heterogeneous nuclear ribonucleoprotein A2

Overview
Nameheterogeneous nuclear ribonucleoprotein A2 (ADK78240.1)
Smed IDSMED30032231
Length (bp)1534
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of heterogeneous nuclear ribonucleoprotein A2 (SMED30032231) t-SNE clustered cells

Violin plots show distribution of expression levels for heterogeneous nuclear ribonucleoprotein A2 (SMED30032231) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of heterogeneous nuclear ribonucleoprotein A2 (SMED30032231) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for heterogeneous nuclear ribonucleoprotein A2 (SMED30032231) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032231

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30032231h1SMcG0018757 HM639989smed_ncbi_20240424PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
spermatogoniumSMED30032231h1SMcG0018757 HM639989smed_ncbi_20240424PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
spermatocyteSMED30032231h1SMcG0018757 HM639989smed_ncbi_20240424PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testis primordiumSMED30032231h1SMcG0018757 Contig3836_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile stagecDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Human
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 217.238 bits (552), Expect = 1.090e-66
Identity = 103/177 (58.19%), Postives = 127/177 (71.75%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEE 669
            QFRKLFIGGL+ +T E  LR YYEQWG+L D VVM+D  + RSRGFGFVT+     VD A   RPH +DG++VE KRA+ RE+S  P +H+TV KLFVGG+K+D    HLR YF  YG I   EI+T + SG+ RGFGFVTFDD+DPVDK +L K H I     +V+KALS+ EM+E
Sbjct:   19 QFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQE 195          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Human
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 218.394 bits (555), Expect = 4.445e-66
Identity = 103/179 (57.54%), Postives = 129/179 (72.07%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIR 675
            QFRKLFIGGL+ +T E  LR YYEQWG+L D VVM+D  + RSRGFGFVT+     VD A   RPH +DG++VE KRA+ RE+S  P +H+TV KLFVGG+K+D    HLR YF  YG I   EI+T + SG+ RGFGFVTFDD+DPVDK +L K H I     +V+KALS+ EM+E++
Sbjct:    7 QFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQ 185          

HSP 2 Score: 68.9366 bits (167), Expect = 4.148e-12
Identity = 30/87 (34.48%), Postives = 56/87 (64.37%), Query Frame = 1
Query:  145 RKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPES 405
            +KLF+GG+   T+E  LR Y+E++G++    ++ D ++G+ RGFGFVT+ D + VD+    + H ++G   E ++A+ R++    +S
Sbjct:  100 KKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQS 186          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Human
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 218.394 bits (555), Expect = 4.445e-66
Identity = 103/179 (57.54%), Postives = 129/179 (72.07%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIR 675
            QFRKLFIGGL+ +T E  LR YYEQWG+L D VVM+D  + RSRGFGFVT+     VD A   RPH +DG++VE KRA+ RE+S  P +H+TV KLFVGG+K+D    HLR YF  YG I   EI+T + SG+ RGFGFVTFDD+DPVDK +L K H I     +V+KALS+ EM+E++
Sbjct:    7 QFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQ 185          

HSP 2 Score: 68.9366 bits (167), Expect = 4.148e-12
Identity = 30/87 (34.48%), Postives = 56/87 (64.37%), Query Frame = 1
Query:  145 RKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPES 405
            +KLF+GG+   T+E  LR Y+E++G++    ++ D ++G+ RGFGFVT+ D + VD+    + H ++G   E ++A+ R++    +S
Sbjct:  100 KKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQS 186          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Human
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 218.394 bits (555), Expect = 7.816e-66
Identity = 103/178 (57.87%), Postives = 128/178 (71.91%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEI 672
            QFRKLFIGGL+ +T E  LR YYEQWG+L D VVM+D  + RSRGFGFVT+     VD A   RPH +DG++VE KRA+ RE+S  P +H+TV KLFVGG+K+D    HLR YF  YG I   EI+T + SG+ RGFGFVTFDD+DPVDK +L K H I     +V+KALS+ EM+E+
Sbjct:   19 QFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEV 196          

HSP 2 Score: 68.9366 bits (167), Expect = 5.403e-12
Identity = 30/87 (34.48%), Postives = 56/87 (64.37%), Query Frame = 1
Query:  145 RKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPES 405
            +KLF+GG+   T+E  LR Y+E++G++    ++ D ++G+ RGFGFVT+ D + VD+    + H ++G   E ++A+ R++    +S
Sbjct:  112 KKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQS 198          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Human
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 218.394 bits (555), Expect = 7.816e-66
Identity = 103/178 (57.87%), Postives = 128/178 (71.91%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEI 672
            QFRKLFIGGL+ +T E  LR YYEQWG+L D VVM+D  + RSRGFGFVT+     VD A   RPH +DG++VE KRA+ RE+S  P +H+TV KLFVGG+K+D    HLR YF  YG I   EI+T + SG+ RGFGFVTFDD+DPVDK +L K H I     +V+KALS+ EM+E+
Sbjct:   19 QFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEV 196          

HSP 2 Score: 68.9366 bits (167), Expect = 5.403e-12
Identity = 30/87 (34.48%), Postives = 56/87 (64.37%), Query Frame = 1
Query:  145 RKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPES 405
            +KLF+GG+   T+E  LR Y+E++G++    ++ D ++G+ RGFGFVT+ D + VD+    + H ++G   E ++A+ R++    +S
Sbjct:  112 KKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQS 198          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Celegans
Match: hrp-1 (Heterogeneous nuclear ribonucleoprotein A1 [Source:UniProtKB/Swiss-Prot;Acc:Q22037])

HSP 1 Score: 190.66 bits (483), Expect = 8.095e-56
Identity = 89/184 (48.37%), Postives = 125/184 (67.93%), Query Frame = 1
Query:  142 FRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIRRKQHNE 693
             RK+F+GGLT  T +  +R++Y Q+GE+ D +VM+D  T RSRGFGFVT+     VD A   RPH +DGK V+ KRA+PR+D N  ES+++  +L+V G+++D T + L  YFT YGT+T  EI+  K + + RGFGFVTFDD+D VD+ +L K H +   R DV+K LSKDEM + +  +  E
Sbjct:   22 LRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDEMSKAQMNRDRE 205          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Celegans
Match: hrp-1 (Heterogeneous nuclear ribonucleoprotein A1 [Source:UniProtKB/Swiss-Prot;Acc:Q22037])

HSP 1 Score: 190.66 bits (483), Expect = 8.095e-56
Identity = 89/184 (48.37%), Postives = 125/184 (67.93%), Query Frame = 1
Query:  142 FRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIRRKQHNE 693
             RK+F+GGLT  T +  +R++Y Q+GE+ D +VM+D  T RSRGFGFVT+     VD A   RPH +DGK V+ KRA+PR+D N  ES+++  +L+V G+++D T + L  YFT YGT+T  EI+  K + + RGFGFVTFDD+D VD+ +L K H +   R DV+K LSKDEM + +  +  E
Sbjct:   22 LRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDEMSKAQMNRDRE 205          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Celegans
Match: hrp-1 (Heterogeneous nuclear ribonucleoprotein A1 [Source:UniProtKB/Swiss-Prot;Acc:Q22037])

HSP 1 Score: 190.66 bits (483), Expect = 8.313e-56
Identity = 89/184 (48.37%), Postives = 125/184 (67.93%), Query Frame = 1
Query:  142 FRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIRRKQHNE 693
             RK+F+GGLT  T +  +R++Y Q+GE+ D +VM+D  T RSRGFGFVT+     VD A   RPH +DGK V+ KRA+PR+D N  ES+++  +L+V G+++D T + L  YFT YGT+T  EI+  K + + RGFGFVTFDD+D VD+ +L K H +   R DV+K LSKDEM + +  +  E
Sbjct:   22 LRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDEMSKAQMNRDRE 205          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Celegans
Match: hrp-1 (Heterogeneous nuclear ribonucleoprotein A1 [Source:UniProtKB/Swiss-Prot;Acc:Q22037])

HSP 1 Score: 190.66 bits (483), Expect = 8.313e-56
Identity = 89/184 (48.37%), Postives = 125/184 (67.93%), Query Frame = 1
Query:  142 FRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIRRKQHNE 693
             RK+F+GGLT  T +  +R++Y Q+GE+ D +VM+D  T RSRGFGFVT+     VD A   RPH +DGK V+ KRA+PR+D N  ES+++  +L+V G+++D T + L  YFT YGT+T  EI+  K + + RGFGFVTFDD+D VD+ +L K H +   R DV+K LSKDEM + +  +  E
Sbjct:   22 LRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDEMSKAQMNRDRE 205          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Celegans
Match: hrp-1 (Heterogeneous nuclear ribonucleoprotein A1 [Source:UniProtKB/Swiss-Prot;Acc:Q22037])

HSP 1 Score: 174.096 bits (440), Expect = 5.808e-50
Identity = 80/157 (50.96%), Postives = 110/157 (70.06%), Query Frame = 1
Query:  193 LRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEM 663
            +R++Y Q+GE+ D +VM+D  T RSRGFGFVT+     VD A   RPH +DGK V+ KRA+PR+D N  ES+++  +L+V G+++D T + L  YFT YGT+T  EI+  K + + RGFGFVTFDD+D VD+ +L K H +   R DV+K LSKDEM
Sbjct:    1 MREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDEM 157          

HSP 2 Score: 50.447 bits (119), Expect = 1.343e-6
Identity = 25/102 (24.51%), Postives = 56/102 (54.90%), Query Frame = 1
Query:  145 RKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKD 450
            ++L++ G+     E  L +Y+ ++G +    ++ D  T + RGFGFVT+ D + VD+    + H V+G   + ++ + +++ +  ++ M  ++   GG  +D
Sbjct:   76 KRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDEMS--KAQMNRDRETRGGRSRD 175          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Fly
Match: Hrb87F (gene:FBgn0004237 transcript:FBtr0310621)

HSP 1 Score: 206.453 bits (524), Expect = 2.784e-61
Identity = 97/176 (55.11%), Postives = 127/176 (72.16%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEME 666
            Q RKLFIGGL  +T +  L+ ++E+WG +VD VVMKD KT RSRGFGF+TY    M+D AQN RPH++DG+ VE KRA+PR++ ++P +  TV KLFVGGL+ D   E LR YF  +G I    IV+ KD+G+ RGF F+ FDDYDPVDK IL K H I +  +DVKKA++K +M+
Sbjct:   22 QLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMD 197          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Fly
Match: Hrb87F (gene:FBgn0004237 transcript:FBtr0300590)

HSP 1 Score: 206.453 bits (524), Expect = 2.784e-61
Identity = 97/176 (55.11%), Postives = 127/176 (72.16%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEME 666
            Q RKLFIGGL  +T +  L+ ++E+WG +VD VVMKD KT RSRGFGF+TY    M+D AQN RPH++DG+ VE KRA+PR++ ++P +  TV KLFVGGL+ D   E LR YF  +G I    IV+ KD+G+ RGF F+ FDDYDPVDK IL K H I +  +DVKKA++K +M+
Sbjct:   22 QLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMD 197          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Fly
Match: Hrb87F (gene:FBgn0004237 transcript:FBtr0334495)

HSP 1 Score: 206.453 bits (524), Expect = 2.784e-61
Identity = 97/176 (55.11%), Postives = 127/176 (72.16%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEME 666
            Q RKLFIGGL  +T +  L+ ++E+WG +VD VVMKD KT RSRGFGF+TY    M+D AQN RPH++DG+ VE KRA+PR++ ++P +  TV KLFVGGL+ D   E LR YF  +G I    IV+ KD+G+ RGF F+ FDDYDPVDK IL K H I +  +DVKKA++K +M+
Sbjct:   22 QLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMD 197          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Fly
Match: Hrb87F (gene:FBgn0004237 transcript:FBtr0082851)

HSP 1 Score: 206.453 bits (524), Expect = 2.784e-61
Identity = 97/176 (55.11%), Postives = 127/176 (72.16%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEME 666
            Q RKLFIGGL  +T +  L+ ++E+WG +VD VVMKD KT RSRGFGF+TY    M+D AQN RPH++DG+ VE KRA+PR++ ++P +  TV KLFVGGL+ D   E LR YF  +G I    IV+ KD+G+ RGF F+ FDDYDPVDK IL K H I +  +DVKKA++K +M+
Sbjct:   22 QLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMD 197          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Fly
Match: Hrb98DE (gene:FBgn0001215 transcript:FBtr0085302)

HSP 1 Score: 204.912 bits (520), Expect = 6.690e-61
Identity = 95/172 (55.23%), Postives = 123/172 (71.51%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSK 654
              RKLFIGGL  +T +  L+ ++E+WG +VD VVMKD +T RSRGFGF+TY    M+DEAQ +RPH++DG++VE KRA+PR+D ++P +  TV KLFVG LK D   + +R YF  +G I D  IV  K++G+ RGF FV FDDYDPVDK +L K HQ+    VDVKKAL K
Sbjct:   25 HMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPK 196          

HSP 2 Score: 63.1586 bits (152), Expect = 1.946e-10
Identity = 33/95 (34.74%), Postives = 55/95 (57.89%), Query Frame = 1
Query:  382 EDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEME 666
            +DS T   HM   KLF+GGL    T E+L+ +F  +G I D  ++    +  SRGFGF+T+     +D+A   +PH+I    V+ K+A+ + +++
Sbjct:   17 DDSITEPEHM--RKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDID 109          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Zebrafish
Match: hnrnpa3 (heterogeneous nuclear ribonucleoprotein A3 [Source:ZFIN;Acc:ZDB-GENE-060224-1])

HSP 1 Score: 201.445 bits (511), Expect = 5.087e-61
Identity = 96/176 (54.55%), Postives = 122/176 (69.32%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEME 666
            Q RKLFIGGL+ +T E  LR ++EQWG+L D VVM+D    RSRGFGFVTY     VD A   RPH+VDG++VE KRA+ REDSN P +H+TV K+FVGG+K+D    H+R YF  YG I   +I+  + +G+ RGF FVTFDD+D VDK +  K H I S   +V+KAL K EM+
Sbjct:   11 QLRKLFIGGLSFETTEDSLRAHFEQWGKLTDCVVMRDPANKRSRGFGFVTYSSVSEVDAAMTARPHKVDGRVVEPKRAVSREDSNKPGAHLTVKKIFVGGIKEDTEEYHIREYFECYGKIETIDIMEERSTGKKRGFCFVTFDDHDTVDKIVAQKYHTINSHNCEVRKALPKQEMQ 186          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Zebrafish
Match: hnrnpa3 (heterogeneous nuclear ribonucleoprotein A3 [Source:ZFIN;Acc:ZDB-GENE-060224-1])

HSP 1 Score: 201.06 bits (510), Expect = 6.447e-60
Identity = 96/176 (54.55%), Postives = 122/176 (69.32%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEME 666
            Q RKLFIGGL+ +T E  LR ++EQWG+L D VVM+D    RSRGFGFVTY     VD A   RPH+VDG++VE KRA+ REDSN P +H+TV K+FVGG+K+D    H+R YF  YG I   +I+  + +G+ RGF FVTFDD+D VDK +  K H I S   +V+KAL K EM+
Sbjct:   11 QLRKLFIGGLSFETTEDSLRAHFEQWGKLTDCVVMRDPANKRSRGFGFVTYSSVSEVDAAMTARPHKVDGRVVEPKRAVSREDSNKPGAHLTVKKIFVGGIKEDTEEYHIREYFECYGKIETIDIMEERSTGKKRGFCFVTFDDHDTVDKIVAQKYHTINSHNCEVRKALPKQEMQ 186          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Zebrafish
Match: hnrnpa3 (heterogeneous nuclear ribonucleoprotein A3 [Source:ZFIN;Acc:ZDB-GENE-060224-1])

HSP 1 Score: 201.06 bits (510), Expect = 1.279e-59
Identity = 96/176 (54.55%), Postives = 122/176 (69.32%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEME 666
            Q RKLFIGGL+ +T E  LR ++EQWG+L D VVM+D    RSRGFGFVTY     VD A   RPH+VDG++VE KRA+ REDSN P +H+TV K+FVGG+K+D    H+R YF  YG I   +I+  + +G+ RGF FVTFDD+D VDK +  K H I S   +V+KAL K EM+
Sbjct:   10 QLRKLFIGGLSFETTEDSLRAHFEQWGKLTDCVVMRDPANKRSRGFGFVTYSSVSEVDAAMTARPHKVDGRVVEPKRAVSREDSNKPGAHLTVKKIFVGGIKEDTEEYHIREYFECYGKIETIDIMEERSTGKKRGFCFVTFDDHDTVDKIVAQKYHTINSHNCEVRKALPKQEMQ 185          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Zebrafish
Match: hnrnpa1a (heterogeneous nuclear ribonucleoprotein A1a [Source:ZFIN;Acc:ZDB-GENE-040426-1546])

HSP 1 Score: 201.06 bits (510), Expect = 4.777e-59
Identity = 94/178 (52.81%), Postives = 125/178 (70.22%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEI 672
            Q RKLFIGGL+ +T +  LR ++EQWG L D VVM+D  T RSRGFGFVTY     VD A + RPH+VDG+ VE KRA+ REDS+ P +H TV K+FVGG+K+D   EHLR YF  +G I +  I+T K+S + RGF F+TFDD+D VD+ ++ K H +     +V+KALS++EM  +
Sbjct:   13 QLRKLFIGGLSFETTDESLRAHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYSSVGEVDAAMDARPHKVDGRAVEPKRAVSREDSSKPGAHSTVKKMFVGGIKEDTDEEHLREYFGQFGKIDEVNIMTEKNSDKRRGFAFITFDDHDAVDRIVIQKYHTVNGHNCEVRKALSREEMNRV 190          

HSP 2 Score: 76.6406 bits (187), Expect = 1.212e-14
Identity = 35/93 (37.63%), Postives = 58/93 (62.37%), Query Frame = 1
Query:  382 EDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDE 660
            ++  TP     + KLF+GGL  + T E LR +F  +GT+TDC ++   ++  SRGFGFVT+     VD A+  +PH++    V+ K+A+S+++
Sbjct:    3 KEQQTPREPEQLRKLFIGGLSFETTDESLRAHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYSSVGEVDAAMDARPHKVDGRAVEPKRAVSRED 95          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Zebrafish
Match: hnrnpa1b (heterogeneous nuclear ribonucleoprotein A1b [Source:ZFIN;Acc:ZDB-GENE-030912-14])

HSP 1 Score: 192.586 bits (488), Expect = 8.967e-56
Identity = 93/175 (53.14%), Postives = 120/175 (68.57%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEM 663
            Q RKLFIGGL+ +T +  LR ++EQWG L D VVMKD  T RSRGFGFVTY   + V+ + + RPH+VDG++VE KRA+ REDS+ P +H TV K+FVGG+K D    HLR YF  +G I   EI+    +G  RGF FVTFDD+D VD+ ++ K H +     +V+KALSK EM
Sbjct:   12 QLRKLFIGGLSFETTDDSLRAHFEQWGTLTDCVVMKDPNTKRSRGFGFVTYSSVDEVNASMDARPHKVDGRLVEPKRAVSREDSSKPFAHTTVKKIFVGGIKDDTEENHLRDYFDQFGKIEVVEIMVDHKTGNKRGFAFVTFDDHDSVDRIVIQKYHTVNGHNCEVRKALSKQEM 186          

HSP 2 Score: 73.1738 bits (178), Expect = 1.628e-13
Identity = 37/100 (37.00%), Postives = 62/100 (62.00%), Query Frame = 1
Query:  361 AKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDE 660
            +K   PRE    PE    + KLF+GGL  + T + LR +F  +GT+TDC ++   ++  SRGFGFVT+   D V+ ++  +PH++    V+ K+A+S+++
Sbjct:    2 SKEGQPRE----PEQ---LRKLFIGGLSFETTDDSLRAHFEQWGTLTDCVVMKDPNTKRSRGFGFVTYSSVDEVNASMDARPHKVDGRLVEPKRAVSRED 94          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Xenopus
Match: hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:NCBI gene;Acc:549680])

HSP 1 Score: 218.779 bits (556), Expect = 2.763e-66
Identity = 103/179 (57.54%), Postives = 130/179 (72.63%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIR 675
            QFRKLFIGGL+ +T E  LR YYEQWG+L D VVM+D  + RSRGFGFVT+   + VD +   RPH +DG++VE KRA+ RE+S  P +H+TV KLFVGG+K+D    HLR YF  YG I   EI+T K SG+ RGFGFVTFDD+DPVDK +L K H I     +V+KALSK EM++++
Sbjct:    7 QFRKLFIGGLSFETTEDSLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMDEVDASMAARPHTIDGRVVEPKRAVAREESAKPGAHVTVKKLFVGGIKEDTEEHHLREYFEEYGKIESIEIITDKQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSKQEMQDVQ 185          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Xenopus
Match: hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:NCBI gene;Acc:549680])

HSP 1 Score: 219.164 bits (557), Expect = 3.385e-66
Identity = 103/179 (57.54%), Postives = 130/179 (72.63%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIR 675
            QFRKLFIGGL+ +T E  LR YYEQWG+L D VVM+D  + RSRGFGFVT+   + VD +   RPH +DG++VE KRA+ RE+S  P +H+TV KLFVGG+K+D    HLR YF  YG I   EI+T K SG+ RGFGFVTFDD+DPVDK +L K H I     +V+KALSK EM++++
Sbjct:    7 QFRKLFIGGLSFETTEDSLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMDEVDASMAARPHTIDGRVVEPKRAVAREESAKPGAHVTVKKLFVGGIKEDTEEHHLREYFEEYGKIESIEIITDKQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSKQEMQDVQ 185          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Xenopus
Match: hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:NCBI gene;Acc:549680])

HSP 1 Score: 218.009 bits (554), Expect = 4.730e-66
Identity = 103/179 (57.54%), Postives = 130/179 (72.63%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIR 675
            QFRKLFIGGL+ +T E  LR YYEQWG+L D VVM+D  + RSRGFGFVT+   + VD +   RPH +DG++VE KRA+ RE+S  P +H+TV KLFVGG+K+D    HLR YF  YG I   EI+T K SG+ RGFGFVTFDD+DPVDK +L K H I     +V+KALSK EM++++
Sbjct:    7 QFRKLFIGGLSFETTEDSLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMDEVDASMAARPHTIDGRVVEPKRAVAREESAKPGAHVTVKKLFVGGIKEDTEEHHLREYFEEYGKIESIEIITDKQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSKQEMQDVQ 185          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Xenopus
Match: hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:NCBI gene;Acc:549680])

HSP 1 Score: 218.394 bits (555), Expect = 5.046e-66
Identity = 103/179 (57.54%), Postives = 130/179 (72.63%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIR 675
            QFRKLFIGGL+ +T E  LR YYEQWG+L D VVM+D  + RSRGFGFVT+   + VD +   RPH +DG++VE KRA+ RE+S  P +H+TV KLFVGG+K+D    HLR YF  YG I   EI+T K SG+ RGFGFVTFDD+DPVDK +L K H I     +V+KALSK EM++++
Sbjct:    7 QFRKLFIGGLSFETTEDSLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMDEVDASMAARPHTIDGRVVEPKRAVAREESAKPGAHVTVKKLFVGGIKEDTEEHHLREYFEEYGKIESIEIITDKQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSKQEMQDVQ 185          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Xenopus
Match: psd3 (pleckstrin and Sec7 domain containing 3 [Source:Xenbase;Acc:XB-GENE-6467528])

HSP 1 Score: 205.297 bits (521), Expect = 3.317e-61
Identity = 96/178 (53.93%), Postives = 128/178 (71.91%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEI 672
            Q RKLFIGGL+ +T +  LR+++EQWG L D VVM+D  + RSRGFGFVTY   + VD A + RPH+VDG++VE KRA+ REDS+ P +H+TV K+FVGG+K+D    HLR YF  YG I   EI+T + SG+ RGF FVTF+D+D VDK ++ K H + +   +V+KALSK EM  +
Sbjct:   12 QLRKLFIGGLSFETTDESLREHFEQWGTLTDCVVMRDPNSKRSRGFGFVTYSSTDEVDAAMSARPHKVDGRVVEPKRAVSREDSSRPGAHLTVKKIFVGGIKEDTEEHHLREYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFEDHDSVDKIVIQKYHTVNNHNCEVRKALSKQEMASV 189          

HSP 2 Score: 79.7221 bits (195), Expect = 1.052e-15
Identity = 37/91 (40.66%), Postives = 58/91 (63.74%), Query Frame = 1
Query:  388 SNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDE 660
            S  P+    + KLF+GGL  + T E LR +F  +GT+TDC ++   +S  SRGFGFVT+   D VD A+  +PH++    V+ K+A+S+++
Sbjct:    4 SEAPKEPEQLRKLFIGGLSFETTDESLREHFEQWGTLTDCVVMRDPNSKRSRGFGFVTYSSTDEVDAAMSARPHKVDGRVVEPKRAVSRED 94          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Mouse
Match: Hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:MGI Symbol;Acc:MGI:104819])

HSP 1 Score: 218.779 bits (556), Expect = 7.312e-67
Identity = 103/179 (57.54%), Postives = 129/179 (72.07%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIR 675
            QFRKLFIGGL+ +T E  LR YYEQWG+L D VVM+D  + RSRGFGFVT+     VD A   RPH +DG++VE KRA+ RE+S  P +H+TV KLFVGG+K+D    HLR YF  YG I   EI+T + SG+ RGFGFVTFDD+DPVDK +L K H I     +V+KALS+ EM+E++
Sbjct:    7 QFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQ 185          

HSP 2 Score: 69.3218 bits (168), Expect = 1.746e-12
Identity = 30/87 (34.48%), Postives = 56/87 (64.37%), Query Frame = 1
Query:  145 RKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPES 405
            +KLF+GG+   T+E  LR Y+E++G++    ++ D ++G+ RGFGFVT+ D + VD+    + H ++G   E ++A+ R++    +S
Sbjct:  100 KKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQS 186          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Mouse
Match: Hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:MGI Symbol;Acc:MGI:104819])

HSP 1 Score: 218.779 bits (556), Expect = 7.312e-67
Identity = 103/179 (57.54%), Postives = 129/179 (72.07%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIR 675
            QFRKLFIGGL+ +T E  LR YYEQWG+L D VVM+D  + RSRGFGFVT+     VD A   RPH +DG++VE KRA+ RE+S  P +H+TV KLFVGG+K+D    HLR YF  YG I   EI+T + SG+ RGFGFVTFDD+DPVDK +L K H I     +V+KALS+ EM+E++
Sbjct:    7 QFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQ 185          

HSP 2 Score: 69.3218 bits (168), Expect = 1.746e-12
Identity = 30/87 (34.48%), Postives = 56/87 (64.37%), Query Frame = 1
Query:  145 RKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPES 405
            +KLF+GG+   T+E  LR Y+E++G++    ++ D ++G+ RGFGFVT+ D + VD+    + H ++G   E ++A+ R++    +S
Sbjct:  100 KKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQS 186          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Mouse
Match: Hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:MGI Symbol;Acc:MGI:104819])

HSP 1 Score: 218.779 bits (556), Expect = 7.312e-67
Identity = 103/179 (57.54%), Postives = 129/179 (72.07%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIR 675
            QFRKLFIGGL+ +T E  LR YYEQWG+L D VVM+D  + RSRGFGFVT+     VD A   RPH +DG++VE KRA+ RE+S  P +H+TV KLFVGG+K+D    HLR YF  YG I   EI+T + SG+ RGFGFVTFDD+DPVDK +L K H I     +V+KALS+ EM+E++
Sbjct:    7 QFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQ 185          

HSP 2 Score: 69.3218 bits (168), Expect = 1.746e-12
Identity = 30/87 (34.48%), Postives = 56/87 (64.37%), Query Frame = 1
Query:  145 RKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPES 405
            +KLF+GG+   T+E  LR Y+E++G++    ++ D ++G+ RGFGFVT+ D + VD+    + H ++G   E ++A+ R++    +S
Sbjct:  100 KKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQS 186          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Mouse
Match: Hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:MGI Symbol;Acc:MGI:104819])

HSP 1 Score: 218.394 bits (555), Expect = 3.052e-66
Identity = 103/179 (57.54%), Postives = 129/179 (72.07%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIR 675
            QFRKLFIGGL+ +T E  LR YYEQWG+L D VVM+D  + RSRGFGFVT+     VD A   RPH +DG++VE KRA+ RE+S  P +H+TV KLFVGG+K+D    HLR YF  YG I   EI+T + SG+ RGFGFVTFDD+DPVDK +L K H I     +V+KALS+ EM+E++
Sbjct:    7 QFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQ 185          

HSP 2 Score: 68.9366 bits (167), Expect = 2.848e-12
Identity = 30/87 (34.48%), Postives = 56/87 (64.37%), Query Frame = 1
Query:  145 RKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPES 405
            +KLF+GG+   T+E  LR Y+E++G++    ++ D ++G+ RGFGFVT+ D + VD+    + H ++G   E ++A+ R++    +S
Sbjct:  100 KKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQS 186          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Mouse
Match: Hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:MGI Symbol;Acc:MGI:104819])

HSP 1 Score: 218.394 bits (555), Expect = 3.052e-66
Identity = 103/179 (57.54%), Postives = 129/179 (72.07%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIR 675
            QFRKLFIGGL+ +T E  LR YYEQWG+L D VVM+D  + RSRGFGFVT+     VD A   RPH +DG++VE KRA+ RE+S  P +H+TV KLFVGG+K+D    HLR YF  YG I   EI+T + SG+ RGFGFVTFDD+DPVDK +L K H I     +V+KALS+ EM+E++
Sbjct:    7 QFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQ 185          

HSP 2 Score: 68.9366 bits (167), Expect = 2.848e-12
Identity = 30/87 (34.48%), Postives = 56/87 (64.37%), Query Frame = 1
Query:  145 RKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPES 405
            +KLF+GG+   T+E  LR Y+E++G++    ++ D ++G+ RGFGFVT+ D + VD+    + H ++G   E ++A+ R++    +S
Sbjct:  100 KKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQS 186          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. UniProt/SwissProt
Match: sp|Q9TTV2|ROA2_SAGOE (Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Saguinus oedipus OX=9490 GN=HNRNPA2B1 PE=1 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 2.871e-66
Identity = 104/179 (58.10%), Postives = 129/179 (72.07%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIR 675
            QFRKLFIGGL+ QT E  LR YYEQWG+L D VVM+D  + RSRGFGFVT+     VD A   RPH +DG++VE KRA+ RE+S  P +H+TV KLFVGG+K+D    HLR YF  YG I   EI+T + SG+ RGFGFVTFDD+DPVDK +L K H I     +V+KALS+ EM+E++
Sbjct:    7 QFRKLFIGGLSFQTTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFAEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQ 185          

HSP 2 Score: 67.0106 bits (162), Expect = 9.131e-11
Identity = 29/87 (33.33%), Postives = 55/87 (63.22%), Query Frame = 1
Query:  145 RKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPES 405
            +KLF+GG+   T+E  LR Y+ ++G++    ++ D ++G+ RGFGFVT+ D + VD+    + H ++G   E ++A+ R++    +S
Sbjct:  100 KKLFVGGIKEDTEEHHLRDYFAEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQS 186          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. UniProt/SwissProt
Match: sp|Q5RBU8|ROA2_PONAB (Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Pongo abelii OX=9601 GN=HNRNPA2B1 PE=2 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 2.117e-65
Identity = 103/178 (57.87%), Postives = 128/178 (71.91%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEI 672
            QFRKLFIGGL+ +T E  LR YYEQWG+L D VVM+D  + RSRGFGFVT+     VD A   RPH +DG++VE KRA+ RE+S  P +H+TV KLFVGG+K+D    HLR YF  YG I   EI+T + SG+ RGFGFVTFDD+DPVDK +L K H I     +V+KALS+ EM+E+
Sbjct:   19 QFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKHHTINGHNAEVRKALSRQEMQEV 196          

HSP 2 Score: 69.3218 bits (168), Expect = 1.607e-11
Identity = 30/87 (34.48%), Postives = 56/87 (64.37%), Query Frame = 1
Query:  145 RKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPES 405
            +KLF+GG+   T+E  LR Y+E++G++    ++ D ++G+ RGFGFVT+ D + VD+    + H ++G   E ++A+ R++    +S
Sbjct:  112 KKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKHHTINGHNAEVRKALSRQEMQEVQS 198          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. UniProt/SwissProt
Match: sp|Q2HJ60|ROA2_BOVIN (Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Bos taurus OX=9913 GN=HNRNPA2B1 PE=2 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 2.135e-65
Identity = 103/179 (57.54%), Postives = 129/179 (72.07%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIR 675
            QFRKLFIGGL+ +T E  LR YYEQWG+L D VVM+D  + RSRGFGFVT+     VD A   RPH +DG++VE KRA+ RE+S  P +H+TV KLFVGG+K+D    HLR YF  YG I   EI+T + SG+ RGFGFVTFDD+DPVDK +L K H I     +V+KALS+ EM+E++
Sbjct:    7 QFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQ 185          

HSP 2 Score: 68.9366 bits (167), Expect = 1.992e-11
Identity = 30/87 (34.48%), Postives = 56/87 (64.37%), Query Frame = 1
Query:  145 RKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPES 405
            +KLF+GG+   T+E  LR Y+E++G++    ++ D ++G+ RGFGFVT+ D + VD+    + H ++G   E ++A+ R++    +S
Sbjct:  100 KKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQS 186          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. UniProt/SwissProt
Match: sp|O88569|ROA2_MOUSE (Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Mus musculus OX=10090 GN=Hnrnpa2b1 PE=1 SV=2)

HSP 1 Score: 218.394 bits (555), Expect = 3.753e-65
Identity = 103/178 (57.87%), Postives = 128/178 (71.91%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEI 672
            QFRKLFIGGL+ +T E  LR YYEQWG+L D VVM+D  + RSRGFGFVT+     VD A   RPH +DG++VE KRA+ RE+S  P +H+TV KLFVGG+K+D    HLR YF  YG I   EI+T + SG+ RGFGFVTFDD+DPVDK +L K H I     +V+KALS+ EM+E+
Sbjct:   19 QFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEV 196          

HSP 2 Score: 68.9366 bits (167), Expect = 2.594e-11
Identity = 30/87 (34.48%), Postives = 56/87 (64.37%), Query Frame = 1
Query:  145 RKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPES 405
            +KLF+GG+   T+E  LR Y+E++G++    ++ D ++G+ RGFGFVT+ D + VD+    + H ++G   E ++A+ R++    +S
Sbjct:  112 KKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQS 198          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. UniProt/SwissProt
Match: sp|P22626|ROA2_HUMAN (Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2)

HSP 1 Score: 218.394 bits (555), Expect = 3.753e-65
Identity = 103/178 (57.87%), Postives = 128/178 (71.91%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEI 672
            QFRKLFIGGL+ +T E  LR YYEQWG+L D VVM+D  + RSRGFGFVT+     VD A   RPH +DG++VE KRA+ RE+S  P +H+TV KLFVGG+K+D    HLR YF  YG I   EI+T + SG+ RGFGFVTFDD+DPVDK +L K H I     +V+KALS+ EM+E+
Sbjct:   19 QFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEV 196          

HSP 2 Score: 68.9366 bits (167), Expect = 2.594e-11
Identity = 30/87 (34.48%), Postives = 56/87 (64.37%), Query Frame = 1
Query:  145 RKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPES 405
            +KLF+GG+   T+E  LR Y+E++G++    ++ D ++G+ RGFGFVT+ D + VD+    + H ++G   E ++A+ R++    +S
Sbjct:  112 KKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQS 198          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. TrEMBL
Match: E2IXG0 (Heterogeneous nuclear ribonucleoprotein A2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 664.84 bits (1714), Expect = 0.000e+0
Identity = 331/331 (100.00%), Postives = 331/331 (100.00%), Query Frame = 1
Query:   97 MGXXXXXXXXXXXXQFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIRRKQHNEPLSVNCSTSSDYFQNTSKSTIPAFQSPIQQNTYSSNLPCVGSVMFDGSFQATGYQYPNISASNWNGNPGINSNYMYSRPISDLNQFVAPSVINFNNLINPSQPSPVDNGQQNIDACDISTKTKISSTGDENI 1089
            MGRRNTENNDRRTEQFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIRRKQHNEPLSVNCSTSSDYFQNTSKSTIPAFQSPIQQNTYSSNLPCVGSVMFDGSFQATGYQYPNISASNWNGNPGINSNYMYSRPISDLNQFVAPSVINFNNLINPSQPSPVDNGQQNIDACDISTKTKISSTGDENI
Sbjct:    1 MGRRNTENNDRRTEQFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIRRKQHNEPLSVNCSTSSDYFQNTSKSTIPAFQSPIQQNTYSSNLPCVGSVMFDGSFQATGYQYPNISASNWNGNPGINSNYMYSRPISDLNQFVAPSVINFNNLINPSQPSPVDNGQQNIDACDISTKTKISSTGDENI 331          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. TrEMBL
Match: A0A183Q034 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS19970 PE=4 SV=1)

HSP 1 Score: 310.071 bits (793), Expect = 2.413e-100
Identity = 153/196 (78.06%), Postives = 174/196 (88.78%), Query Frame = 1
Query:   97 MGXXXXXXXXXXXXQFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIRRKQ 684
            MGRRN+ENNDRRTEQFRKLFIGGLTP T E +L+ +Y QWGE+VD VVMKD +T RSRGFGF+TY++PEMVD AQ NRPHE+DGK VEAKRAMPREDSN+PESHMTV KLFVGGLKKDVT E LR YF+ YG IT+CE+V WK+SGESRGFGFVTFDDYDPVDKAILYKPH IGSSR DVKKALSK+++  +++KQ
Sbjct:    1 MGRRNSENNDRRTEQFRKLFIGGLTPLTTEAKLKDFYSQWGEIVDVVVMKDGRTNRSRGFGFITYKEPEMVDAAQANRPHEIDGKTVEAKRAMPREDSNSPESHMTVTKLFVGGLKKDVTHEELREYFSKYGNITECEVVAWKESGESRGFGFVTFDDYDPVDKAILYKPHHIGSSRADVKKALSKEQINTMKKKQ 196          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. TrEMBL
Match: A0A183JHD4 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS2108 PE=4 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 2.502e-100
Identity = 153/196 (78.06%), Postives = 174/196 (88.78%), Query Frame = 1
Query:   97 MGXXXXXXXXXXXXQFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIRRKQ 684
            MGRRN+ENNDRRTEQFRKLFIGGLTP T E +L+ +Y QWGE+VD VVMKD +T RSRGFGF+TY++PEMVD AQ NRPHE+DGK VEAKRAMPREDSN+PESHMTV KLFVGGLKKDVT E LR YF+ YG IT+CE+V WK+SGESRGFGFVTFDDYDPVDKAILYKPH IGSSR DVKKALSK+++  +++KQ
Sbjct:    1 MGRRNSENNDRRTEQFRKLFIGGLTPLTTEAKLKDFYSQWGEIVDVVVMKDGRTNRSRGFGFITYKEPEMVDAAQANRPHEIDGKTVEAKRAMPREDSNSPESHMTVTKLFVGGLKKDVTHEELREYFSKYGNITECEVVAWKESGESRGFGFVTFDDYDPVDKAILYKPHHIGSSRADVKKALSKEQINTMKKKQ 196          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. TrEMBL
Match: C1L9G6 (Heterogeneous nuclear ribonucleoprotein A2 homolog 1 OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 4.097e-100
Identity = 153/196 (78.06%), Postives = 174/196 (88.78%), Query Frame = 1
Query:   97 MGXXXXXXXXXXXXQFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIRRKQ 684
            MGRRN+ENNDRRTEQFRKLFIGGLTP T E +L+ +Y QWGE+VD VVMKD +T RSRGFGF+TY++PEMVD AQ NRPHE+DGK VEAKRAMPREDSN+PESHMTV KLFVGGLKKDVT E LR YF+ YG IT+CE+V WK+SGESRGFGFVTFDDYDPVDKAILYKPH IGSSR DVKKALSK+++  +++KQ
Sbjct:    1 MGRRNSENNDRRTEQFRKLFIGGLTPLTTEAKLKDFYSQWGEIVDVVVMKDGRTNRSRGFGFITYKEPEMVDAAQANRPHEIDGKTVEAKRAMPREDSNSPESHMTVTKLFVGGLKKDVTHEELREYFSKYGNITECEVVAWKESGESRGFGFVTFDDYDPVDKAILYKPHHIGSSRADVKKALSKEQINTMKKKQ 196          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. TrEMBL
Match: A0A183VJF7 (Uncharacterized protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS141 PE=4 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 5.720e-99
Identity = 152/196 (77.55%), Postives = 175/196 (89.29%), Query Frame = 1
Query:   97 MGXXXXXXXXXXXXQFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIRRKQ 684
            MGRRN+ENNDRRTEQFRKLFIGGLTP T E +L+ +Y QWGE+VD VVMKD +T RSRGFGF+TY++PEMVD AQ NRPHE+DGK VEAKRAMPREDSN+PESHMTV KLFVGGLKKDVT E LR YF+ YG IT+CE+V+WK++GESRGFGFVTFDDYDPVDKAILYKPH IGSSR DVKKALSK+++  +++KQ
Sbjct:    1 MGRRNSENNDRRTEQFRKLFIGGLTPLTTEAKLKDFYSQWGEIVDVVVMKDGRTNRSRGFGFITYKEPEMVDAAQANRPHEIDGKTVEAKRAMPREDSNSPESHMTVTKLFVGGLKKDVTQEELREYFSKYGNITECEVVSWKETGESRGFGFVTFDDYDPVDKAILYKPHHIGSSRADVKKALSKEQINTMKKKQ 196          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Cavefish
Match: hnrnpa1a (heterogeneous nuclear ribonucleoprotein A1-like [Source:NCBI gene;Acc:103021383])

HSP 1 Score: 207.994 bits (528), Expect = 6.270e-62
Identity = 99/176 (56.25%), Postives = 125/176 (71.02%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEME 666
            Q RKLFIGGL+ +T +  LR Y+EQWG L D VVMKD  + RSRGFGFVTY + E VD A N RPH+VDG++VE KRA+ REDSN P +HMTV K+FVGG+K+D    HLR YF  +G I   EI+  + SG+ RGF FVTF D+D VD+ ++ K H I     +V+KALS+ EM+
Sbjct:   12 QLRKLFIGGLSFETTDDSLRAYFEQWGTLTDCVVMKDPNSKRSRGFGFVTYANVEEVDAAMNARPHKVDGRLVEPKRAVSREDSNKPFAHMTVKKIFVGGIKEDTEESHLRDYFDQFGRIEAIEIMVDRGSGKKRGFAFVTFSDHDSVDRIVIQKYHTINGHNSEVRKALSRQEMQ 187          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Cavefish
Match: hnrnpa1a (heterogeneous nuclear ribonucleoprotein A1-like [Source:NCBI gene;Acc:103021383])

HSP 1 Score: 207.994 bits (528), Expect = 6.270e-62
Identity = 99/176 (56.25%), Postives = 125/176 (71.02%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEME 666
            Q RKLFIGGL+ +T +  LR Y+EQWG L D VVMKD  + RSRGFGFVTY + E VD A N RPH+VDG++VE KRA+ REDSN P +HMTV K+FVGG+K+D    HLR YF  +G I   EI+  + SG+ RGF FVTF D+D VD+ ++ K H I     +V+KALS+ EM+
Sbjct:   12 QLRKLFIGGLSFETTDDSLRAYFEQWGTLTDCVVMKDPNSKRSRGFGFVTYANVEEVDAAMNARPHKVDGRLVEPKRAVSREDSNKPFAHMTVKKIFVGGIKEDTEESHLRDYFDQFGRIEAIEIMVDRGSGKKRGFAFVTFSDHDSVDRIVIQKYHTINGHNSEVRKALSRQEMQ 187          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Cavefish
Match: hnrnpa3 (heterogeneous nuclear ribonucleoprotein A3 [Source:NCBI gene;Acc:103035058])

HSP 1 Score: 198.364 bits (503), Expect = 1.663e-58
Identity = 97/176 (55.11%), Postives = 122/176 (69.32%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEME 666
            Q RKLFIGGL+ +T E  LR ++EQWG+L D VVM+D    RSRGFGFVTY     VD A   RPH+VDG+IVE KRA+ REDSN P +H+TV K+FVGG+K+D    H+R YF  YG I   +I+  + +G+ RGF FVTFDD+D VDK +  K H I S   +V+KAL K EM+
Sbjct:   11 QLRKLFIGGLSFETTEDSLRAHFEQWGKLTDCVVMRDPGNKRSRGFGFVTYSCVSEVDAAMGARPHKVDGRIVEPKRAVSREDSNRPGAHLTVKKIFVGGIKEDTEEYHIREYFEHYGKIESIDIMEERPTGKKRGFCFVTFDDHDTVDKIVAQKYHTINSHNCEVRKALPKQEMQ 186          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Cavefish
Match: ENSAMXT00000025677.2 (pep primary_assembly:Astyanax_mexicanus-2.0:24:39015044:39015955:-1 gene:ENSAMXG00000024951.2 transcript:ENSAMXT00000025677.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 187.963 bits (476), Expect = 1.472e-55
Identity = 89/176 (50.57%), Postives = 120/176 (68.18%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEME 666
            Q  KLF+GGL  QT +  LRK++EQ+G+L D VV+++ +  RSR FGFVTY  PE  D A + RPH +DG  VE KRA+ RED+  PE+   V K+FVGGLK D+   HL   F+ +G++   E++  KD+G+ RGFGFV FDD D  DKA++ K H I   +V+VKKAL+K EM+
Sbjct:    4 QLCKLFVGGLNVQTTDEGLRKHFEQYGQLTDCVVVQNQQLKRSRCFGFVTYTSPEEADAAMSARPHVLDGNNVEIKRAVAREDAGKPEALAKVKKIFVGGLKDDIEDSHLIECFSQFGSVEKAEVIMDKDTGKKRGFGFVYFDDNDSADKAVVLKFHTINGHKVEVKKALTKQEMQ 179          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Cavefish
Match: ENSAMXT00000047970.1 (pep primary_assembly:Astyanax_mexicanus-2.0:24:13999011:14001608:-1 gene:ENSAMXG00000037730.1 transcript:ENSAMXT00000047970.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 176.022 bits (445), Expect = 3.541e-50
Identity = 88/176 (50.00%), Postives = 118/176 (67.05%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEME 666
            Q  KLF+GGL  QT    LR ++EQ+G+L D VV+++ +  RSR FGFVTY   E  D A   RPH VDGK VE KRA+ RED+  PE+   V K+FVGGLK+D+    L  YF+ +G I   E++T KD+G+ RGFGFV F+D D  DKA++ K H I   +V+VKKAL++ E++
Sbjct:   14 QLCKLFVGGLNVQTTNEGLRAHFEQYGKLTDCVVVQNEQLQRSRCFGFVTYSSAEEADAAMAARPHVVDGKNVELKRAVAREDAGRPEALAKVKKIFVGGLKEDIEENELNEYFSQFGVIEKSEVITDKDTGKKRGFGFVHFEDNDSADKAVVLKFHTIKGHKVEVKKALTRQEIQ 189          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004893.1 (pep scaffold:Pmarinus_7.0:GL479484:4:2056:-1 gene:ENSPMAG00000004449.1 transcript:ENSPMAT00000004893.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 205.297 bits (521), Expect = 2.203e-63
Identity = 95/176 (53.98%), Postives = 128/176 (72.73%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEME 666
            QFRKLF+GGL+ +T E  LR+Y+EQWG L D VVMKD ++ RSRGFGFVT+     VD A + RPH++DG++VE KRA+ REDS  P +H++V K+FVGG+K D   EHLR YF  YG I   E++T ++SG+ RGF FVTF+D+DPVDK ++ K H I     +++KAL K E++
Sbjct:    9 QFRKLFVGGLSFETTEEGLRQYFEQWGSLTDCVVMKDTQSKRSRGFGFVTFSSMSEVDAAMSARPHKIDGRMVEPKRAVSREDSMRPGAHLSVKKIFVGGIKDDTDEEHLRDYFEKYGRIEIVEVMTERESGKKRGFAFVTFNDHDPVDKIVVQKYHTINGHNCEIRKALPKQELQ 184          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Sea Lamprey
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 205.682 bits (522), Expect = 2.781e-63
Identity = 100/182 (54.95%), Postives = 130/182 (71.43%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIRRKQ 684
            Q RKLFIGGL+ +T E  LR+YYEQWG +VD VVMKD  + RSRGFGF+TY   E V+ A   RPH VDG++VEAKRA+PR+DS  P   +TV KLFVGG+K +    HLR YF+ +G +   ++VT K +G+ RGF FVTFDDYDPVD+ +  K H I   +++V+KALS+ EME ++  Q
Sbjct:   12 QMRKLFIGGLSFETTEESLREYYEQWGTIVDCVVMKDPSSKRSRGFGFITYSVMEEVNSAMQARPHTVDGRVVEAKRAVPRDDSR-PGIQVTVKKLFVGGIKDNTDESHLRDYFSKFGRVESVDMVTDKQTGKKRGFAFVTFDDYDPVDQIVFQKFHTINCHKLEVRKALSRHEMETMQMNQ 192          

HSP 2 Score: 73.9442 bits (180), Expect = 3.975e-15
Identity = 34/91 (37.36%), Postives = 54/91 (59.34%), Query Frame = 1
Query:  388 SNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDE 660
            S  P+    + KLF+GGL  + T E LR Y+  +GTI DC ++    S  SRGFGF+T+   + V+ A+  +PH +    V+ K+A+ +D+
Sbjct:    4 SGMPKEPEQMRKLFIGGLSFETTEESLREYYEQWGTIVDCVVMKDPSSKRSRGFGFITYSVMEEVNSAMQARPHTVDGRVVEAKRAVPRDD 94          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Sea Lamprey
Match: HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0 [Source:HGNC Symbol;Acc:HGNC:5030])

HSP 1 Score: 203.371 bits (516), Expect = 6.854e-63
Identity = 96/175 (54.86%), Postives = 124/175 (70.86%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEM 663
            Q RKLFIGGL+ +T E  +RK++EQWG L D VVM+D  T RSRGFGFVTY  PE VD A + RPH +D ++VEAKRA+ REDS  P +H+ V K+FVGG++ D   +HLR YF  YG +   E++  + +G+ RGFGFVTF D+D VDK I+ K H I   + +V+KALSK EM
Sbjct:    7 QQRKLFIGGLSFETTEDSMRKHFEQWGTLTDCVVMRDPHTKRSRGFGFVTYTCPEEVDAAMDARPHHLDNRVVEAKRAISREDSLKPGAHLKVKKIFVGGIRDDTDEQHLREYFQVYGDVEAAEVMEDRSTGKKRGFGFVTFSDHDTVDKVIVQKYHTINGHKAEVRKALSKQEM 181          

HSP 2 Score: 72.7886 bits (177), Expect = 4.800e-15
Identity = 31/85 (36.47%), Postives = 56/85 (65.88%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSN 393
            + +K+F+GG+   TDE  LR+Y++ +G++    VM+D  TG+ RGFGFVT+ D + VD+    + H ++G   E ++A+ +++ N
Sbjct:   98 KVKKIFVGGIRDDTDEQHLREYFQVYGDVEAAEVMEDRSTGKKRGFGFVTFSDHDTVDKVIVQKYHTINGHKAEVRKALSKQEMN 182          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Sea Lamprey
Match: HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0 [Source:HGNC Symbol;Acc:HGNC:5030])

HSP 1 Score: 199.904 bits (507), Expect = 9.582e-60
Identity = 94/178 (52.81%), Postives = 125/178 (70.22%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEI 672
            Q RKLFIGGL+ +T E  ++K++EQWG L D VVM+D  T RSRGFGFVTY   E VD A   RPH +DG++VEAKRA+ REDS  P +H+ V K+FVGG+K +   +HLR YF+ YG +   +++  + SG+ RGFGFVTF D+D VDK ++ K H I   + +V+KALSK EM  +
Sbjct:   31 QQRKLFIGGLSFETTEESMQKHFEQWGTLTDCVVMRDPHTKRSRGFGFVTYMSAEEVDAAMEVRPHHLDGRVVEAKRAISREDSLKPGAHLKVKKIFVGGIKDNTDEDHLRDYFSEYGMVESVDVMEDRQSGKKRGFGFVTFSDHDAVDKVVVQKYHTINGHKAEVRKALSKQEMNSL 208          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Sea Lamprey
Match: TARDBP (TAR DNA binding protein [Source:HGNC Symbol;Acc:HGNC:11571])

HSP 1 Score: 78.9518 bits (193), Expect = 4.462e-17
Identity = 52/165 (31.52%), Postives = 81/165 (49.09%), Query Frame = 1
Query:  151 LFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKA 645
            L + GL  +  E  +R Y+  +GE++   V +D KTG S+GFGFV +RD E   +    R H +DG+  + K  +P              K+FVG   +D+T + LR +F+ +G +TD  I         R F FVTF D D + + +  +   I  + V +  A
Sbjct:   27 LIVLGLPWKASEQDIRDYFSTFGEVLMAQVKRDIKTGNSKGFGFVRFRDYETQLKVLAQR-HMIDGRWCDCK--LPNSKEQQVGDAFRSRKIFVGRCTEDITADDLRQFFSQFGEVTDVFI-----PKPFRAFAFVTFSD-DQIAQGLCGEDLIIKGTSVHISSA 182          

HSP 2 Score: 46.595 bits (109), Expect = 3.565e-6
Identity = 34/103 (33.01%), Postives = 52/103 (50.49%), Query Frame = 1
Query:  364 KRAMPR-EDSNTPESHMTVNK---LFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDE 660
            KR M   E SN  +   +V K   L V GL    + + +R YF+++G +   ++     +G S+GFGFV F DY+   K +L + H I     D K   SK++
Sbjct:    3 KRKMDEAEMSNVAKVKRSVQKTSDLIVLGLPWKASEQDIRDYFSTFGEVLMAQVKRDIKTGNSKGFGFVRFRDYETQLK-VLAQRHMIDGRWCDCKLPNSKEQ 104          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Yeast
Match: HRP1 (Subunit of cleavage factor I; cleavage factor I is a five-subunit complex required for the cleavage and polyadenylation of pre-mRNA 3' ends; RRM-containing heteronuclear RNA binding protein and hnRNPA/B family member that binds to poly (A) signal sequences; required for genome stability [Source:SGD;Acc:S000005483])

HSP 1 Score: 142.124 bits (357), Expect = 3.781e-37
Identity = 68/166 (40.96%), Postives = 105/166 (63.25%), Query Frame = 1
Query:  148 KLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKA 645
            K+FIGGL   T E  LR+Y+ ++G + D  +MKD  TGRSRGFGF+++  P  VDE    + H +DGK+++ KRA+PR++ +         K+FVGG+  DV  +    +F+ +GTI D +++  KD+G+SRGFGFVT+D  D VD+    K       ++++K+A
Sbjct:  160 KMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ-HILDGKVIDPKRAIPRDEQDK------TGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQNKFIDFKDRKIEIKRA 318          

HSP 2 Score: 70.0922 bits (170), Expect = 3.024e-13
Identity = 31/78 (39.74%), Postives = 46/78 (58.97%), Query Frame = 1
Query:  148 KLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPR 381
            K+F+GG+ P        +++ QWG ++D  +M D  TG+SRGFGFVTY   + VD    N+  +   + +E KRA PR
Sbjct:  244 KIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQNKFIDFKDRKIEIKRAEPR 321          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 64.3142 bits (155), Expect = 2.143e-11
Identity = 55/196 (28.06%), Postives = 91/196 (46.43%), Query Frame = 1
Query:  142 FRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPE-MVDEAQNNRPHEVDGKIVEAKRAMPREDS-------------NTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSR-VDVKKALSKDEMEEIRRKQ 684
            +  L++  +  +T + + ++ + ++G +V   + KD   G+ +GFGFV Y   E  V   +     E++G+ +   RA  + +                   +  VN LFV  L   V  E L   F  YGTIT  +++   ++G+S+GFGFV F   +   KAI  K  QI + + + V  A  KD    +RR Q
Sbjct:  218 YTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVN-LFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRT-ENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKD----VRRSQ 406          

HSP 2 Score: 51.9878 bits (123), Expect = 1.323e-7
Identity = 41/151 (27.15%), Postives = 69/151 (45.70%), Query Frame = 1
Query:  151 LFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEM---VDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAI 594
            L++G L P   E  L   +   G +    V +D  T  S G+ +V + D E      E  N  P  + G++    R M  +   +     + N +F+  L  D+  + L   F+ +G I   +I T  ++G+S+GFGFV F++     +AI
Sbjct:   40 LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTP--IKGRLC---RIMWSQRDPSLRKKGSGN-IFIKNLHPDIDNKALYDTFSVFGDILSSKIAT-DENGKSKGFGFVHFEEEGAAKEAI 183          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 60.077 bits (144), Expect = 3.209e-10
Identity = 37/156 (23.72%), Postives = 75/156 (48.08%), Query Frame = 1
Query:  151 LFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEA-QNNRPHEVDGKIVEAKRAMPREDSNTPESHM-------TVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAI 594
            +F+G L+   D+  L+K +E  G ++   V+ +  T RSRG+G+V + +    ++A Q  +  E+DG+ +    +  +   N   +           + LF+G L  +   + +   F  +G +    I T  ++ + +GFG+V F + +   KA+
Sbjct:  170 IFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKAL 325          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 58.5362 bits (140), Expect = 1.129e-9
Identity = 40/153 (26.14%), Postives = 74/153 (48.37%), Query Frame = 1
Query:  145 RKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYR---DPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAI 594
            R L++G L     E  L++Y++  G + +  +M D K  ++  + FV Y    D  +  +  N +  +++  IV+   A   + S++ ++      LFVG L  +V  E LR+ F  + +     ++    +G SRG+GFV+F   D    A+
Sbjct:   75 RVLYVGNLDKAITEDILKQYFQVGGPIANIKIMID-KNNKNVNYAFVEYHQSHDANIALQTLNGK--QIENNIVKINWAFQSQQSSSDDTF----NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAM 220          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Yeast
Match: SNP1 (Component of U1 snRNP required for mRNA splicing via spliceosome; substrate of the arginine methyltransferase Hmt1p; may interact with poly(A) polymerase to regulate polyadenylation; homolog of human U1 70K protein; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001323])

HSP 1 Score: 52.7582 bits (125), Expect = 4.141e-8
Identity = 21/53 (39.62%), Postives = 36/53 (67.92%), Query Frame = 1
Query:  142 FRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDP 300
            +R +FIG L    DEI L+KY+ ++GE+    ++KD  T +S+G+ F+ ++DP
Sbjct:  106 YRTIFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDP 158          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Nematostella
Match: EDO39879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8S5])

HSP 1 Score: 139.043 bits (349), Expect = 9.384e-39
Identity = 73/173 (42.20%), Postives = 112/173 (64.74%), Query Frame = 1
Query:  148 KLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHM-TVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEM 663
            K+FIGGL+ QT    LR+++E++GEL + VVM+D  T RSRGFGF+T++DP+ VD   N+   E+DGK ++ K A+P+     P   + T  K+F+GGL  + + E ++ YF+ +G IT+  ++  K +   RGFGFVTF+  +  DKA   + H I + +V+VKKA  K+ M
Sbjct:    1 KMFIGGLSWQTTAEGLRQHFEKFGELKECVVMRDPVTKRSRGFGFLTFKDPKAVDVVLNSGAQELDGKKIDPKLAVPK---RAPAKMVTTTKKIFIGGLSTNTSEEDMKKYFSQFGKITETMLMFDKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPKEVM 170          

HSP 2 Score: 73.559 bits (179), Expect = 3.405e-15
Identity = 33/80 (41.25%), Postives = 53/80 (66.25%), Query Frame = 1
Query:  145 RKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPRE 384
            +K+FIGGL+  T E  ++KY+ Q+G++ + ++M D  T R RGFGFVT+      D+A + + H ++ K VE K+A P+E
Sbjct:   89 KKIFIGGLSTNTSEEDMKKYFSQFGKITETMLMFDKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPKE 168          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Nematostella
Match: EDO33389 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSE1])

HSP 1 Score: 135.576 bits (340), Expect = 1.166e-37
Identity = 68/164 (41.46%), Postives = 98/164 (59.76%), Query Frame = 1
Query:  145 RKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVN--KLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRV 630
            RK+F+GGL   TD   L+ Y+E++GE+ D V+M D  T RSR FGF+T+RDP +V    +++PH++DGK+++ K A+PR     P      N  K+FVGGL    + + L  YFT+YG +    ++    + + RGFGFVTF+  D V KA     HQI    V
Sbjct:    1 RKIFVGGLAISTDSAGLQGYFEKYGEVTDCVLMTDPVTKRSRCFGFITFRDPSVVQNVMDDKPHQLDGKMIDPKPAVPRGPGQGPPQGNQNNEFKIFVGGLAHSTSKQDLEDYFTAYGKVVSVNLMVDPQTQKMRGFGFVTFESKDSVTKAADEHYHQINGKTV 164          

HSP 2 Score: 61.6178 bits (148), Expect = 2.599e-11
Identity = 31/78 (39.74%), Postives = 44/78 (56.41%), Query Frame = 1
Query:  421 KLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSK 654
            K+FVGGL     +  L+ YF  YG +TDC ++T   +  SR FGF+TF D   V   +  KPHQ+    +D K A+ +
Sbjct:    2 KIFVGGLAISTDSAGLQGYFEKYGEVTDCVLMTDPVTKRSRCFGFITFRDPSVVQNVMDDKPHQLDGKMIDPKPAVPR 79          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Nematostella
Match: EDO49349 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG33])

HSP 1 Score: 131.339 bits (329), Expect = 6.536e-36
Identity = 71/173 (41.04%), Postives = 103/173 (59.54%), Query Frame = 1
Query:  148 KLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSY------GTITDCEIVTWKDSGES-RGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKA 645
            K+FIGGL   T E  L+ Y+ QWG +VD V+MK  + GRSRGFGFVTY   + V+E    + H +D + +E KR++PR++S  PE+     K+FVGGL      E ++ YF S       G + D ++   +D+ +  RGF FVTFD+ + V+K    K H+I   + +VKKA
Sbjct:    1 KIFIGGLNWNTTEEGLKDYFSQWGTIVDCVIMK--RDGRSRGFGFVTYESSDSVNEVLKKKDHVLDDREIEPKRSVPRDESGAPEAMSKTRKIFVGGLASTTVEEDIKEYFNSLCRKNGMGEVIDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKA 171          

HSP 2 Score: 50.447 bits (119), Expect = 2.119e-7
Identity = 29/86 (33.72%), Postives = 49/86 (56.98%), Query Frame = 1
Query:  145 RKLFIGGLTPQTDEIRLRKYYEQW------GELVDFVVMKD-NKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPR 381
            RK+F+GGL   T E  +++Y+         GE++D  + +D +   R RGF FVT+ + E+V++    + HE+  K  E K+A P+
Sbjct:   89 RKIFVGGLASTTVEEDIKEYFNSLCRKNGMGEVIDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKAEPQ 174          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Nematostella
Match: EDO36522 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIF0])

HSP 1 Score: 119.783 bits (299), Expect = 1.419e-31
Identity = 68/177 (38.42%), Postives = 101/177 (57.06%), Query Frame = 1
Query:  148 KLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPE----MVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSY--GTITDCEIVTWK-DSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKD 657
            KLF+GGL  +T    LR+Y+E +GEL D VV+ D+ T +SRGFG+VT+ D +    ++ +   N  H +DGK VE KRA+PR+D N+  SH    K+FVGGL +D T E ++    S     +   +++  K D  + RGF FV  ++ D  D+    K   +    V+ KKA  +D
Sbjct:   15 KLFVGGLNRETTNETLREYFEAYGELTDVVVICDSATKKSRGFGYVTFADYKVTRNVLKDKVENGAHRIDGKEVEVKRAIPRDD-NSATSHEKTKKIFVGGLPEDATKEDIQEAIESLLEEKVDKVDLIMKKEDETKHRGFAFVELNNEDQADELCCVKKIHVKGKMVEAKKATPRD 190          

HSP 2 Score: 70.8626 bits (172), Expect = 2.949e-14
Identity = 35/84 (41.67%), Postives = 51/84 (60.71%), Query Frame = 1
Query:  421 KLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYK----PHQIGSSRVDVKKALSKDE 660
            KLFVGGL ++ T E LR YF +YG +TD  ++    + +SRGFG+VTF DY      +  K     H+I    V+VK+A+ +D+
Sbjct:   15 KLFVGGLNRETTNETLREYFEAYGELTDVVVICDSATKKSRGFGYVTFADYKVTRNVLKDKVENGAHRIDGKEVEVKRAIPRDD 98          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Nematostella
Match: EDO38417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCX6])

HSP 1 Score: 120.939 bits (302), Expect = 1.003e-30
Identity = 68/172 (39.53%), Postives = 100/172 (58.14%), Query Frame = 1
Query:  148 KLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNN-RPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYF-TSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKD 657
            KLF+GGL+ +T +  L++Y+ ++GELV   +  D  TGR RGF FV ++     D   N   PH +DG+ ++ K A P      P  H+ V K+FVGGLK + + E +R YF  +Y  + + E +T   S   RGF FV+FD  D VDK    + H I  ++V+VK+AL K+
Sbjct:   30 KLFVGGLSYETTKESLKEYFSKYGELVGVDIKMDALTGRPRGFAFVQFKHQSEADAVLNQVDPHVLDGRTIDPKPAAP---IGKP-PHLRVKKIFVGGLKPETSDEKIREYFGKAYAPVKEIEYITEHSSNRRRGFCFVSFDSEDTVDKICETQFHNIEGNKVEVKRALPKE 197          

HSP 2 Score: 60.077 bits (144), Expect = 5.229e-10
Identity = 26/83 (31.33%), Postives = 53/83 (63.86%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYY-EQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPRE 384
            + +K+F+GGL P+T + ++R+Y+ + +  + +   + ++ + R RGF FV++   + VD+    + H ++G  VE KRA+P+E
Sbjct:  115 RVKKIFVGGLKPETSDEKIREYFGKAYAPVKEIEYITEHSSNRRRGFCFVSFDSEDTVDKICETQFHNIEGNKVEVKRALPKE 197          

HSP 3 Score: 53.1434 bits (126), Expect = 8.689e-8
Identity = 32/92 (34.78%), Postives = 46/92 (50.00%), Query Frame = 1
Query:  415 VNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYK--PHQIGSSRVDVKKALSKDEMEEIRRKQ 684
            + KLFVGGL  + T E L+ YF+ YG +   +I     +G  RGF FV F      D A+L +  PH +    +D K A    +   +R K+
Sbjct:   28 IGKLFVGGLSYETTKESLKEYFSKYGELVGVDIKMDALTGRPRGFAFVQFKHQSEAD-AVLNQVDPHVLDGRTIDPKPAAPIGKPPHLRVKK 118          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Medaka
Match: ENSORLT00000010040.2 (heterogeneous nuclear ribonucleoprotein A1 [Source:NCBI gene;Acc:101174914])

HSP 1 Score: 202.216 bits (513), Expect = 3.155e-60
Identity = 95/176 (53.98%), Postives = 128/176 (72.73%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEME 666
            Q RKLFIGGL+ +T +  LR ++EQWG L D VVM+D  + RSRGFGFVTY   + VD A + RPH+VDG++VE KRA+ REDSN P +H+TV K+FVGG+K+D    HLR YF  +G I   +I+T +++G+ RGF FVTFDD+D VD+ ++ K H I S   +V+KAL+K EM+
Sbjct:   11 QLRKLFIGGLSFETTDESLRAHFEQWGTLTDCVVMRDPNSKRSRGFGFVTYSSVQEVDAAMSARPHKVDGRVVEPKRAVSREDSNRPGAHITVKKIFVGGIKEDTEESHLRDYFQQFGKIEVIDIMTDRNTGKKRGFAFVTFDDHDSVDRIVIQKYHTINSHNCEVRKALTKQEMQ 186          

HSP 2 Score: 75.485 bits (184), Expect = 1.362e-14
Identity = 35/90 (38.89%), Postives = 56/90 (62.22%), Query Frame = 1
Query:  391 NTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDE 660
            + P     + KLF+GGL  + T E LR +F  +GT+TDC ++   +S  SRGFGFVT+     VD A+  +PH++    V+ K+A+S+++
Sbjct:    4 DVPREPEQLRKLFIGGLSFETTDESLRAHFEQWGTLTDCVVMRDPNSKRSRGFGFVTYSSVQEVDAAMSARPHKVDGRVVEPKRAVSRED 93          

HSP 3 Score: 64.6994 bits (156), Expect = 6.223e-11
Identity = 28/84 (33.33%), Postives = 51/84 (60.71%), Query Frame = 1
Query:  145 RKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNT 396
            +K+F+GG+   T+E  LR Y++Q+G++    +M D  TG+ RGF FVT+ D + VD     + H ++    E ++A+ +++  T
Sbjct:  104 KKIFVGGIKEDTEESHLRDYFQQFGKIEVIDIMTDRNTGKKRGFAFVTFDDHDSVDRIVIQKYHTINSHNCEVRKALTKQEMQT 187          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Medaka
Match: hnrnpa3 (heterogeneous nuclear ribonucleoprotein A3 [Source:NCBI gene;Acc:101164602])

HSP 1 Score: 199.904 bits (507), Expect = 2.889e-59
Identity = 97/178 (54.49%), Postives = 124/178 (69.66%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEI 672
            Q RKLFIGGL+ +T E  LR ++EQWG L D VVM+D  + RSRGFGFVTY +   VD+A   RPH+VDG++VE KRA+ REDSN P +H+TV K+FVGG+K+D    H+R YF  YG I   +I+  + +G+ RGF FVTFDD+D VDK +  K H I     +V+KALSK EM  I
Sbjct:   11 QLRKLFIGGLSFETTEESLRAHFEQWGSLTDCVVMRDPNSKRSRGFGFVTYSNVTEVDDAMKARPHKVDGRVVEPKRAVSREDSNKPGAHLTVKKIFVGGIKEDTEEYHIREYFEKYGKIECIDIMEERSTGKKRGFCFVTFDDHDTVDKIVAQKYHIINFHNCEVRKALSKQEMNTI 188          

HSP 2 Score: 65.4698 bits (158), Expect = 2.969e-11
Identity = 28/87 (32.18%), Postives = 56/87 (64.37%), Query Frame = 1
Query:  145 RKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPES 405
            +K+F+GG+   T+E  +R+Y+E++G++    +M++  TG+ RGF FVT+ D + VD+    + H ++    E ++A+ +++ NT  S
Sbjct:  104 KKIFVGGIKEDTEEYHIREYFEKYGKIECIDIMEERSTGKKRGFCFVTFDDHDTVDKIVAQKYHIINFHNCEVRKALSKQEMNTISS 190          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Medaka
Match: hnrnpa3 (heterogeneous nuclear ribonucleoprotein A3 [Source:NCBI gene;Acc:101164602])

HSP 1 Score: 199.904 bits (507), Expect = 3.121e-59
Identity = 97/178 (54.49%), Postives = 124/178 (69.66%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEI 672
            Q RKLFIGGL+ +T E  LR ++EQWG L D VVM+D  + RSRGFGFVTY +   VD+A   RPH+VDG++VE KRA+ REDSN P +H+TV K+FVGG+K+D    H+R YF  YG I   +I+  + +G+ RGF FVTFDD+D VDK +  K H I     +V+KALSK EM  I
Sbjct:   20 QLRKLFIGGLSFETTEESLRAHFEQWGSLTDCVVMRDPNSKRSRGFGFVTYSNVTEVDDAMKARPHKVDGRVVEPKRAVSREDSNKPGAHLTVKKIFVGGIKEDTEEYHIREYFEKYGKIECIDIMEERSTGKKRGFCFVTFDDHDTVDKIVAQKYHIINFHNCEVRKALSKQEMNTI 197          

HSP 2 Score: 65.855 bits (159), Expect = 2.898e-11
Identity = 28/87 (32.18%), Postives = 56/87 (64.37%), Query Frame = 1
Query:  145 RKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPES 405
            +K+F+GG+   T+E  +R+Y+E++G++    +M++  TG+ RGF FVT+ D + VD+    + H ++    E ++A+ +++ NT  S
Sbjct:  113 KKIFVGGIKEDTEEYHIREYFEKYGKIECIDIMEERSTGKKRGFCFVTFDDHDTVDKIVAQKYHIINFHNCEVRKALSKQEMNTISS 199          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Medaka
Match: ENSORLT00000000235.2 (pep primary_assembly:ASM223467v1:10:5454935:5456789:1 gene:ENSORLG00000026571.1 transcript:ENSORLT00000000235.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.918 bits (398), Expect = 3.259e-45
Identity = 78/173 (45.09%), Postives = 109/173 (63.01%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKD 657
            Q  KLF+GGL   T++  LRK++EQ+G L+D  V+      RSR FGFVTY  PE  D A    PH V+G  VE KRA+P++ ++  E+   V K+FVGGLK D+  + L  YF+ YG + + EI++ KD+G+ RGFGFV F D+   D A+    H +   RV+VKK++ KD
Sbjct:    4 QACKLFVGGLKVDTNDDGLRKHFEQFGTLIDCAVVPHKTAQRSRCFGFVTYLTPEEADAAMAASPHTVEGNWVEVKRAVPKKQADESEARAKVKKIFVGGLKNDIQEDDLTDYFSQYGEVENSEIMSEKDTGKKRGFGFVHFTDHYAADMAVAVPFHTVNGHRVEVKKSVPKD 176          

HSP 2 Score: 72.0182 bits (175), Expect = 3.107e-14
Identity = 35/83 (42.17%), Postives = 51/83 (61.45%), Query Frame = 1
Query:  421 KLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEE 669
            KLFVGGLK D   + LR +F  +GT+ DC +V  K +  SR FGFVT+   +  D A+   PH +  + V+VK+A+ K + +E
Sbjct:    7 KLFVGGLKVDTNDDGLRKHFEQFGTLIDCAVVPHKTAQRSRCFGFVTYLTPEEADAAMAASPHTVEGNWVEVKRAVPKKQADE 89          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Medaka
Match: ENSORLT00000039941.1 (pep primary_assembly:ASM223467v1:10:6518911:6524698:1 gene:ENSORLG00000023542.1 transcript:ENSORLT00000039941.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.918 bits (398), Expect = 4.915e-44
Identity = 78/176 (44.32%), Postives = 109/176 (61.93%), Query Frame = 1
Query:  151 LFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIRR 678
            LF+GGL   T++  LRK++EQ+G L+DF V+      RSR FGFVTY  PE  + A    PH V+G  VE KRA+P++ ++  E+   V K+FVGGLK D+  + L  YF+ YG + + EI++ K +G+ RGFGFV F D    D A+    H +   RV+VKKA+ K EM+   R
Sbjct:   10 LFVGGLKVDTNDDGLRKHFEQFGTLIDFAVVPHKTAQRSRCFGFVTYLTPEEANAAMAASPHTVEGNWVEVKRAVPKKQADESEARAKVKKIFVGGLKNDIQEDDLTDYFSQYGEVENSEIISEKTTGKKRGFGFVHFTDDYAADMAVAVPFHTVNGHRVEVKKAVPKQEMQAPSR 185          

HSP 2 Score: 63.5438 bits (153), Expect = 9.263e-11
Identity = 31/87 (35.63%), Postives = 50/87 (57.47%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTP 399
            + +K+F+GGL     E  L  Y+ Q+GE+ +  ++ +  TG+ RGFGFV + D    D A     H V+G  VE K+A+P+++   P
Sbjct:   97 KVKKIFVGGLKNDIQEDDLTDYFSQYGEVENSEIISEKTTGKKRGFGFVHFTDDYAADMAVAVPFHTVNGHRVEVKKAVPKQEMQAP 183          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Planmine SMEST
Match: SMESG000025890.1 (SMESG000025890.1)

HSP 1 Score: 664.84 bits (1714), Expect = 0.000e+0
Identity = 331/331 (100.00%), Postives = 331/331 (100.00%), Query Frame = 1
Query:   97 MGXXXXXXXXXXXXQFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIRRKQHNEPLSVNCSTSSDYFQNTSKSTIPAFQSPIQQNTYSSNLPCVGSVMFDGSFQATGYQYPNISASNWNGNPGINSNYMYSRPISDLNQFVAPSVINFNNLINPSQPSPVDNGQQNIDACDISTKTKISSTGDENI 1089
            MGRRNTENNDRRTEQFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIRRKQHNEPLSVNCSTSSDYFQNTSKSTIPAFQSPIQQNTYSSNLPCVGSVMFDGSFQATGYQYPNISASNWNGNPGINSNYMYSRPISDLNQFVAPSVINFNNLINPSQPSPVDNGQQNIDACDISTKTKISSTGDENI
Sbjct:    1 MGRRNTENNDRRTEQFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIRRKQHNEPLSVNCSTSSDYFQNTSKSTIPAFQSPIQQNTYSSNLPCVGSVMFDGSFQATGYQYPNISASNWNGNPGINSNYMYSRPISDLNQFVAPSVINFNNLINPSQPSPVDNGQQNIDACDISTKTKISSTGDENI 331          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Planmine SMEST
Match: SMESG000080165.1 (SMESG000080165.1)

HSP 1 Score: 299.286 bits (765), Expect = 2.137e-97
Identity = 139/187 (74.33%), Postives = 161/187 (86.10%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIRRKQHNEPL 699
            QFRKLFIGGLTP T E +LRKYY+QWGELVD VVMKD  +GRSRGFGFVTY++  MVDEAQNNRPHE+DGKIVEAKRAMPREDS  PE+HMTV KLFVGGLKK++  + L  YFT YG + +CEIV+WKD+G+SRGFGFV FDDYDPVDKAILYKPH I SS++DVKKALSK+E+ EI+RK+ +  L
Sbjct:   16 QFRKLFIGGLTPNTSEEKLRKYYQQWGELVDAVVMKDCNSGRSRGFGFVTYKEVFMVDEAQNNRPHEIDGKIVEAKRAMPREDSIHPEAHMTVTKLFVGGLKKEIVNQELVDYFTDYGIVIECEIVSWKDTGKSRGFGFVLFDDYDPVDKAILYKPHFIQSSKIDVKKALSKEEIFEIKRKKQSSHL 202          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Planmine SMEST
Match: SMESG000050993.1 (SMESG000050993.1)

HSP 1 Score: 250.366 bits (638), Expect = 1.331e-79
Identity = 115/183 (62.84%), Postives = 146/183 (79.78%), Query Frame = 1
Query:  139 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMK-DNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIRRKQ 684
            QFRKLFIGGL+  T E  L+ ++EQWGELVD VVM+   K G+SRGFGFVTY+DP+MVD AQ +RPH +D + VE KRAMPR+++N+ ESHMTV KLFVG LKK+V  + LR YF  +G IT+CEI+TW+++GESRGFGFVT+DDYDPVDK +L KPH I + R +VKKALSK+E   ++ K+
Sbjct:   13 QFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDDRTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKE 195          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Planmine SMEST
Match: SMESG000081075.1 (SMESG000081075.1)

HSP 1 Score: 214.542 bits (545), Expect = 3.868e-65
Identity = 103/172 (59.88%), Postives = 132/172 (76.74%), Query Frame = 1
Query:  145 RKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDE 660
            +KLFIGGL  +T E  L+ +Y QWGE+VD VVM+D +TG+SRGFGFVTY D   VD+AQ+NRPHEVDG  V++KRAMP+ED+ +PE H TVN+LFVG LK++V  + LR YF  YGTI D  I+    +GESRGFGFVTFDD D VDK I+ +PHQ+  + ++VKKAL +D+
Sbjct:   10 KKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVIIN-NSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD 179          
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Planmine SMEST
Match: SMESG000038668.1 (SMESG000038668.1)

HSP 1 Score: 166.392 bits (420), Expect = 1.085e-46
Identity = 74/160 (46.25%), Postives = 110/160 (68.75%), Query Frame = 1
Query:  193 LRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEI 672
            +R+Y+ ++G++ D V M+D    +SRGFGFV +++ + VD  Q  RPH++ GKIV+ KRAMP+E+S  P+ H    ++F+GG+++  T + L+ YF+++G I DC I     SG+SRGF F+TF D D VDK IL KPH I    VDVKKALS +E+ ++
Sbjct:    1 MRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEDDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 160          

HSP 2 Score: 70.4774 bits (171), Expect = 5.356e-13
Identity = 30/81 (37.04%), Postives = 54/81 (66.67%), Query Frame = 1
Query:  145 RKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPRED 387
            +++FIGG+     E  L+ Y+  +GE+VD  + +DN +G+SRGF F+T+ D ++VD+   ++PH +   IV+ K+A+  E+
Sbjct:   76 KRIFIGGIRRFFTEDDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEE 156          
The following BLAST results are available for this feature:
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HNRNPA2B11.090e-6658.19heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
HNRNPA2B14.445e-6657.54heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
HNRNPA2B14.445e-6657.54heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
HNRNPA2B17.816e-6657.87heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
HNRNPA2B17.816e-6657.87heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hrp-18.095e-5648.37Heterogeneous nuclear ribonucleoprotein A1 [Sourc... [more]
hrp-18.095e-5648.37Heterogeneous nuclear ribonucleoprotein A1 [Sourc... [more]
hrp-18.313e-5648.37Heterogeneous nuclear ribonucleoprotein A1 [Sourc... [more]
hrp-18.313e-5648.37Heterogeneous nuclear ribonucleoprotein A1 [Sourc... [more]
hrp-15.808e-5050.96Heterogeneous nuclear ribonucleoprotein A1 [Sourc... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hrb87F2.784e-6155.11gene:FBgn0004237 transcript:FBtr0310621[more]
Hrb87F2.784e-6155.11gene:FBgn0004237 transcript:FBtr0300590[more]
Hrb87F2.784e-6155.11gene:FBgn0004237 transcript:FBtr0334495[more]
Hrb87F2.784e-6155.11gene:FBgn0004237 transcript:FBtr0082851[more]
Hrb98DE6.690e-6155.23gene:FBgn0001215 transcript:FBtr0085302[more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpa35.087e-6154.55heterogeneous nuclear ribonucleoprotein A3 [Source... [more]
hnrnpa36.447e-6054.55heterogeneous nuclear ribonucleoprotein A3 [Source... [more]
hnrnpa31.279e-5954.55heterogeneous nuclear ribonucleoprotein A3 [Source... [more]
hnrnpa1a4.777e-5952.81heterogeneous nuclear ribonucleoprotein A1a [Sourc... [more]
hnrnpa1b8.967e-5653.14heterogeneous nuclear ribonucleoprotein A1b [Sourc... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpa2b12.763e-6657.54heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
hnrnpa2b13.385e-6657.54heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
hnrnpa2b14.730e-6657.54heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
hnrnpa2b15.046e-6657.54heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
psd33.317e-6153.93pleckstrin and Sec7 domain containing 3 [Source:Xe... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hnrnpa2b17.312e-6757.54heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
Hnrnpa2b17.312e-6757.54heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
Hnrnpa2b17.312e-6757.54heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
Hnrnpa2b13.052e-6657.54heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
Hnrnpa2b13.052e-6657.54heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9TTV2|ROA2_SAGOE2.871e-6658.10Heterogeneous nuclear ribonucleoproteins A2/B1 OS=... [more]
sp|Q5RBU8|ROA2_PONAB2.117e-6557.87Heterogeneous nuclear ribonucleoproteins A2/B1 OS=... [more]
sp|Q2HJ60|ROA2_BOVIN2.135e-6557.54Heterogeneous nuclear ribonucleoproteins A2/B1 OS=... [more]
sp|O88569|ROA2_MOUSE3.753e-6557.87Heterogeneous nuclear ribonucleoproteins A2/B1 OS=... [more]
sp|P22626|ROA2_HUMAN3.753e-6557.87Heterogeneous nuclear ribonucleoproteins A2/B1 OS=... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E2IXG00.000e+0100.00Heterogeneous nuclear ribonucleoprotein A2 OS=Schm... [more]
A0A183Q0342.413e-10078.06Uncharacterized protein OS=Schistosoma mattheei OX... [more]
A0A183JHD42.502e-10078.06Uncharacterized protein OS=Schistosoma curassoni O... [more]
C1L9G64.097e-10078.06Heterogeneous nuclear ribonucleoprotein A2 homolog... [more]
A0A183VJF75.720e-9977.55Uncharacterized protein OS=Trichobilharzia regenti... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpa1a6.270e-6256.25heterogeneous nuclear ribonucleoprotein A1-like [S... [more]
hnrnpa1a6.270e-6256.25heterogeneous nuclear ribonucleoprotein A1-like [S... [more]
hnrnpa31.663e-5855.11heterogeneous nuclear ribonucleoprotein A3 [Source... [more]
ENSAMXT00000025677.21.472e-5550.57pep primary_assembly:Astyanax_mexicanus-2.0:24:390... [more]
ENSAMXT00000047970.13.541e-5050.00pep primary_assembly:Astyanax_mexicanus-2.0:24:139... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004893.12.203e-6353.98pep scaffold:Pmarinus_7.0:GL479484:4:2056:-1 gene:... [more]
HNRNPA2B12.781e-6354.95heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
HNRNPA06.854e-6354.86heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
HNRNPA09.582e-6052.81heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
TARDBP4.462e-1731.52TAR DNA binding protein [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HRP13.781e-3740.96Subunit of cleavage factor I; cleavage factor I is... [more]
PAB12.143e-1128.06Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
NSR13.209e-1023.72Nucleolar protein that binds nuclear localization ... [more]
PUB11.129e-926.14Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
SNP14.141e-839.62Component of U1 snRNP required for mRNA splicing v... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO398799.384e-3942.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333891.166e-3741.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493496.536e-3641.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365221.419e-3138.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384171.003e-3039.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000010040.23.155e-6053.98heterogeneous nuclear ribonucleoprotein A1 [Source... [more]
hnrnpa32.889e-5954.49heterogeneous nuclear ribonucleoprotein A3 [Source... [more]
hnrnpa33.121e-5954.49heterogeneous nuclear ribonucleoprotein A3 [Source... [more]
ENSORLT00000000235.23.259e-4545.09pep primary_assembly:ASM223467v1:10:5454935:545678... [more]
ENSORLT00000039941.14.915e-4444.32pep primary_assembly:ASM223467v1:10:6518911:652469... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein A2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025890.10.000e+0100.00SMESG000025890.1[more]
SMESG000080165.12.137e-9774.33SMESG000080165.1[more]
SMESG000050993.11.331e-7962.84SMESG000050993.1[more]
SMESG000081075.13.868e-6559.88SMESG000081075.1[more]
SMESG000038668.11.085e-4646.25SMESG000038668.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30032231
GenBankADK78240.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032231 ID=SMED30032231|Name=heterogeneous nuclear ribonucleoprotein A2|organism=Schmidtea mediterranea sexual|type=transcript|length=1534bp
CTTCCGATCTATTTAATTCAAATTTAAAAAGCTGGCTTCATGGTATTTTG
AGCAGAATTTCACGGCACAATAATCACTTGTAAAGTTTCAGTTAGAATGG
GTCGTCGAAATACAGAAAACAATGATAGACGAACCGAACAATTTCGAAAA
CTCTTTATCGGCGGATTGACTCCCCAGACCGATGAAATCCGTCTCCGAAA
ATATTATGAACAGTGGGGTGAATTGGTCGACTTTGTTGTGATGAAAGATA
ATAAAACTGGCCGTTCAAGAGGATTCGGATTTGTTACTTATCGAGATCCT
GAAATGGTTGATGAAGCTCAAAATAATAGGCCCCATGAAGTTGATGGCAA
AATCGTTGAAGCAAAACGAGCAATGCCGCGAGAAGATTCCAACACTCCTG
AATCACATATGACAGTTAACAAGCTCTTTGTCGGAGGATTAAAAAAAGAT
GTAACAACTGAACATTTACGACATTATTTTACCAGTTATGGCACGATAAC
TGACTGTGAAATTGTTACATGGAAAGATTCAGGAGAGTCAAGAGGATTTG
GATTTGTTACATTTGATGATTACGATCCAGTTGATAAAGCTATTCTTTAT
AAGCCTCACCAAATTGGTTCTAGTCGAGTCGACGTTAAAAAAGCTTTGAG
TAAAGATGAAATGGAAGAAATTCGTAGAAAACAACACAACGAGCCCTTAT
CTGTAAACTGTTCAACATCAAGTGATTATTTTCAAAACACGTCAAAATCT
ACAATACCAGCCTTCCAAAGTCCCATTCAACAAAACACTTATTCAAGCAA
TTTGCCATGCGTTGGGAGTGTCATGTTTGATGGTTCTTTCCAAGCCACTG
GCTACCAATATCCAAACATTTCTGCATCAAATTGGAATGGAAATCCAGGA
ATTAATTCAAATTATATGTATTCACGACCTATATCTGATTTGAATCAATT
CGTGGCCCCTTCAGTCATCAACTTTAATAATCTTATAAATCCTTCCCAAC
CTTCACCTGTTGACAATGGCCAGCAAAATATAGATGCTTGCGATATTAGT
ACAAAAACCAAAATTAGTTCTACTGGAGATGAAAATATTTAATGTTTATG
AAATAATCAAATTATTGATAGAAATTAATCCAGTGATTCTTATGAAAAAT
ATGTATGACCGATAGCTTCGAGTTGCCTTCAATCGCGTTCTGATTTTTAA
CATATCGAAATAGGGATTTCTTTTTCTTCGATTTCTTTTCCTGATCTTCC
TACGATGCCTAATCACTTTTATTTTAGCCTTTTTAGGTCCCACGACAGAA
TTTTATTTTTGTTTAGTAAGTGATATTTATGTCAATGTAAAAGAATTTCA
TAAAAAATAATAAAATGGTTCCCTCTATTCAAAATTGATAATGTATTTCA
CCATCAGATATTGTTGAATGATTTAGAGATTTTATCAGTAAATCTCGATA
GTAAGTGTCAAGTAGGTTCAACATTTTGAGTCTCGTTTATATTGTAACAA
TTTTGTGCTAATACAAATTTTTGATCGTCGAAAA
back to top

protein sequence of SMED30032231-orf-1

>SMED30032231-orf-1 ID=SMED30032231-orf-1|Name=SMED30032231-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=332bp
MGRRNTENNDRRTEQFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMK
DNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNT
PESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRG
FGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIRRKQHNEP
LSVNCSTSSDYFQNTSKSTIPAFQSPIQQNTYSSNLPCVGSVMFDGSFQA
TGYQYPNISASNWNGNPGINSNYMYSRPISDLNQFVAPSVINFNNLINPS
QPSPVDNGQQNIDACDISTKTKISSTGDENI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003729mRNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0000220spermatogonium
PLANA:0000221spermatocyte
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR037366BOULE/DAZ
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: cellular component
TermDefinition
GO:0019013viral nucleocapsid
GO:0030529intracellular ribonucleoprotein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 18..90
e-value: 7.8E-20
score: 81.9
coord: 109..181
e-value: 6.6E-20
score: 82.1
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 110..167
e-value: 1.7E-13
score: 50.1
coord: 19..77
e-value: 2.9E-13
score: 49.4
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 17..100
score: 15.46
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 108..185
score: 16.381
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 103..183
e-value: 1.6E-22
score: 81.5
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 3..102
e-value: 9.3E-23
score: 82.3
IPR037366BOULE/DAZ familyPANTHERPTHR11176BOULE-RELATEDcoord: 14..97
coord: 104..232
NoneNo IPR availablePANTHERPTHR11176:SF13GENE 17190-RELATEDcoord: 14..97
NoneNo IPR availablePANTHERPTHR11176:SF13GENE 17190-RELATEDcoord: 104..232
NoneNo IPR availableCDDcd12328RRM2_hnRNPA_likecoord: 109..181
e-value: 5.28804E-39
score: 130.841
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 15..101
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 98..195