIKNSLRVCLGSLGLFAE--TSFGKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCDKTGDQCVVSYEQLRHYGM-FDCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRIMYQTLTFGSNDNSRKTDPGTD----NMP--------------KQLQSLS----------------------KEIPN--------------CLYLYQLCTQSSACLQRYMEIEKHCS-------ICQNYTACLEATRSFYSKPDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFCIKKGQRPIINCLILMQACLNNTSCLDSFTVFNQLCSPIMNKTLKCPNNYFRCLDAYRTIWGSILTRECSCDAKEISRILSNNNSWAQNPTKICKFFQNMLSKPVCIFPDEASSKKHXXXXXXXXXXXXXDPCLILSKHNLPNKDFIRIESF----------SKCPMVCKCGESCKILPCSHXXXXXXXXXXXXXXXXE------------------------------ECQCNNL-KITCNKHKRKNEAWQYIDSGYKLLIQFNKKELILIINQNFVDGIQSIISSLNSLMKMS----------TGLKHCRLI---FHSVHDLY------------------FTFILEINLLRSNDQQNQFPYKYWSPSNEERIGHLTAECVLSAKLLQLMINRRYPEIQHNLPLSVLQKA 2363
            Q  S +C +   +C+     C++D+ I K  CGD+  +   +                        GC+++    CQ A++T+N  + G K C C +    S      C +L K LN HPCL  PPI+L +    G          +   NS +           +    I K++++S    +    ++ I  S+     ++GL  E       N SC++  + C     C+   N F++ C   TC+K    C+ + ++   +    +C C    +      ++CL  + +++DN+C+    N+  +  L  G++ +        D    N P              K L SL                       KEI +              C  ++  C +   CLQ ++ +   C+        C+N T C+ +   FY +       +I C C  S  +  C + Q +F P CI+      ++C      C N+  C  S+ +   L S        C  N   CL++YR +W       CSC   E+S+ + N+   + N    C  F  +L++P C+   E + K HE + + +    +   C I+    + + DFIRI S             C ++C C   C+   C      +     L   +++                               C C    ++ CN  ++KN    YI SG+KLLI F+ +     I+    D   S      S++++            G K CRLI   +HS  D +                    ++L INL  S+  +N                  T+ CV   ++L +MIN +YP+I+++   S  QK+
Sbjct:   85 QEISIDCLEGLNNCESFSGICKVDVDIFKTFCGDWTDERSLM------------------------GCHRKYLRECQSALKTMNLGRPGLKYCTCDSRSSRSIDDLTKCNLLRKNLNNHPCLAEPPIFLRESHPSGNLRQEPKSEFKTENNSTQSENNMNTYTQRLNSSPIIKSYESSTPVTTTLPVNMNIPPSVNA--SNIGLVDEHLNIRKGNTSCLDLLEKCTKLPACAIALNKFRALCTIRTCNKLKIHCLEASKKFLQFKTHMNCNCQS--ELNEGRYRRCLDYKDAVIDNKCVEISTNQ--HVNLVNGNDPDFSSAGLNIDRNLVNPPIPPVIHITYPVETEKNLASLENRTSFKLQHSRLVTTNISEQRQKEIADLKTDFAESWSNKADCFSVFYECLREPVCLQYFVNLRYGCAQMNKQFDACRNPTQCISSLEGFYKETKPFINKAISCTCTES--DAYCQQMQNVFSPRCIRHTYGLRMDCYQAWIQCQNDPVCRTSYDL---LVSECQTSNGLCYLNPSACLNSYRRLWSGPWAGGCSC---ELSQSMRNS---SDNALTGCSEFGRILTQPPCV---ENNLKTHEVENHALINKPQY--CRIIETLQMSSDDFIRIPSLHDYQEQRQLGRNCSLLCNCQLGCRYEMCYETRIKIWHPYYLSNRTSQNVTVSTRIQSLNIYQPNLSLDCLYLPKFNSHCTCYAYNQVVCNVIEQKN---LYIVSGHKLLIDFDLEMYSTTIDLLADDRSLSEYELYGSIVQLEFLLTNFLAHLIGQKSCRLILSAYHSSDDKHRWLKQHSTDNIPNKLLKRLEYMLVINLDISHHVENH-----------------TSLCVNLLEILNIMINDQYPQIRYHAKFSTFQKS 909          
BLAST of SMED30032233 vs. TrEMBL
Match: A0A4S2LJ89 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008202 PE=4 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 1.784e-23
Identity = 185/893 (20.72%), Postives = 328/893 (36.73%), Query Frame = 3
Query:  162 SKNCFQMYESCDISQNNCQLDIIIMKKMCGDFLIDGCFILPRIYSEFQNPNITTFIIQYTVFNGCNKQNELSCQGAIRTLNTKHG---FKGCYCPTHYRTSKASTHYCEMLMKMLNAHPCLLNPPIYLSDRKSIGIEIN---------RNSKKPTE------------------------------------IELDKI-FKNHQASQEEISYKKYDILIKNSLRVCLGSLGLFAETSFGKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCDKTGDQCVVSYEQLRHYGMF-DCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRIMYQTLTF--------------------GSNDNSRKTDPGTDNMPKQLQSLSK------EIPNCLYLYQLCTQSSACLQRYMEIEKHCSICQNY-----TACLEATRSFYSKPDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFCIKKGQRPIIN-CLILMQACLNNTSCLDSFTVFNQLCSPIMNKTLKCPNNYFRCLDAYRTIWGSI-LTRECSCDAKEISRILSNNNSWA-------QNPTKICKFFQNMLSKPVCIFPDEASSKKHXXXXXXXXXXXXXDPCLILSKHNLPNKDFIRI----------ESFSKCPMVCKCGESCKILPCSHXXXXXXXXXXXXXXXXEECQCNNLKITCNKHKRKNEAWQY---IDSG------------------------YKLLIQFNKKELILII---NQNFV-------DGIQSIISSLNSLMKMSTGLKHCRLIF--HSVHDLYFTFILEINLLRSND-----QQNQFPYKYWS----PS----------NEERIGHLTAECVLSAKLLQLMINRRYPEIQHNLPLSVLQKAE 2366
            +K+C +   +C+  +  C++D+ I K+ CGD+  +   +                        GC+KQ    C+ A++T+N  HG    + C C      S      C +L + LN+HPC+  PP+   +  +  + +          R+S  P E                                    +EL  + +    A+QE    K  +  +  S+     ++ L   +S     SC+   + C     C+   N +++ C   +C+K   QC++++  +  YG   +C C    +   +  ++CL  + S++ NQC+A           T                     G++ ++++        P  L SLS        + +C   Y+LC ++  CLQ Y+++   CS    Y     + C    + FYS+       ++ C C+    +  C  Q  MF+P  I   Q    + C  L   C  N +C  +       C+        C     RC++AYR  W S+     C C   EI R+ S+  S +       Q+  K     +N L +P   FP    S                  C + ++  L     IR+             S+C  +C C   C+   C+   + L  + +   +S+E  + +        H       +Y   IDS                         ++ ++++++ ELI ++    +N V       + + SI   L  +++ STG + C L+   H +    F       L    D      + +  Y  ++    PS          N +      ++CV S KLL+LM+NRRY EI+    LSVL++AE
Sbjct:   75 AKDCLESLRTCETQRGICRVDLEIFKQFCGDWRNERSLL------------------------GCHKQFVKECRSALKTVN--HGRPNLRHCTCDGQVSRSIEDLSKCNLLRRNLNSHPCIQEPPLLYREITNFNLNMEHRIKDSAGKRDSTTPVEQTSTQESSELFSGTSATPQSTATNSSHPGVDSSDEKVELPSVGYSEQMATQEPKKSKTDNHTVSQSMEQRPENVKLTV-SSVSNKTSCLVLLEQCTNQPSCARTLNQYRALCTPRSCNKLRSQCLLAHRAIERYGTHGNCSC--NTEDDQVRKRRCLDYEQSVILNQCVALATEETADSKSTHDFSLMELPKLIETQVDSQQQGNSLHNQQYVKAVATSPGWLTSLSDPEGATTNVSDCYDPYRLCIRNRKCLQIYLQLATACSNAGTYFFSPTSTCSNRLKDFYSQATEYVHQALSCTCSERDHD--CQTQLMMFRPQLIGLDQTNYGDPCTALWNNCQENRNCRANIKYLLLDCA---RNGAACSVYPERCIEAYR-WWRSMDPLSNCRCMETEIFRLASSEGSHSFTCDTLKQSVIKTPCVRRNYLPEPQSTFPSNPHSVA----------------CFVTTRLELSPTTAIRVLANETQTNLATESSECSYLCSCSGGCQHRLCALEQRRLENDRRFKDVSSEGSRRDVTVDETFAHSNSPSPCRYASLIDSSCTCRVNGDVWCDVFQNIKPNILLDFQFVLRYDRGELISVVQLLTENLVNSELQYFNSLISIGRLLVGILRNSTGDQDCGLVLNEHRIEADAFHGSSTPRLFGGADAPDSADRGKTGYLVYAIITRPSLLIDWQSARTNRDSDQDALSQCVQSVKLLKLMVNRRYGEIRFPAVLSVLKRAE 916          
BLAST of SMED30032233 vs. Planmine SMEST
Match: SMESG000080577.1 (SMESG000080577.1)

HSP 1 Score: 1363.21 bits (3527), Expect = 0.000e+0
Identity = 750/794 (94.46%), Postives = 752/794 (94.71%), Query Frame = 3
Query:  150 AQLTSKNCFQMYESCDISQNNCQLDIIIMKKMCGDFLIDGCFILPRIYSEFQNPNITTFIIQYTVFNGCNKQNELSCQGAIRTLNTKHGFKGCYCPTHYRTSKASTHYCEMLMKMLNAHPCLLNPPIYLSDRKSIGIEINRNSKKPTEIELDKIFKNHQASQEEISYKKYDILIKNSLRVCLGSLGLFAETSFGKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCDKTGDQCVVSYEQLRHYGMFDCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRIMYQTLTFGSNDNSRKTDPGTDNMPKQLQSLSKEIPNCLYLYQLCTQSSACLQRYMEIEKHCSICQNYTACLEATRSFYSKPDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFCIKKGQRPIINCLILMQACLNNTSCLDSFTVFNQLCSPIMNKTLKCPNNYFRCLDAYRTIWGSILTRECSCDAKEISRILSNNNSWAQNPTKICKFFQNMLSKPVCIFPDEASSKKHXXXXXXXXXXXXXDPCLILSKHNLPNKDFIRIESFSKCPMVCKCGESCKILPCSHXXXXXXXXXXXXXXXXEECQCNNLKITCNKHKRKNEAWQYIDSGYKLLIQFNKKELILIINQNFVDGIQSIISSLNSLMKMSTGLKHCRLIFHSVHDLYFTFILEINLLRSNDQQNQFPYKYWSPSNEERIGHLTAECVLSAKLLQLMINRRYPEIQHNLPLSVLQKAEXXXXXXXXXXXXXXXTSSLRNNDNXXXXXXXXXXXXXXXXXXXXXXQNIIYSLKR 2531
            AQLTSKNCFQMYESCDISQNNCQLDIIIMKKMCGDFLID                        TVFNGCNKQNELSCQGAIRTLNTKHGFKGCYCPTHYRTSKASTHYCEMLMKMLNAHPCLLNPPIYLSDRKSIGIEINRNSKKPTEIELDKIFKNHQASQEEISYKKYDILIKNSLRVCLGSLGLFAETSFGKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCDKTGDQCVVSYEQLRHYGMFDCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRIMYQTLTFGSNDNSRKTDPGTDNMPKQLQSLSKEIPNCLYLYQLCTQSSACLQRYMEIEKHCSICQNYTACLEATRSFYSKPDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFCIKKGQRPIINCLILMQACLNNTSCLDSFTVFNQLCSPIMNKTLKCPNNYFRCLDAYRTIWGSILTRECSCDAKEISRILSNNNSWAQNPTKICKFFQNMLSKPVCIFPDE+SSKKHENKYNNIAIN+ENDPCLILSKHNLPNKDFIRIESFSKCPMVCKCGESCKILPCSHNNKSLSLNCKLLKLSNEECQCNNLKITCNKHKRKNEAWQYIDSGYKLLIQFNKKELILIINQNFVD                 GLKHCRLIFHSVHDLYFTFILEINLLRSNDQQNQFPYKYWSPSNEERIGHLTAECVLSAKLLQLMINRRYPEIQHNLPLSVLQKAEIISSQSPQLLQISKSTSSLRNNDNLSISIFLIFPFLFLYSYFLIIIQNI YSLKR
Sbjct:   15 AQLTSKNCFQMYESCDISQNNCQLDIIIMKKMCGDFLIDD-----------------------TVFNGCNKQNELSCQGAIRTLNTKHGFKGCYCPTHYRTSKASTHYCEMLMKMLNAHPCLLNPPIYLSDRKSIGIEINRNSKKPTEIELDKIFKNHQASQEEISYKKYDILIKNSLRVCLGSLGLFAETSFGKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCDKTGDQCVVSYEQLRHYGMFDCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRIMYQTLTFGSNDNSRKTDPGTDNMPKQLQSLSKEIPNCLYLYQLCTQSSACLQRYMEIEKHCSICQNYTACLEATRSFYSKPDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFCIKKGQRPIINCLILMQACLNNTSCLDSFTVFNQLCSPIMNKTLKCPNNYFRCLDAYRTIWGSILTRECSCDAKEISRILSNNNSWAQNPTKICKFFQNMLSKPVCIFPDESSSKKHENKYNNIAINHENDPCLILSKHNLPNKDFIRIESFSKCPMVCKCGESCKILPCSHNNKSLSLNCKLLKLSNEECQCNNLKITCNKHKRKNEAWQYIDSGYKLLIQFNKKELILIINQNFVD-----------------GLKHCRLIFHSVHDLYFTFILEINLLRSNDQQNQFPYKYWSPSNEERIGHLTAECVLSAKLLQLMINRRYPEIQHNLPLSVLQKAEIISSQSPQLLQISKSTSSLRNNDNLSISIFLIFPFLFLYSYFLIIIQNITYSLKR 768          
BLAST of SMED30032233 vs. Planmine SMEST
Match: SMESG000080577.1 (SMESG000080577.1)

HSP 1 Score: 1342.79 bits (3474), Expect = 0.000e+0
Identity = 740/784 (94.39%), Postives = 742/784 (94.64%), Query Frame = 3
Query:  180 MYESCDISQNNCQLDIIIMKKMCGDFLIDGCFILPRIYSEFQNPNITTFIIQYTVFNGCNKQNELSCQGAIRTLNTKHGFKGCYCPTHYRTSKASTHYCEMLMKMLNAHPCLLNPPIYLSDRKSIGIEINRNSKKPTEIELDKIFKNHQASQEEISYKKYDILIKNSLRVCLGSLGLFAETSFGKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCDKTGDQCVVSYEQLRHYGMFDCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRIMYQTLTFGSNDNSRKTDPGTDNMPKQLQSLSKEIPNCLYLYQLCTQSSACLQRYMEIEKHCSICQNYTACLEATRSFYSKPDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFCIKKGQRPIINCLILMQACLNNTSCLDSFTVFNQLCSPIMNKTLKCPNNYFRCLDAYRTIWGSILTRECSCDAKEISRILSNNNSWAQNPTKICKFFQNMLSKPVCIFPDEASSKKHXXXXXXXXXXXXXDPCLILSKHNLPNKDFIRIESFSKCPMVCKCGESCKILPCSHXXXXXXXXXXXXXXXXEECQCNNLKITCNKHKRKNEAWQYIDSGYKLLIQFNKKELILIINQNFVDGIQSIISSLNSLMKMSTGLKHCRLIFHSVHDLYFTFILEINLLRSNDQQNQFPYKYWSPSNEERIGHLTAECVLSAKLLQLMINRRYPEIQHNLPLSVLQKAEXXXXXXXXXXXXXXXTSSLRNNDNXXXXXXXXXXXXXXXXXXXXXXQNIIYSLKR 2531
            MYESCDISQNNCQLDIIIMKKMCGDFLID                        TVFNGCNKQNELSCQGAIRTLNTKHGFKGCYCPTHYRTSKASTHYCEMLMKMLNAHPCLLNPPIYLSDRKSIGIEINRNSKKPTEIELDKIFKNHQASQEEISYKKYDILIKNSLRVCLGSLGLFAETSFGKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCDKTGDQCVVSYEQLRHYGMFDCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRIMYQTLTFGSNDNSRKTDPGTDNMPKQLQSLSKEIPNCLYLYQLCTQSSACLQRYMEIEKHCSICQNYTACLEATRSFYSKPDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFCIKKGQRPIINCLILMQACLNNTSCLDSFTVFNQLCSPIMNKTLKCPNNYFRCLDAYRTIWGSILTRECSCDAKEISRILSNNNSWAQNPTKICKFFQNMLSKPVCIFPDE+SSKKHENKYNNIAIN+ENDPCLILSKHNLPNKDFIRIESFSKCPMVCKCGESCKILPCSHNNKSLSLNCKLLKLSNEECQCNNLKITCNKHKRKNEAWQYIDSGYKLLIQFNKKELILIINQNFVD                 GLKHCRLIFHSVHDLYFTFILEINLLRSNDQQNQFPYKYWSPSNEERIGHLTAECVLSAKLLQLMINRRYPEIQHNLPLSVLQKAEIISSQSPQLLQISKSTSSLRNNDNLSISIFLIFPFLFLYSYFLIIIQNI YSLKR
Sbjct:    1 MYESCDISQNNCQLDIIIMKKMCGDFLIDD-----------------------TVFNGCNKQNELSCQGAIRTLNTKHGFKGCYCPTHYRTSKASTHYCEMLMKMLNAHPCLLNPPIYLSDRKSIGIEINRNSKKPTEIELDKIFKNHQASQEEISYKKYDILIKNSLRVCLGSLGLFAETSFGKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCDKTGDQCVVSYEQLRHYGMFDCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRIMYQTLTFGSNDNSRKTDPGTDNMPKQLQSLSKEIPNCLYLYQLCTQSSACLQRYMEIEKHCSICQNYTACLEATRSFYSKPDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFCIKKGQRPIINCLILMQACLNNTSCLDSFTVFNQLCSPIMNKTLKCPNNYFRCLDAYRTIWGSILTRECSCDAKEISRILSNNNSWAQNPTKICKFFQNMLSKPVCIFPDESSSKKHENKYNNIAINHENDPCLILSKHNLPNKDFIRIESFSKCPMVCKCGESCKILPCSHNNKSLSLNCKLLKLSNEECQCNNLKITCNKHKRKNEAWQYIDSGYKLLIQFNKKELILIINQNFVD-----------------GLKHCRLIFHSVHDLYFTFILEINLLRSNDQQNQFPYKYWSPSNEERIGHLTAECVLSAKLLQLMINRRYPEIQHNLPLSVLQKAEIISSQSPQLLQISKSTSSLRNNDNLSISIFLIFPFLFLYSYFLIIIQNITYSLKR 744          
BLAST of SMED30032233 vs. Planmine SMEST
Match: SMESG000080577.1 (SMESG000080577.1)

HSP 1 Score: 835.869 bits (2158), Expect = 0.000e+0
Identity = 488/508 (96.06%), Postives = 490/508 (96.46%), Query Frame = 3
Query: 1008 MYQTLTFGSNDNSRKTDPGTDNMPKQLQSLSKEIPNCLYLYQLCTQSSACLQRYMEIEKHCSICQNYTACLEATRSFYSKPDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFCIKKGQRPIINCLILMQACLNNTSCLDSFTVFNQLCSPIMNKTLKCPNNYFRCLDAYRTIWGSILTRECSCDAKEISRILSNNNSWAQNPTKICKFFQNMLSKPVCIFPDEASSKKHXXXXXXXXXXXXXDPCLILSKHNLPNKDFIRIESFSKCPMVCKCGESCKILPCSHXXXXXXXXXXXXXXXXEECQCNNLKITCNKHKRKNEAWQYIDSGYKLLIQFNKKELILIINQNFVDGIQSIISSLNSLMKMSTGLKHCRLIFHSVHDLYFTFILEINLLRSNDQQNQFPYKYWSPSNEERIGHLTAECVLSAKLLQLMINRRYPEIQHNLPLSVLQKAEXXXXXXXXXXXXXXXTSSLRNNDNXXXXXXXXXXXXXXXXXXXXXXQNIIYSLKR 2531
            MYQTLTFGSNDNSRKTDPGTDNMPKQLQSLSKEIPNCLYLYQLCTQSSACLQRYMEIEKHCSICQNYTACLEATRSFYSKPDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFCIKKGQRPIINCLILMQACLNNTSCLDSFTVFNQLCSPIMNKTLKCPNNYFRCLDAYRTIWGSILTRECSCDAKEISRILSNNNSWAQNPTKICKFFQNMLSKPVCIFPDE+SSKKHENKYNNIAIN+ENDPCLILSKHNLPNKDFIRIESFSKCPMVCKCGESCKILPCSHNNKSLSLNCKLLKLSNEECQCNNLKITCNKHKRKNEAWQYIDSGYKLLIQFNKKELILIINQNFVD                 GLKHCRLIFHSVHDLYFTFILEINLLRSNDQQNQFPYKYWSPSNEERIGHLTAECVLSAKLLQLMINRRYPEIQHNLPLSVLQKAEIISSQSPQLLQISKSTSSLRNNDNLSISIFLIFPFLFLYSYFLIIIQNI YSLKR
Sbjct:    1 MYQTLTFGSNDNSRKTDPGTDNMPKQLQSLSKEIPNCLYLYQLCTQSSACLQRYMEIEKHCSICQNYTACLEATRSFYSKPDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFCIKKGQRPIINCLILMQACLNNTSCLDSFTVFNQLCSPIMNKTLKCPNNYFRCLDAYRTIWGSILTRECSCDAKEISRILSNNNSWAQNPTKICKFFQNMLSKPVCIFPDESSSKKHENKYNNIAINHENDPCLILSKHNLPNKDFIRIESFSKCPMVCKCGESCKILPCSHNNKSLSLNCKLLKLSNEECQCNNLKITCNKHKRKNEAWQYIDSGYKLLIQFNKKELILIINQNFVD-----------------GLKHCRLIFHSVHDLYFTFILEINLLRSNDQQNQFPYKYWSPSNEERIGHLTAECVLSAKLLQLMINRRYPEIQHNLPLSVLQKAEIISSQSPQLLQISKSTSSLRNNDNLSISIFLIFPFLFLYSYFLIIIQNITYSLKR 491          
BLAST of SMED30032233 vs. Planmine SMEST
Match: SMESG000080577.1 (SMESG000080577.1)

HSP 1 Score: 808.905 bits (2088), Expect = 0.000e+0
Identity = 400/424 (94.34%), Postives = 400/424 (94.34%), Query Frame = 3
Query:  150 AQLTSKNCFQMYESCDISQNNCQLDIIIMKKMCGDFLIDGCFILPRIYSEFQNPNITTFIIQYTVFNGCNKQNELSCQGAIRTLNTKHGFKGCYCPTHYRTSKASTHYCEMLMKMLNAHPCLLNPPIYLSDRKSIGIEINRNSKKPTEIELDKIFKNHQASQEEISYKKYDILIKNSLRVCLGSLGLFAETSFGKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCDKTGDQCVVSYEQLRHYGMFDCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRIMYQTLTFGSNDNSRKTDPGTDNMPKQLQSLSKEIPNCLYLYQLCTQSSACLQRYMEIEKHCSICQNYTACLEATRSFYSKPDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFCIKKGQRPIINCLILMQACLNNTSCL 1421
            AQLTSKNCFQMYESCDISQNNCQLDIIIMKKMCGDFLID                        TVFNGCNKQNELSCQGAIRTLNTKHGFKGCYCPTHYRTSKASTHYCEMLMKMLNAHPCLLNPPIYLSDRKSIGIEINRNSKKPTEIELDKIFKNHQASQEEISYKKYDILIKNSLRVCLGSLGLFAETSFGKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCDKTGDQCVVSYEQLRHYGMFDCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRIMYQTLTFGSNDNSRKTDPGTDNMPKQLQSLSKEIPNCLYLYQLCTQSSACLQRYMEIEKHCSICQNYTACLEATRSFYSKPDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFCIKKGQRPIINCLILMQACLNNTSCL
Sbjct:   15 AQLTSKNCFQMYESCDISQNNCQLDIIIMKKMCGDFLIDD-----------------------TVFNGCNKQNELSCQGAIRTLNTKHGFKGCYCPTHYRTSKASTHYCEMLMKMLNAHPCLLNPPIYLSDRKSIGIEINRNSKKPTEIELDKIFKNHQASQEEISYKKYDILIKNSLRVCLGSLGLFAETSFGKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCDKTGDQCVVSYEQLRHYGMFDCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRIMYQTLTFGSNDNSRKTDPGTDNMPKQLQSLSKEIPNCLYLYQLCTQSSACLQRYMEIEKHCSICQNYTACLEATRSFYSKPDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFCIKKGQRPIINCLILMQACLNNTSCL 415          
BLAST of SMED30032233 vs. Planmine SMEST
Match: SMESG000080577.1 (SMESG000080577.1)

HSP 1 Score: 788.489 bits (2035), Expect = 0.000e+0
Identity = 390/414 (94.20%), Postives = 390/414 (94.20%), Query Frame = 3
Query:  180 MYESCDISQNNCQLDIIIMKKMCGDFLIDGCFILPRIYSEFQNPNITTFIIQYTVFNGCNKQNELSCQGAIRTLNTKHGFKGCYCPTHYRTSKASTHYCEMLMKMLNAHPCLLNPPIYLSDRKSIGIEINRNSKKPTEIELDKIFKNHQASQEEISYKKYDILIKNSLRVCLGSLGLFAETSFGKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCDKTGDQCVVSYEQLRHYGMFDCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRIMYQTLTFGSNDNSRKTDPGTDNMPKQLQSLSKEIPNCLYLYQLCTQSSACLQRYMEIEKHCSICQNYTACLEATRSFYSKPDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFCIKKGQRPIINCLILMQACLNNTSCL 1421
            MYESCDISQNNCQLDIIIMKKMCGDFLID                        TVFNGCNKQNELSCQGAIRTLNTKHGFKGCYCPTHYRTSKASTHYCEMLMKMLNAHPCLLNPPIYLSDRKSIGIEINRNSKKPTEIELDKIFKNHQASQEEISYKKYDILIKNSLRVCLGSLGLFAETSFGKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCDKTGDQCVVSYEQLRHYGMFDCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRIMYQTLTFGSNDNSRKTDPGTDNMPKQLQSLSKEIPNCLYLYQLCTQSSACLQRYMEIEKHCSICQNYTACLEATRSFYSKPDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFCIKKGQRPIINCLILMQACLNNTSCL
Sbjct:    1 MYESCDISQNNCQLDIIIMKKMCGDFLIDD-----------------------TVFNGCNKQNELSCQGAIRTLNTKHGFKGCYCPTHYRTSKASTHYCEMLMKMLNAHPCLLNPPIYLSDRKSIGIEINRNSKKPTEIELDKIFKNHQASQEEISYKKYDILIKNSLRVCLGSLGLFAETSFGKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCDKTGDQCVVSYEQLRHYGMFDCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRIMYQTLTFGSNDNSRKTDPGTDNMPKQLQSLSKEIPNCLYLYQLCTQSSACLQRYMEIEKHCSICQNYTACLEATRSFYSKPDTISLNSIRCQCNHSSFNDPCHRQQQMFQPFCIKKGQRPIINCLILMQACLNNTSCL 391          
The following BLAST results are available for this feature:
BLAST of SMED30032233 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
GFRA11.029e-624.51GDNF family receptor alpha 1 [Source:HGNC Symbol;A... [more]
GFRA11.029e-624.51GDNF family receptor alpha 1 [Source:HGNC Symbol;A... [more]
GFRA12.343e-623.18GDNF family receptor alpha 1 [Source:HGNC Symbol;A... [more]
GFRA12.343e-623.18GDNF family receptor alpha 1 [Source:HGNC Symbol;A... [more]
back to top
BLAST of SMED30032233 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032233 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032233 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032233 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032233 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gfra12.812e-824.92glial cell line derived neurotrophic factor family... [more]
Gfra14.290e-824.92glial cell line derived neurotrophic factor family... [more]
Gfra14.290e-824.92glial cell line derived neurotrophic factor family... [more]
Gfra14.290e-824.92glial cell line derived neurotrophic factor family... [more]
Gfra12.058e-723.30glial cell line derived neurotrophic factor family... [more]
back to top
BLAST of SMED30032233 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|P97785|GFRA1_MOUSE3.001e-724.92GDNF family receptor alpha-1 OS=Mus musculus OX=10... [more]
sp|Q62997|GFRA1_RAT3.054e-724.92GDNF family receptor alpha-1 OS=Rattus norvegicus ... [more]
sp|P56159|GFRA1_HUMAN4.944e-624.51GDNF family receptor alpha-1 OS=Homo sapiens OX=96... [more]
back to top
BLAST of SMED30032233 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4VIA02.671e-2920.81Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A3R7JTB16.702e-2520.72Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
A0A5K4FFG07.662e-2520.55Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A4Z2DUM58.952e-2521.55Uncharacterized protein OS=Schistosoma japonicum O... [more]
A0A4S2LJ891.784e-2320.72Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of SMED30032233 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032233 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032233 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032233 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032233 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032233 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080577.10.000e+094.46SMESG000080577.1[more]
SMESG000080577.10.000e+094.39SMESG000080577.1[more]
SMESG000080577.10.000e+096.06SMESG000080577.1[more]
SMESG000080577.10.000e+094.34SMESG000080577.1[more]
SMESG000080577.10.000e+094.20SMESG000080577.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032233 ID=SMED30032233|Name=SMED30032233|organism=Schmidtea mediterranea sexual|type=transcript|length=2585bp
TGAAAATGTTTTAAAATTAGAAATGATTGCATTTGATTAATTTGAATATC
CAAAATGAAAAAAAAACGATGTTAAATGATATTAAATTTTAAACTGAAAT
TATTACAATGATTGTTCGTGTAATTCTTATAATTATTTTTCATCAAATTG
CTCAACTGACTTCTAAAAATTGTTTTCAAATGTATGAAAGTTGTGATATT
TCCCAAAACAATTGTCAATTGGATATAATTATTATGAAAAAAATGTGTGG
CGATTTTCTTATAGACGGATGCTTTATTTTGCCGCGAATTTACTCCGAAT
TCCAGAACCCTAATATCACGACTTTCATCATTCAATATACTGTTTTCAAT
GGATGCAATAAACAAAATGAATTAAGTTGCCAAGGTGCTATCAGAACTCT
AAACACAAAGCATGGATTTAAGGGATGTTATTGTCCCACTCATTACCGTA
CTTCTAAAGCAAGCACTCATTATTGTGAAATGCTTATGAAAATGCTAAAT
GCACATCCTTGTCTACTAAATCCACCAATTTACTTGTCAGATCGGAAATC
AATTGGAATTGAAATTAATCGAAATTCTAAGAAGCCGACAGAAATTGAAT
TGGACAAAATTTTTAAGAATCACCAAGCTTCTCAAGAAGAAATATCTTAC
AAAAAATATGACATTTTAATCAAAAATAGTTTACGAGTATGCCTTGGTAG
TTTGGGTTTATTTGCAGAAACAAGTTTTGGAAAAAATATAAGCTGTATTG
AAAGGGAAAAATCATGCCATCTGGGTCAAAAATGCTCTACCTTTTGGAAT
AGTTTCAAGTCATTTTGTCAATTTCATACGTGTGATAAAACAGGTGACCA
ATGTGTAGTTTCCTATGAACAATTACGACATTATGGAATGTTTGACTGTG
TCTGTGTTCCATTCTATCAACATCAACCCATGTTAATGAAAAAATGTCTT
ATCATTCAAACAAGTTTACTTGACAACCAATGCTTGGCATTCCTGAATAA
CAGAATTATGTATCAAACTCTAACATTTGGCTCTAATGATAATTCGAGAA
AAACTGATCCCGGAACTGATAATATGCCAAAACAACTTCAGTCTCTCAGT
AAAGAAATTCCAAATTGTTTGTATTTATATCAACTTTGCACACAATCATC
AGCGTGTTTACAACGATATATGGAGATCGAGAAACACTGCAGTATTTGCC
AAAATTATACAGCATGTCTTGAAGCAACTCGCTCATTTTATTCGAAACCA
GATACTATAAGCCTCAATTCCATTAGGTGTCAATGCAATCACTCTTCCTT
TAATGACCCTTGTCATCGTCAACAGCAAATGTTTCAGCCTTTTTGTATTA
AAAAAGGTCAACGCCCAATTATTAACTGTCTTATACTAATGCAAGCTTGC
CTGAATAATACCTCGTGTTTAGATTCATTTACAGTTTTCAATCAGCTATG
TTCTCCCATAATGAATAAAACATTAAAATGCCCCAATAATTATTTTCGCT
GCCTTGATGCATACAGAACAATTTGGGGTAGCATTCTCACCAGAGAATGC
AGTTGTGACGCAAAAGAAATATCTCGCATCTTATCCAATAATAATTCGTG
GGCTCAAAATCCAACAAAAATTTGTAAATTTTTTCAAAATATGTTATCAA
AGCCAGTTTGCATTTTTCCAGATGAAGCTTCAAGTAAAAAGCATGAAAAT
AAATATAATAACATTGCAATAAATAATGAAAATGATCCATGTTTAATTTT
GTCAAAGCATAATTTGCCAAACAAAGACTTCATTCGAATTGAATCATTTT
CAAAATGTCCAATGGTGTGTAAATGTGGTGAAAGTTGTAAAATTTTGCCT
TGTTCCCATAACAATAAGTCATTGAGTTTGAATTGCAAATTATTGAAGTT
ATCAAATGAAGAATGTCAGTGCAATAATTTAAAAATTACTTGTAATAAAC
ACAAAAGAAAAAATGAGGCTTGGCAATATATAGATTCAGGATATAAATTA
TTGATCCAGTTTAACAAAAAAGAACTTATTCTAATCATAAATCAGAATTT
TGTTGATGGTATTCAATCGATAATATCGTCTCTTAATTCCCTTATGAAAA
TGTCTACAGGGCTCAAACATTGTCGACTGATATTTCATAGTGTCCATGAT
CTTTATTTCACATTTATTCTGGAAATCAATCTACTGCGATCTAATGATCA
ACAAAATCAATTTCCATATAAATATTGGTCACCGTCAAATGAAGAACGAA
TAGGCCATTTAACTGCAGAATGTGTATTATCCGCGAAACTTTTGCAGTTG
ATGATTAACCGTAGATATCCAGAAATTCAGCATAATCTTCCATTGTCTGT
ACTACAGAAAGCTGAAATAATCTCATCTCAATCTCCTCAATTACTCCAGA
TATCAAAATCAACTTCTAGCTTACGCAATAATGACAATCTATCAATTTCA
ATATTTCTGATTTTCCCCTTTTTATTTCTATATTCTTATTTCCTAATAAT
TATACAAAACATAATTTATTCTTTAAAGAGATAAATCAATTTAATACCAA
AGTGTCATCATTTTGATTTTGAAAATATTTCCGCA
back to top

protein sequence of SMED30032233-orf-1

>SMED30032233-orf-1 ID=SMED30032233-orf-1|Name=SMED30032233-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=809bp
MIVRVILIIIFHQIAQLTSKNCFQMYESCDISQNNCQLDIIIMKKMCGDF
LIDGCFILPRIYSEFQNPNITTFIIQYTVFNGCNKQNELSCQGAIRTLNT
KHGFKGCYCPTHYRTSKASTHYCEMLMKMLNAHPCLLNPPIYLSDRKSIG
IEINRNSKKPTEIELDKIFKNHQASQEEISYKKYDILIKNSLRVCLGSLG
LFAETSFGKNISCIEREKSCHLGQKCSTFWNSFKSFCQFHTCDKTGDQCV
VSYEQLRHYGMFDCVCVPFYQHQPMLMKKCLIIQTSLLDNQCLAFLNNRI
MYQTLTFGSNDNSRKTDPGTDNMPKQLQSLSKEIPNCLYLYQLCTQSSAC
LQRYMEIEKHCSICQNYTACLEATRSFYSKPDTISLNSIRCQCNHSSFND
PCHRQQQMFQPFCIKKGQRPIINCLILMQACLNNTSCLDSFTVFNQLCSP
IMNKTLKCPNNYFRCLDAYRTIWGSILTRECSCDAKEISRILSNNNSWAQ
NPTKICKFFQNMLSKPVCIFPDEASSKKHENKYNNIAINNENDPCLILSK
HNLPNKDFIRIESFSKCPMVCKCGESCKILPCSHNNKSLSLNCKLLKLSN
EECQCNNLKITCNKHKRKNEAWQYIDSGYKLLIQFNKKELILIINQNFVD
GIQSIISSLNSLMKMSTGLKHCRLIFHSVHDLYFTFILEINLLRSNDQQN
QFPYKYWSPSNEERIGHLTAECVLSAKLLQLMINRRYPEIQHNLPLSVLQ
KAEIISSQSPQLLQISKSTSSLRNNDNLSISIFLIFPFLFLYSYFLIIIQ
NIIYSLKR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR003438GDNF_rcpt
IPR037193GDNF_alpha
Vocabulary: molecular function
TermDefinition
GO:0038023signaling receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 598..618
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.601
NoneNo IPR availableTMHMMTMhelixcoord: 777..799
IPR003438Glial cell line-derived neurotrophic factor receptorPANTHERPTHR10269GDNF RECEPTOR ALPHAcoord: 201..519
IPR037193GDNF receptor alphaSUPERFAMILYSSF110035GDNF receptor-likecoord: 333..416
IPR037193GDNF receptor alphaSUPERFAMILYSSF110035GDNF receptor-likecoord: 423..520