WH1 domain-containing protein

Overview
NameWH1 domain-containing protein
Smed IDSMED30032229
Length (bp)2273
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WH1 domain-containing protein (SMED30032229) t-SNE clustered cells

Violin plots show distribution of expression levels for WH1 domain-containing protein (SMED30032229) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WH1 domain-containing protein (SMED30032229) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WH1 domain-containing protein (SMED30032229) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032229

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior sideSMED30032229h1SMcG0016205 dd_Smed_v4_7714_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30032229h1SMcG0016205 dd_Smed_v4_7714_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WH1 domain-containing protein vs. Ensembl Human
Match: ENAH (ENAH actin regulator [Source:HGNC Symbol;Acc:HGNC:18271])

HSP 1 Score: 72.0182 bits (175), Expect = 1.670e-13
Identity = 39/120 (32.50%), Postives = 66/120 (55.00%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQ 434
            SE  +  A A VM YD+   KWV +G S   +  +V +  H   N FR+      + +++++  +   L+Y +A  TFH+WRDA  + VYGL+F   ++A++F    S +  +LE++  Q
Sbjct:    2 SEQSICQARAAVMVYDDANKKWVPAGGSTGFS--RVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDA--RQVYGLNFGSKEDANVFA---SAMMHALEVLNSQ 114          
BLAST of WH1 domain-containing protein vs. Ensembl Human
Match: ENAH (ENAH actin regulator [Source:HGNC Symbol;Acc:HGNC:18271])

HSP 1 Score: 73.9442 bits (180), Expect = 5.054e-13
Identity = 39/120 (32.50%), Postives = 66/120 (55.00%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQ 434
            SE  +  A A VM YD+   KWV +G S     ++V +  H   N FR+      + +++++  +   L+Y +A  TFH+WRDA  + VYGL+F   ++A++F    S +  +LE++  Q
Sbjct:    2 SEQSICQARAAVMVYDDANKKWVPAGGS--TGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDA--RQVYGLNFGSKEDANVFA---SAMMHALEVLNSQ 114          
BLAST of WH1 domain-containing protein vs. Ensembl Human
Match: ENAH (ENAH actin regulator [Source:HGNC Symbol;Acc:HGNC:18271])

HSP 1 Score: 74.3294 bits (181), Expect = 5.276e-13
Identity = 39/120 (32.50%), Postives = 66/120 (55.00%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQ 434
            SE  +  A A VM YD+   KWV +G S   +  +V +  H   N FR+      + +++++  +   L+Y +A  TFH+WRDA  + VYGL+F   ++A++F    S +  +LE++  Q
Sbjct:    2 SEQSICQARAAVMVYDDANKKWVPAGGSTGFS--RVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDA--RQVYGLNFGSKEDANVFA---SAMMHALEVLNSQ 114          
BLAST of WH1 domain-containing protein vs. Ensembl Human
Match: ENAH (ENAH actin regulator [Source:HGNC Symbol;Acc:HGNC:18271])

HSP 1 Score: 73.9442 bits (180), Expect = 5.442e-13
Identity = 39/120 (32.50%), Postives = 66/120 (55.00%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQ 434
            SE  +  A A VM YD+   KWV +G S   +  +V +  H   N FR+      + +++++  +   L+Y +A  TFH+WRDA  + VYGL+F   ++A++F    S +  +LE++  Q
Sbjct:    2 SEQSICQARAAVMVYDDANKKWVPAGGSTGFS--RVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDA--RQVYGLNFGSKEDANVFA---SAMMHALEVLNSQ 114          
BLAST of WH1 domain-containing protein vs. Ensembl Human
Match: EVL (Enah/Vasp-like [Source:HGNC Symbol;Acc:HGNC:20234])

HSP 1 Score: 61.2326 bits (147), Expect = 1.176e-10
Identity = 33/107 (30.84%), Postives = 59/107 (55.14%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVI 395
            SE  +  A A VM YD+   KWV     +    +++ +  +  +N FR+      +++++++  +   L+Y +A  TFH+WRDA  + VYGL+FA  +EA  F + +
Sbjct:    4 SEQSICQARASVMVYDDTSKKWVPIKPGQQ-GFSRINIYHNTASNTFRVVGVKLQDQQVVINYSIVKGLKYNQATPTFHQWRDA--RQVYGLNFASKEEATTFSNAM 107          
BLAST of WH1 domain-containing protein vs. Ensembl Celegans
Match: unc-34 (UNC-34 [Source:UniProtKB/TrEMBL;Acc:G5EG53])

HSP 1 Score: 62.3882 bits (150), Expect = 6.714e-10
Identity = 36/116 (31.03%), Postives = 64/116 (55.17%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLEL 422
            SE  +  A A VM Y+     WV  G +   ++  V+L+Q +   +FRI +    +  IL  +I Y  ++Y KA   FH+WR  + + VYGL+F + ++A MF  ++ +  ++L++
Sbjct:    3 SEACIATAMARVMTYNESTKGWVLLGGNDD-SMTNVRLIQDIRRPEFRIVSNRADSTNILNCNI-YRGIKYHKATPMFHQWR-TEQRRVYGLNFENEQDATMFLSIVLQAIETLKV 115          
BLAST of WH1 domain-containing protein vs. Ensembl Celegans
Match: unc-34 (UNC-34 [Source:UniProtKB/TrEMBL;Acc:G5EG53])

HSP 1 Score: 60.4622 bits (145), Expect = 1.445e-9
Identity = 36/116 (31.03%), Postives = 64/116 (55.17%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLEL 422
            SE  +  A A VM Y+     WV  G +   ++  V+L+Q +   +FRI +    +  IL  +I Y  ++Y KA   FH+WR  + + VYGL+F + ++A MF  ++ +  ++L++
Sbjct:    3 SEACIATAMARVMTYNESTKGWVLLGGNDD-SMTNVRLIQDIRRPEFRIVSNRADSTNILNCNI-YRGIKYHKATPMFHQWR-TEQRRVYGLNFENEQDATMFLSIVLQAIETLKV 115          
BLAST of WH1 domain-containing protein vs. Ensembl Celegans
Match: unc-34 (UNC-34 [Source:UniProtKB/TrEMBL;Acc:G5EG53])

HSP 1 Score: 58.9214 bits (141), Expect = 8.199e-9
Identity = 33/107 (30.84%), Postives = 60/107 (56.07%), Query Frame = 3
Query:  102 AFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLEL 422
            A VM Y+     WV  G +   ++  V+L+Q +   +FRI +    +  IL  +I Y  ++Y KA   FH+WR  + + VYGL+F + ++A MF  ++ +  ++L++
Sbjct:    2 ARVMTYNESTKGWVLLGGNDD-SMTNVRLIQDIRRPEFRIVSNRADSTNILNCNI-YRGIKYHKATPMFHQWR-TEQRRVYGLNFENEQDATMFLSIVLQAIETLKV 105          
BLAST of WH1 domain-containing protein vs. Ensembl Celegans
Match: unc-34 (UNC-34 [Source:UniProtKB/TrEMBL;Acc:G5EG53])

HSP 1 Score: 53.9138 bits (128), Expect = 1.756e-7
Identity = 31/104 (29.81%), Postives = 58/104 (55.77%), Query Frame = 3
Query:  111 MYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLEL 422
            M Y+     WV  G +   ++  V+L+Q +   +FRI +    +  IL  +I Y  ++Y KA   FH+WR  + + VYGL+F + ++A MF  ++ +  ++L++
Sbjct:    1 MTYNESTKGWVLLGGNDD-SMTNVRLIQDIRRPEFRIVSNRADSTNILNCNI-YRGIKYHKATPMFHQWR-TEQRRVYGLNFENEQDATMFLSIVLQAIETLKV 101          
BLAST of WH1 domain-containing protein vs. Ensembl Fly
Match: ena (gene:FBgn0000578 transcript:FBtr0340450)

HSP 1 Score: 78.9518 bits (193), Expect = 7.489e-15
Identity = 44/134 (32.84%), Postives = 72/134 (53.73%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQCRELQAVIRANTPG 476
            +E  ++ A A VM YD+   KWV SG+S  ++  KVQ+  H   N FR+      + E++++  +   L+Y +A ATFH+WR  D++ VYGL+F+   +A  F   +     +LE++  +         AN PG
Sbjct:    2 TEQSIIGARASVMVYDDNQKKWVPSGSSSGLS--KVQIYHHQQNNTFRVVGRKLQDHEVVINCSILKGLKYNQATATFHQWR--DSKFVYGLNFSSQNDAENFARAM---MHALEVLSGRV--------ANNPG 120          
BLAST of WH1 domain-containing protein vs. Ensembl Fly
Match: ena (gene:FBgn0000578 transcript:FBtr0100174)

HSP 1 Score: 78.9518 bits (193), Expect = 7.861e-15
Identity = 44/134 (32.84%), Postives = 72/134 (53.73%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQCRELQAVIRANTPG 476
            +E  ++ A A VM YD+   KWV SG+S  ++  KVQ+  H   N FR+      + E++++  +   L+Y +A ATFH+WR  D++ VYGL+F+   +A  F   +     +LE++  +         AN PG
Sbjct:    2 TEQSIIGARASVMVYDDNQKKWVPSGSSSGLS--KVQIYHHQQNNTFRVVGRKLQDHEVVINCSILKGLKYNQATATFHQWR--DSKFVYGLNFSSQNDAENFARAM---MHALEVLSGRV--------ANNPG 120          
BLAST of WH1 domain-containing protein vs. Ensembl Fly
Match: ena (gene:FBgn0000578 transcript:FBtr0086582)

HSP 1 Score: 78.9518 bits (193), Expect = 8.536e-15
Identity = 44/134 (32.84%), Postives = 72/134 (53.73%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQCRELQAVIRANTPG 476
            +E  ++ A A VM YD+   KWV SG+S  ++  KVQ+  H   N FR+      + E++++  +   L+Y +A ATFH+WR  D++ VYGL+F+   +A  F   +     +LE++  +         AN PG
Sbjct:    2 TEQSIIGARASVMVYDDNQKKWVPSGSSSGLS--KVQIYHHQQNNTFRVVGRKLQDHEVVINCSILKGLKYNQATATFHQWR--DSKFVYGLNFSSQNDAENFARAM---MHALEVLSGRV--------ANNPG 120          
BLAST of WH1 domain-containing protein vs. Ensembl Fly
Match: ena (gene:FBgn0000578 transcript:FBtr0100176)

HSP 1 Score: 78.9518 bits (193), Expect = 8.536e-15
Identity = 44/134 (32.84%), Postives = 72/134 (53.73%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQCRELQAVIRANTPG 476
            +E  ++ A A VM YD+   KWV SG+S  ++  KVQ+  H   N FR+      + E++++  +   L+Y +A ATFH+WR  D++ VYGL+F+   +A  F   +     +LE++  +         AN PG
Sbjct:    2 TEQSIIGARASVMVYDDNQKKWVPSGSSSGLS--KVQIYHHQQNNTFRVVGRKLQDHEVVINCSILKGLKYNQATATFHQWR--DSKFVYGLNFSSQNDAENFARAM---MHALEVLSGRV--------ANNPG 120          
BLAST of WH1 domain-containing protein vs. Ensembl Fly
Match: ena (gene:FBgn0000578 transcript:FBtr0086583)

HSP 1 Score: 78.9518 bits (193), Expect = 8.536e-15
Identity = 44/134 (32.84%), Postives = 72/134 (53.73%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQCRELQAVIRANTPG 476
            +E  ++ A A VM YD+   KWV SG+S  ++  KVQ+  H   N FR+      + E++++  +   L+Y +A ATFH+WR  D++ VYGL+F+   +A  F   +     +LE++  +         AN PG
Sbjct:    2 TEQSIIGARASVMVYDDNQKKWVPSGSSSGLS--KVQIYHHQQNNTFRVVGRKLQDHEVVINCSILKGLKYNQATATFHQWR--DSKFVYGLNFSSQNDAENFARAM---MHALEVLSGRV--------ANNPG 120          
BLAST of WH1 domain-containing protein vs. Ensembl Zebrafish
Match: enah (ENAH actin regulator [Source:ZFIN;Acc:ZDB-GENE-010323-11])

HSP 1 Score: 71.633 bits (174), Expect = 2.952e-14
Identity = 44/146 (30.14%), Postives = 76/146 (52.05%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQCRELQAVIRANTPGDQYGSKSQNLKI 512
            SE  +  A A VM YD+   KWV +G S   +  +V +  H   N FR+      + +++++  +   L+Y +A  TFH+WRDA  + VYGL+F   ++A++F    S +  +LE++  Q  +    +   TP  Q G   + L++
Sbjct:    2 SEQSICQARAAVMVYDDANKKWVPAGGSTGFS--RVHIYHHTGNNAFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDA--RQVYGLNFGSKEDANVFA---SAMMHALEVLNSQ--DAGPPLPRQTPQVQNGPSPEELEV 138          
BLAST of WH1 domain-containing protein vs. Ensembl Zebrafish
Match: enah (ENAH actin regulator [Source:ZFIN;Acc:ZDB-GENE-010323-11])

HSP 1 Score: 77.0258 bits (188), Expect = 4.543e-14
Identity = 45/152 (29.61%), Postives = 79/152 (51.97%), Query Frame = 3
Query:   57 SEMNRNSEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQCRELQAVIRANTPGDQYGSKSQNLKI 512
            S+M  + E  +  A A VM YD+   KWV +G S   +  +V +  H   N FR+      + +++++  +   L+Y +A  TFH+WRDA  + VYGL+F   ++A++F    S +  +LE++  Q  +    +   TP  Q G   + L++
Sbjct:   24 SKMEVHREQSICQARAAVMVYDDANKKWVPAGGSTGFS--RVHIYHHTGNNAFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDA--RQVYGLNFGSKEDANVFA---SAMMHALEVLNSQ--DAGPPLPRQTPQVQNGPSPEELEV 166          
BLAST of WH1 domain-containing protein vs. Ensembl Zebrafish
Match: enah (ENAH actin regulator [Source:ZFIN;Acc:ZDB-GENE-010323-11])

HSP 1 Score: 73.9442 bits (180), Expect = 3.252e-13
Identity = 44/146 (30.14%), Postives = 76/146 (52.05%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQCRELQAVIRANTPGDQYGSKSQNLKI 512
            SE  +  A A VM YD+   KWV +G S     ++V +  H   N FR+      + +++++  +   L+Y +A  TFH+WRDA  + VYGL+F   ++A++F    S +  +LE++  Q  +    +   TP  Q G   + L++
Sbjct:    2 SEQSICQARAAVMVYDDANKKWVPAGGS--TGFSRVHIYHHTGNNAFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDA--RQVYGLNFGSKEDANVFA---SAMMHALEVLNSQ--DAGPPLPRQTPQVQNGPSPEELEV 138          
BLAST of WH1 domain-containing protein vs. Ensembl Zebrafish
Match: enah (ENAH actin regulator [Source:ZFIN;Acc:ZDB-GENE-010323-11])

HSP 1 Score: 63.1586 bits (152), Expect = 1.347e-11
Identity = 34/108 (31.48%), Postives = 60/108 (55.56%), Query Frame = 3
Query:  111 MYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQ 434
            M YD+   KWV +G S   +  +V +  H   N FR+      + +++++  +   L+Y +A  TFH+WRDA  + VYGL+F   ++A++F    S +  +LE++  Q
Sbjct:    1 MVYDDANKKWVPAGGSTGFS--RVHIYHHTGNNAFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDA--RQVYGLNFGSKEDANVFA---SAMMHALEVLNSQ 101          
BLAST of WH1 domain-containing protein vs. Ensembl Zebrafish
Match: vaspa (vasodilator stimulated phosphoprotein a [Source:ZFIN;Acc:ZDB-GENE-070424-68])

HSP 1 Score: 68.1662 bits (165), Expect = 1.621e-11
Identity = 35/118 (29.66%), Postives = 69/118 (58.47%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNP-INKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELI 425
            SE  +  A A VM YD+   +W+ +G S +  V+++ + Q+ ++  FR+       +++++++  L   ++Y +A  TFH+WRDA  + V+GL+F   +EA  F    S + Q+L+++
Sbjct:    2 SEQSICQARATVMLYDDGSKRWMPAG-SGAQAVSRIHIFQNSSSCSFRVVGRKQQADQQVVINCPLVRGMKYNQATPTFHQWRDA--RQVWGLNFGSKEEASQFA---SGIMQALDML 113          
BLAST of WH1 domain-containing protein vs. Ensembl Xenopus
Match: neu1 (neuraminidase 1 (lysosomal sialidase) [Source:Xenbase;Acc:XB-GENE-959028])

HSP 1 Score: 75.485 bits (184), Expect = 6.023e-14
Identity = 37/100 (37.00%), Postives = 62/100 (62.00%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEA 374
            SE PLV A A VM YD+   KWVA+G   +   ++VQ+  + TT  +R+      +++++++  L   L+Y +A   FH+WR  D++ V+GL+FA+ +EA
Sbjct:    3 SETPLVTARANVMVYDDSSKKWVAAGTG-AQGPSRVQIFHNPTTQAYRVVGRKMQDQQVVINCPLVRGLKYNQATPNFHQWR--DSRQVWGLNFANKEEA 99          
BLAST of WH1 domain-containing protein vs. Ensembl Xenopus
Match: sorbs2 (sorbin and SH3 domain containing 2 [Source:Xenbase;Acc:XB-GENE-478190])

HSP 1 Score: 74.7146 bits (182), Expect = 3.432e-13
Identity = 39/120 (32.50%), Postives = 66/120 (55.00%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQ 434
            SE  +  A A VM YD+   KWV +G S   +  +V +  H   N FR+      + +++++  +   L+Y +A  TFH+WRDA  + VYGL+F   ++A++F    S +  +LE++  Q
Sbjct:    2 SEQSICQARAAVMVYDDANKKWVPAGGSTGFS--RVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDA--RQVYGLNFGSKEDANVFA---SAMMHALEVLNSQ 114          
BLAST of WH1 domain-containing protein vs. Ensembl Xenopus
Match: sorbs2 (sorbin and SH3 domain containing 2 [Source:Xenbase;Acc:XB-GENE-478190])

HSP 1 Score: 74.7146 bits (182), Expect = 4.019e-13
Identity = 39/120 (32.50%), Postives = 66/120 (55.00%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQ 434
            SE  +  A A VM YD+   KWV +G S   +  +V +  H   N FR+      + +++++  +   L+Y +A  TFH+WRDA  + VYGL+F   ++A++F    S +  +LE++  Q
Sbjct:    2 SEQSICQARAAVMVYDDANKKWVPAGGSTGFS--RVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDA--RQVYGLNFGSKEDANVFA---SAMMHALEVLNSQ 114          
BLAST of WH1 domain-containing protein vs. Ensembl Xenopus
Match: sorbs2 (sorbin and SH3 domain containing 2 [Source:Xenbase;Acc:XB-GENE-478190])

HSP 1 Score: 73.559 bits (179), Expect = 5.497e-13
Identity = 39/120 (32.50%), Postives = 66/120 (55.00%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQ 434
            SE  +  A A VM YD+   KWV +G S     ++V +  H   N FR+      + +++++  +   L+Y +A  TFH+WRDA  + VYGL+F   ++A++F    S +  +LE++  Q
Sbjct:    2 SEQSICQARAAVMVYDDANKKWVPAGGS--TGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDA--RQVYGLNFGSKEDANVFA---SAMMHALEVLNSQ 114          
BLAST of WH1 domain-containing protein vs. Ensembl Xenopus
Match: sorbs2 (sorbin and SH3 domain containing 2 [Source:Xenbase;Acc:XB-GENE-478190])

HSP 1 Score: 73.9442 bits (180), Expect = 5.874e-13
Identity = 37/116 (31.90%), Postives = 64/116 (55.17%), Query Frame = 3
Query:   87 LVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQ 434
            +  A A VM YD+   KWV +G S   +  +V +  H   N FR+      + +++++  +   L+Y +A  TFH+WRDA  + VYGL+F   ++A++F    S +  +LE++  Q
Sbjct:    5 ICQARAAVMVYDDANKKWVPAGGSTGFS--RVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDA--RQVYGLNFGSKEDANVFA---SAMMHALEVLNSQ 113          
BLAST of WH1 domain-containing protein vs. Ensembl Mouse
Match: Enah (ENAH actin regulator [Source:MGI Symbol;Acc:MGI:108360])

HSP 1 Score: 74.7146 bits (182), Expect = 2.573e-13
Identity = 39/120 (32.50%), Postives = 66/120 (55.00%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQ 434
            SE  +  A A VM YD+   KWV +G S   +  +V +  H   N FR+      + +++++  +   L+Y +A  TFH+WRDA  + VYGL+F   ++A++F    S +  +LE++  Q
Sbjct:    2 SEQSICQARAAVMVYDDANKKWVPAGGSTGFS--RVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDA--RQVYGLNFGSKEDANVFA---SAMMHALEVLNSQ 114          
BLAST of WH1 domain-containing protein vs. Ensembl Mouse
Match: Enah (ENAH actin regulator [Source:MGI Symbol;Acc:MGI:108360])

HSP 1 Score: 73.9442 bits (180), Expect = 2.934e-13
Identity = 40/122 (32.79%), Postives = 67/122 (54.92%), Query Frame = 3
Query:   69 RNSEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQ 434
            R SE  +  A A VM YD+   KWV +G S   +  +V +  H   N FR+      + +++++  +   L+Y +A  TFH+WRDA  + VYGL+F   ++A++F    S +  +LE++  Q
Sbjct:   20 RISEQSICQARAAVMVYDDANKKWVPAGGSTGFS--RVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDA--RQVYGLNFGSKEDANVFA---SAMMHALEVLNSQ 134          
BLAST of WH1 domain-containing protein vs. Ensembl Mouse
Match: Enah (ENAH actin regulator [Source:MGI Symbol;Acc:MGI:108360])

HSP 1 Score: 73.9442 bits (180), Expect = 3.086e-13
Identity = 39/120 (32.50%), Postives = 66/120 (55.00%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQ 434
            SE  +  A A VM YD+   KWV +G S   +  +V +  H   N FR+      + +++++  +   L+Y +A  TFH+WRDA  + VYGL+F   ++A++F    S +  +LE++  Q
Sbjct:    2 SEQSICQARAAVMVYDDANKKWVPAGGSTGFS--RVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDA--RQVYGLNFGSKEDANVF---ASAMMHALEVLNSQ 114          
BLAST of WH1 domain-containing protein vs. Ensembl Mouse
Match: Enah (ENAH actin regulator [Source:MGI Symbol;Acc:MGI:108360])

HSP 1 Score: 74.7146 bits (182), Expect = 3.089e-13
Identity = 39/120 (32.50%), Postives = 66/120 (55.00%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQ 434
            SE  +  A A VM YD+   KWV +G S   +  +V +  H   N FR+      + +++++  +   L+Y +A  TFH+WRDA  + VYGL+F   ++A++F    S +  +LE++  Q
Sbjct:    2 SEQSICQARAAVMVYDDANKKWVPAGGSTGFS--RVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDA--RQVYGLNFGSKEDANVFA---SAMMHALEVLNSQ 114          
BLAST of WH1 domain-containing protein vs. Ensembl Mouse
Match: Enah (ENAH actin regulator [Source:MGI Symbol;Acc:MGI:108360])

HSP 1 Score: 74.3294 bits (181), Expect = 3.555e-13
Identity = 39/120 (32.50%), Postives = 66/120 (55.00%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQ 434
            SE  +  A A VM YD+   KWV +G S   +  +V +  H   N FR+      + +++++  +   L+Y +A  TFH+WRDA  + VYGL+F   ++A++F    S +  +LE++  Q
Sbjct:    2 SEQSICQARAAVMVYDDANKKWVPAGGSTGFS--RVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDA--RQVYGLNFGSKEDANVFA---SAMMHALEVLNSQ 114          
BLAST of WH1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8T4F7|ENA_DROME (Protein enabled OS=Drosophila melanogaster OX=7227 GN=ena PE=1 SV=4)

HSP 1 Score: 78.1814 bits (191), Expect = 2.012e-13
Identity = 39/114 (34.21%), Postives = 64/114 (56.14%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSL 416
            +E  ++ A A VM YD+   KWV SG+S  ++  KVQ+  H   N FR+      + E++++  +   L+Y +A ATFH+WR  D++ VYGL+F+   +A  F   +    + L
Sbjct:  298 AEQSIIGARASVMVYDDNQKKWVPSGSSSGLS--KVQIYHHQQNNTFRVVGRKLQDHEVVINCSILKGLKYNQATATFHQWR--DSKFVYGLNFSSQNDAENFARAMMHALEVL 407          
BLAST of WH1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q03173|ENAH_MOUSE (Protein enabled homolog OS=Mus musculus OX=10090 GN=Enah PE=1 SV=2)

HSP 1 Score: 75.0998 bits (183), Expect = 1.722e-12
Identity = 39/120 (32.50%), Postives = 66/120 (55.00%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQ 434
            SE  +  A A VM YD+   KWV +G S   +  +V +  H   N FR+      + +++++  +   L+Y +A  TFH+WRDA  + VYGL+F   ++A++F    S +  +LE++  Q
Sbjct:    2 SEQSICQARAAVMVYDDANKKWVPAGGSTGFS--RVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDA--RQVYGLNFGSKEDANVFA---SAMMHALEVLNSQ 114          
BLAST of WH1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8N8S7|ENAH_HUMAN (Protein enabled homolog OS=Homo sapiens OX=9606 GN=ENAH PE=1 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 2.427e-12
Identity = 39/120 (32.50%), Postives = 66/120 (55.00%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQ 434
            SE  +  A A VM YD+   KWV +G S     ++V +  H   N FR+      + +++++  +   L+Y +A  TFH+WRDA  + VYGL+F   ++A++F    S +  +LE++  Q
Sbjct:    2 SEQSICQARAAVMVYDDANKKWVPAGGS--TGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDA--RQVYGLNFGSKEDANVFA---SAMMHALEVLNSQ 114          
BLAST of WH1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q64GL0|EVL_XENLA (Ena/VASP-like protein OS=Xenopus laevis OX=8355 GN=evl PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 4.802e-10
Identity = 34/107 (31.78%), Postives = 58/107 (54.21%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVI 395
            SE  +  A A VM YD+   KWV     +    +++ +  +   N FR+      +++++++  L   L+Y +A  TFH+WRDA  + VYGL+FA  +EA  F + +
Sbjct:    2 SEQSICQARASVMIYDDTSKKWVPIKPGQQ-GFSRINIYHNTANNTFRVVGVKLQDQQVVINYSLVKGLKYNQATPTFHQWRDA--RQVYGLNFASKEEATTFSNAM 105          
BLAST of WH1 domain-containing protein vs. UniProt/SwissProt
Match: sp|P50551|VASP_CANLF (Vasodilator-stimulated phosphoprotein OS=Canis lupus familiaris OX=9615 GN=VASP PE=1 SV=3)

HSP 1 Score: 65.855 bits (159), Expect = 5.768e-10
Identity = 31/104 (29.81%), Postives = 61/104 (58.65%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWN-PINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMF 383
            SE  + ++ A VM YD+   +W+ +G     + ++VQ+  + T N FR+  W    +++++++  +   ++Y +A  TFH+WRDA  + V+GL+F   ++A  F
Sbjct:    2 SETVICSSWATVMLYDDSNKRWLPAGTGPQ-SFSRVQIYHNPTANSFRVVGWKMQPDQQVVINCAIVRGIKYNQATPTFHQWRDA--RQVWGLNFGSKEDATQF 102          
BLAST of WH1 domain-containing protein vs. TrEMBL
Match: A0A5J4NI70 (Enabled OS=Paragonimus westermani OX=34504 GN=DEA37_0003903 PE=4 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 2.569e-18
Identity = 44/119 (36.97%), Postives = 70/119 (58.82%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQ 431
            +E P+V A A VM YD     WV SGA   ++  KVQL  + TTN +R+  W   ++E++++  +   L+Y +A  TFH+WRD+  Q VYGL+FA  +EA +F   +     +L  +++
Sbjct:    2 TECPVVTAKANVMLYDTAASAWVPSGARHGIS--KVQLYHNTTTNAYRVVGWRLQDREVVINCAIVRGLKYHRARQTFHQWRDSKQQ-VYGLNFATVEEADVFAAAVEDALANLAALHK 117          
BLAST of WH1 domain-containing protein vs. TrEMBL
Match: A0A419QAE2 (Protein enabled-like protein OS=Clonorchis sinensis OX=79923 GN=Enah PE=4 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 5.056e-16
Identity = 44/114 (38.60%), Postives = 67/114 (58.77%), Query Frame = 3
Query:   78 EVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLE 419
            E P+  A AFV+ +++    WV SG +++++   VQ+LQ    + FRI  W   + +I+V+S+L   L YQ +H  F EWRD  T  VYGLHF D + A +F + ++ V   LE
Sbjct:    8 ETPVATARAFVLVFNSEQRTWVPSGGARAISW--VQVLQQKGFDAFRIVGWRQPDNQIVVNSVLKAGLEYQ-SHGQFQEWRDPITLRVYGLHFPDTENAQLFMETVNLVLTKLE 118          
BLAST of WH1 domain-containing protein vs. TrEMBL
Match: H2KS00 (Protein enabled homolog OS=Clonorchis sinensis OX=79923 GN=CLF_107676 PE=4 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 5.056e-16
Identity = 44/114 (38.60%), Postives = 67/114 (58.77%), Query Frame = 3
Query:   78 EVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLE 419
            E P+  A AFV+ +++    WV SG +++++   VQ+LQ    + FRI  W   + +I+V+S+L   L YQ +H  F EWRD  T  VYGLHF D + A +F + ++ V   LE
Sbjct:    8 ETPVATARAFVLVFNSEQRTWVPSGGARAISW--VQVLQQKGFDAFRIVGWRQPDNQIVVNSVLKAGLEYQ-SHGQFQEWRDPITLRVYGLHFPDTENAQLFMETVNLVLTKLE 118          
BLAST of WH1 domain-containing protein vs. TrEMBL
Match: A0A4S2LT78 (WH1 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005030 PE=4 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 5.327e-16
Identity = 44/114 (38.60%), Postives = 67/114 (58.77%), Query Frame = 3
Query:   78 EVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLE 419
            E P+  A AFV+ +++    WV SG  ++++   VQ+LQ    + FRI  W   + +I+V+S+L   L YQ +H  F EWRD  T  VYGLHF DA++A +F   ++ +   LE
Sbjct:    8 ETPVATARAFVLVFNSEQRTWVPSGGVRAISW--VQVLQQKGFDAFRIVGWRQPDNQIVVNSVLKAGLEYQ-SHGQFQEWRDPITLRVYGLHFPDAEDAQLFMKTVNLILTKLE 118          
BLAST of WH1 domain-containing protein vs. TrEMBL
Match: A0A4S2LTA1 (WH1 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005030 PE=4 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 5.330e-16
Identity = 44/114 (38.60%), Postives = 67/114 (58.77%), Query Frame = 3
Query:   78 EVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLE 419
            E P+  A AFV+ +++    WV SG  ++++   VQ+LQ    + FRI  W   + +I+V+S+L   L YQ +H  F EWRD  T  VYGLHF DA++A +F   ++ +   LE
Sbjct:    8 ETPVATARAFVLVFNSEQRTWVPSGGVRAISW--VQVLQQKGFDAFRIVGWRQPDNQIVVNSVLKAGLEYQ-SHGQFQEWRDPITLRVYGLHFPDAEDAQLFMKTVNLILTKLE 118          
BLAST of WH1 domain-containing protein vs. Ensembl Cavefish
Match: enah (ENAH actin regulator [Source:NCBI gene;Acc:103032123])

HSP 1 Score: 77.0258 bits (188), Expect = 3.737e-14
Identity = 44/150 (29.33%), Postives = 77/150 (51.33%), Query Frame = 3
Query:   63 MNRNSEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQCRELQAVIRANTPGDQYGSKSQNLKI 512
            M R+ E  +  A A VM YD+   KWV +G S     ++V +  H   N FR+      + +++++  +   L+Y +A  TFH+WRDA  + VYGL+F   ++A++F    S +  +LE++  Q  +    +    P  Q G   + L++
Sbjct:    1 MTRDVEQSICQARAAVMVYDDANKKWVPAGGS--TGFSRVHIYHHTGNNAFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDA--RQVYGLNFGSKEDANVFA---SAMMHALEVLNSQ--DAGPTLPRQNPQVQNGPSPEELEM 141          
BLAST of WH1 domain-containing protein vs. Ensembl Cavefish
Match: enah (ENAH actin regulator [Source:NCBI gene;Acc:103032123])

HSP 1 Score: 75.8702 bits (185), Expect = 9.247e-14
Identity = 40/126 (31.75%), Postives = 69/126 (54.76%), Query Frame = 3
Query:   57 SEMNRNSEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQ 434
            S+M  + E  +  A A VM YD+   KWV +G S     ++V +  H   N FR+      + +++++  +   L+Y +A  TFH+WRDA  + VYGL+F   ++A++F    S +  +LE++  Q
Sbjct:   24 SKMEAHREQSICQARAAVMVYDDANKKWVPAGGS--TGFSRVHIYHHTGNNAFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDA--RQVYGLNFGSKEDANVFA---SAMMHALEVLNSQ 142          
BLAST of WH1 domain-containing protein vs. Ensembl Cavefish
Match: enah (ENAH actin regulator [Source:NCBI gene;Acc:103032123])

HSP 1 Score: 75.8702 bits (185), Expect = 9.969e-14
Identity = 44/152 (28.95%), Postives = 78/152 (51.32%), Query Frame = 3
Query:   57 SEMNRNSEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQCRELQAVIRANTPGDQYGSKSQNLKI 512
            S+M  + E  +  A A VM YD+   KWV +G S     ++V +  H   N FR+      + +++++  +   L+Y +A  TFH+WRDA  + VYGL+F   ++A++F    S +  +LE++  Q  +    +    P  Q G   + L++
Sbjct:   24 SKMEAHREQSICQARAAVMVYDDANKKWVPAGGS--TGFSRVHIYHHTGNNAFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDA--RQVYGLNFGSKEDANVFA---SAMMHALEVLNSQ--DAGPTLPRQNPQVQNGPSPEELEM 166          
BLAST of WH1 domain-containing protein vs. Ensembl Cavefish
Match: enah (ENAH actin regulator [Source:NCBI gene;Acc:103032123])

HSP 1 Score: 74.3294 bits (181), Expect = 3.221e-13
Identity = 43/146 (29.45%), Postives = 75/146 (51.37%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQCRELQAVIRANTPGDQYGSKSQNLKI 512
            SE  +  A A VM YD+   KWV +G S     ++V +  H   N FR+      + +++++  +   L+Y +A  TFH+WRDA  + VYGL+F   ++A++F    S +  +LE++  Q  +    +    P  Q G   + L++
Sbjct:    2 SEQSICQARAAVMVYDDANKKWVPAGGS--TGFSRVHIYHHTGNNAFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDA--RQVYGLNFGSKEDANVFA---SAMMHALEVLNSQ--DAGPTLPRQNPQVQNGPSPEELEM 138          
BLAST of WH1 domain-containing protein vs. Ensembl Cavefish
Match: enah (ENAH actin regulator [Source:NCBI gene;Acc:103032123])

HSP 1 Score: 73.559 bits (179), Expect = 3.916e-13
Identity = 39/120 (32.50%), Postives = 66/120 (55.00%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQ 434
            SE  +  A A VM YD+   KWV +G S     ++V +  H   N FR+      + +++++  +   L+Y +A  TFH+WRDA  + VYGL+F   ++A++F    S +  +LE++  Q
Sbjct:    2 SEQSICQARAAVMVYDDANKKWVPAGGS--TGFSRVHIYHHTGNNAFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDA--RQVYGLNFGSKEDANVFA---SAMMHALEVLNSQ 114          
BLAST of WH1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006730.1 (pep scaffold:Pmarinus_7.0:GL476423:313891:330988:1 gene:ENSPMAG00000006060.1 transcript:ENSPMAT00000006730.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.633 bits (174), Expect = 2.545e-13
Identity = 36/115 (31.30%), Postives = 64/115 (55.65%), Query Frame = 3
Query:   72 NSEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSL 416
            +SE  +  A A VM YD+   KW+ SG  +  +  +V +  H + N FR+      +++++++  L   L+Y +A   FH+WRDA  + VYGL+F   ++A++F + I     +L
Sbjct:    1 HSEQSICQARAQVMVYDDANKKWLPSGGQQGFS--RVHIYHHTSLNTFRVVGRRMQDQQVVINCSLSKGLKYNQATPMFHQWRDA--RQVYGLNFGSKEDANVFANGIMHALDAL 111          
BLAST of WH1 domain-containing protein vs. Ensembl Sea Lamprey
Match: SPRED2 (sprouty related EVH1 domain containing 2 [Source:HGNC Symbol;Acc:HGNC:17722])

HSP 1 Score: 51.2174 bits (121), Expect = 6.416e-7
Identity = 35/118 (29.66%), Postives = 53/118 (44.92%), Query Frame = 3
Query:   69 RNSEVPLVAADAFVMYYDNLLGKWV--ASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSL 416
            R+SE  +V   A VM  D+  G WV  A G    V + KV   +    N+F I      +K +++  +L  ++ Y K    FH W+  D Q  +GL F    +A  F   + K  + L
Sbjct:    3 RDSENYIVRVRAVVMTRDDSTGGWVPLAGGGISRVGIYKVLHHEETGRNEFLILGERLKDKLVVLECVLKKDVVYNKVTPIFHHWK-IDEQ-KFGLTFQSPADARAFDRGVRKAIEDL 118          
BLAST of WH1 domain-containing protein vs. Ensembl Nematostella
Match: EDO41208 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4T4])

HSP 1 Score: 73.9442 bits (180), Expect = 9.996e-16
Identity = 38/115 (33.04%), Postives = 61/115 (53.04%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLE 419
            SE  +  A A VM Y+N   +W  SG S+ ++  +V +  H   N FRI      +  ++++  L   L+Y +A  TFH+WR  D + VYGL+F    EA +FG  +    ++L+
Sbjct:    2 SEHSIAQARASVMLYNNEAKQWAPSGGSQGIS--RVHVYHHPVNNTFRIVGRKMADHAVVINCALAKGLKYNEATPTFHQWR--DQRQVYGLNFQSKDEADLFGQAVRDALETLK 112          
BLAST of WH1 domain-containing protein vs. Ensembl Medaka
Match: enah (ENAH actin regulator [Source:NCBI gene;Acc:105357991])

HSP 1 Score: 74.7146 bits (182), Expect = 2.088e-13
Identity = 39/120 (32.50%), Postives = 66/120 (55.00%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQ 434
            SE  +  A A VM YD+   KWV +G S     ++V +  H   N FR+      + +++++  +   L+Y +A  TFH+WRDA  + VYGL+F   ++A++F    S +  +LE++  Q
Sbjct:    2 SEQSICQARAAVMVYDDANKKWVPAGGS--TGFSRVHIYHHTGNNAFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDA--RQVYGLNFGSKEDANVFA---SAMMHALEVLISQ 114          
BLAST of WH1 domain-containing protein vs. Ensembl Medaka
Match: enah (ENAH actin regulator [Source:NCBI gene;Acc:105357991])

HSP 1 Score: 74.7146 bits (182), Expect = 2.131e-13
Identity = 39/121 (32.23%), Postives = 66/121 (54.55%), Query Frame = 3
Query:   72 NSEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQ 434
             SE  +  A A VM YD+   KWV +G S   +  +V +  H   N FR+      + +++++  +   L+Y +A  TFH+WRDA  + VYGL+F   ++A++F    S +  +LE++  Q
Sbjct:  102 RSEQSICQARAAVMVYDDANKKWVPAGGSTGFS--RVHIYHHTGNNAFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDA--RQVYGLNFGSKEDANVFA---SAMMHALEVLISQ 215          
BLAST of WH1 domain-containing protein vs. Ensembl Medaka
Match: enah (ENAH actin regulator [Source:NCBI gene;Acc:105357991])

HSP 1 Score: 74.7146 bits (182), Expect = 2.490e-13
Identity = 39/121 (32.23%), Postives = 66/121 (54.55%), Query Frame = 3
Query:   72 NSEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQ 434
             SE  +  A A VM YD+   KWV +G S     ++V +  H   N FR+      + +++++  +   L+Y +A  TFH+WRDA  + VYGL+F   ++A++F    S +  +LE++  Q
Sbjct:  102 RSEQSICQARAAVMVYDDANKKWVPAGGS--TGFSRVHIYHHTGNNAFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDA--RQVYGLNFGSKEDANVFA---SAMMHALEVLISQ 215          
BLAST of WH1 domain-containing protein vs. Ensembl Medaka
Match: enah (ENAH actin regulator [Source:NCBI gene;Acc:105357991])

HSP 1 Score: 74.3294 bits (181), Expect = 2.712e-13
Identity = 39/124 (31.45%), Postives = 67/124 (54.03%), Query Frame = 3
Query:   63 MNRNSEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQ 434
            M  + E  +  A A VM YD+   KWV +G S   +  +V +  H   N FR+      + +++++  +   L+Y +A  TFH+WRDA  + VYGL+F   ++A++F    S +  +LE++  Q
Sbjct:    1 MEVHREQSICQARAAVMVYDDANKKWVPAGGSTGFS--RVHIYHHTGNNAFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDA--RQVYGLNFGSKEDANVFA---SAMMHALEVLISQ 117          
BLAST of WH1 domain-containing protein vs. Ensembl Medaka
Match: evlb (ena/VASP-like protein [Source:NCBI gene;Acc:101159062])

HSP 1 Score: 63.929 bits (154), Expect = 2.100e-10
Identity = 33/107 (30.84%), Postives = 59/107 (55.14%), Query Frame = 3
Query:   75 SEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVI 395
            SE  +  A A VM YD+   KWV     +    +++ +  +  +N FR+      +++++++  +   L+Y +A  TFH+WRDA  + VYGL+FA  +EA  F + +
Sbjct:    2 SEQSICQARASVMVYDDTSKKWVPIKPGQQ-GFSRINIYHNTASNTFRVVGVKLQDQQVVINYSIVKGLKYNQATPTFHQWRDA--RQVYGLNFASKEEATTFSNAM 105          
BLAST of WH1 domain-containing protein vs. Planmine SMEST
Match: SMESG000069908.1 (SMESG000069908.1)

HSP 1 Score: 1151.35 bits (2977), Expect = 0.000e+0
Identity = 578/581 (99.48%), Postives = 578/581 (99.48%), Query Frame = 3
Query:   63 MNRNSEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQCRELQAVIRANTPGDQYGSKSQNLKIDIQPNFNTNLTSNSVLCEMKSNEHFTTSPPVNIAPFKPIQKSIFLSNYSPNPTSEHSISFGSSPSNNFDFNNTHIDLDTQDLPNYENINNILLKHSEMKSLSIGSENLEF-SNRCQSSSDDSVRGLKRQPSSASSGYATVASIADQYSPTPGLTSSFAMVAEALNKSICDSKSQVQSYLDYSNSDTVHESNVQIDEPVQSAFASQLQNLIQLRKQSNNPGLTKQDSIGNFNRRPEVNQKYCDATVEAVTNNKDVQTYSSPKVKPVDDIMSEMRIKLQRRKQLIDGHTDPNYSSSTEKXXXXXXXXXXXXXXXXNADNSIDNKINSIKLSSTLDTQFGRNVAFDSIKSNKVLLEDDEKSSHLLEEMRDTPKNMNRLKKRSAGDIMQITTSSSMLASKDDLNRIKQEITNDFRRELLGVKKEVVDAIRFHQNV 1802
            MNRNSEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQCRELQAVIRANTPGDQYGSKSQNLKIDIQPNFNTNLTSNSVLCEMKSNEHFTTSPPVNIAPFKPIQKSIFLSNYSPNPTSEHSISFGSSPSNNFDFNNTHIDLDTQDLPNYENINNILLKHSEMKSLSIGSENLEF SNRCQSSSDDSVRGLKRQPSSASSGYATVASIADQYSPTPGLTSSFAMVAEALNKSICDSKSQVQSYLDYSNSDTVHESNVQIDEPVQSAFASQLQNLIQLRKQSNNPGLTKQDSIGNFNRRPEVNQKYCDATVEAVTNNKDVQTYSSPKVKPVDDIMSEMRIKLQRRKQLIDGHTDPNYSSSTEKSDVCSSSASDAGSFVSNADNSIDNKINSIKLSSTLDTQFGRNV FDSIKSNKVLLEDDEKSS LLEEMRDTPKNMNRLKKRSAGDIMQITTSSSMLASKDDLNRIKQEITNDFRRELLGVKKEVVDAIRFHQNV
Sbjct:    1 MNRNSEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQCRELQAVIRANTPGDQYGSKSQNLKIDIQPNFNTNLTSNSVLCEMKSNEHFTTSPPVNIAPFKPIQKSIFLSNYSPNPTSEHSISFGSSPSNNFDFNNTHIDLDTQDLPNYENINNILLKHSEMKSLSIGSENLEFSSNRCQSSSDDSVRGLKRQPSSASSGYATVASIADQYSPTPGLTSSFAMVAEALNKSICDSKSQVQSYLDYSNSDTVHESNVQIDEPVQSAFASQLQNLIQLRKQSNNPGLTKQDSIGNFNRRPEVNQKYCDATVEAVTNNKDVQTYSSPKVKPVDDIMSEMRIKLQRRKQLIDGHTDPNYSSSTEKSDVCSSSASDAGSFVSNADNSIDNKINSIKLSSTLDTQFGRNVTFDSIKSNKVLLEDDEKSSQLLEEMRDTPKNMNRLKKRSAGDIMQITTSSSMLASKDDLNRIKQEITNDFRRELLGVKKEVVDAIRFHQNV 581          
BLAST of WH1 domain-containing protein vs. Planmine SMEST
Match: SMESG000069908.1 (SMESG000069908.1)

HSP 1 Score: 1108.98 bits (2867), Expect = 0.000e+0
Identity = 563/581 (96.90%), Postives = 563/581 (96.90%), Query Frame = 3
Query:   63 MNRNSEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQCRELQAVIRANTPGDQYGSKSQNLKIDIQPNFNTNLTSNSVLCEMKSNEHFTTSPPVNIAPFKPIQKSIFLSNYSPNPTSEHSISFGSSPSNNFDFNNTHIDLDTQDLPNYENINNILLKHSEMKSLSIGSENLEF-SNRCQSSSDDSVRGLKRQPSSASSGYATVASIADQYSPTPGLTSSFAMVAEALNKSICDSKSQVQSYLDYSNSDTVHESNVQIDEPVQSAFASQLQNLIQLRKQSNNPGLTKQDSIGNFNRRPEVNQKYCDATVEAVTNNKDVQTYSSPKVKPVDDIMSEMRIKLQRRKQLIDGHTDPNYSSSTEKXXXXXXXXXXXXXXXXNADNSIDNKINSIKLSSTLDTQFGRNVAFDSIKSNKVLLEDDEKSSHLLEEMRDTPKNMNRLKKRSAGDIMQITTSSSMLASKDDLNRIKQEITNDFRRELLGVKKEVVDAIRFHQNV 1802
            MNRNSEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQCRELQAVIRANTPGDQYGSKSQNLKIDIQPNFNTNLTSNSVLCEMKSNEHFTTSPPVNIAPFKPIQKSIFLSNYSPNPTSEHSISF               DLDTQDLPNYENINNILLKHSEMKSLSIGSENLEF SNRCQSSSDDSVRGLKRQPSSASSGYATVASIADQYSPTPGLTSSFAMVAEALNKSICDSKSQVQSYLDYSNSDTVHESNVQIDEPVQSAFASQLQNLIQLRKQSNNPGLTKQDSIGNFNRRPEVNQKYCDATVEAVTNNKDVQTYSSPKVKPVDDIMSEMRIKLQRRKQLIDGHTDPNYSSSTEKSDVCSSSASDAGSFVSNADNSIDNKINSIKLSSTLDTQFGRNV FDSIKSNKVLLEDDEKSS LLEEMRDTPKNMNRLKKRSAGDIMQITTSSSMLASKDDLNRIKQEITNDFRRELLGVKKEVVDAIRFHQNV
Sbjct:    1 MNRNSEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQQCRELQAVIRANTPGDQYGSKSQNLKIDIQPNFNTNLTSNSVLCEMKSNEHFTTSPPVNIAPFKPIQKSIFLSNYSPNPTSEHSISF---------------DLDTQDLPNYENINNILLKHSEMKSLSIGSENLEFSSNRCQSSSDDSVRGLKRQPSSASSGYATVASIADQYSPTPGLTSSFAMVAEALNKSICDSKSQVQSYLDYSNSDTVHESNVQIDEPVQSAFASQLQNLIQLRKQSNNPGLTKQDSIGNFNRRPEVNQKYCDATVEAVTNNKDVQTYSSPKVKPVDDIMSEMRIKLQRRKQLIDGHTDPNYSSSTEKSDVCSSSASDAGSFVSNADNSIDNKINSIKLSSTLDTQFGRNVTFDSIKSNKVLLEDDEKSSQLLEEMRDTPKNMNRLKKRSAGDIMQITTSSSMLASKDDLNRIKQEITNDFRRELLGVKKEVVDAIRFHQNV 566          
BLAST of WH1 domain-containing protein vs. Planmine SMEST
Match: SMESG000069908.1 (SMESG000069908.1)

HSP 1 Score: 115.161 bits (287), Expect = 1.026e-30
Identity = 57/63 (90.48%), Postives = 59/63 (93.65%), Query Frame = 3
Query: 1614 PKNMNRLKKRSAGDIMQITTSSSMLASKDDLNRIKQEITNDFRRELLGVKKEVVDAIRFHQNV 1802
            P  +  L+KRSAGDIMQITTSSSMLASKDDLNRIKQEITNDFRRELLGVKKEVVDAIRFHQNV
Sbjct:    5 PLCVRDLRKRSAGDIMQITTSSSMLASKDDLNRIKQEITNDFRRELLGVKKEVVDAIRFHQNV 67          
BLAST of WH1 domain-containing protein vs. Planmine SMEST
Match: SMESG000063850.1 (SMESG000063850.1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.086e-21
Identity = 44/118 (37.29%), Postives = 72/118 (61.02%), Query Frame = 3
Query:   78 EVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELIYQ 431
            E P+  A A VM +D +   WVASG+++ ++  KVQL +H   N +R+  W   +KE++++  ++  L+Y +A  TFH+WRD   Q VYGL+F + +EA  F   I +  ++L  IY+
Sbjct:    3 EKPVATARASVMLFDAVTNSWVASGSTQGIS--KVQLFRHQLNNTYRVVGWKLNDKEVVLNCAIFRGLKYNQARPTFHQWRDTKHQ-VYGLNFTNKEEAEQFAAAILEALENLNQIYR 117          
BLAST of WH1 domain-containing protein vs. Planmine SMEST
Match: SMESG000052345.1 (SMESG000052345.1)

HSP 1 Score: 67.3958 bits (163), Expect = 1.548e-11
Identity = 35/116 (30.17%), Postives = 63/116 (54.31%), Query Frame = 3
Query:   78 EVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQFRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFADAKEAHMFGDVISKVFQSLELI 425
            E P+V A   V+ Y    G+W   G+ K   V  + + +   +N++R  +W   ++E++++S L+  + Y +   TFH+W D +++  YGL+F D  EA  FG     V  +LE++
Sbjct:    2 EQPIVQATVIVLKYSLSTGQWEELGSQKGTCV--ISIFKS-PSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYD-ESKSAYGLNFTDPNEAKKFGIA---VVSALEIL 110          
The following BLAST results are available for this feature:
BLAST of WH1 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENAH1.670e-1332.50ENAH actin regulator [Source:HGNC Symbol;Acc:HGNC:... [more]
ENAH5.054e-1332.50ENAH actin regulator [Source:HGNC Symbol;Acc:HGNC:... [more]
ENAH5.276e-1332.50ENAH actin regulator [Source:HGNC Symbol;Acc:HGNC:... [more]
ENAH5.442e-1332.50ENAH actin regulator [Source:HGNC Symbol;Acc:HGNC:... [more]
EVL1.176e-1030.84Enah/Vasp-like [Source:HGNC Symbol;Acc:HGNC:20234][more]
back to top
BLAST of WH1 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
unc-346.714e-1031.03UNC-34 [Source:UniProtKB/TrEMBL;Acc:G5EG53][more]
unc-341.445e-931.03UNC-34 [Source:UniProtKB/TrEMBL;Acc:G5EG53][more]
unc-348.199e-930.84UNC-34 [Source:UniProtKB/TrEMBL;Acc:G5EG53][more]
unc-341.756e-729.81UNC-34 [Source:UniProtKB/TrEMBL;Acc:G5EG53][more]
back to top
BLAST of WH1 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ena7.489e-1532.84gene:FBgn0000578 transcript:FBtr0340450[more]
ena7.861e-1532.84gene:FBgn0000578 transcript:FBtr0100174[more]
ena8.536e-1532.84gene:FBgn0000578 transcript:FBtr0086582[more]
ena8.536e-1532.84gene:FBgn0000578 transcript:FBtr0100176[more]
ena8.536e-1532.84gene:FBgn0000578 transcript:FBtr0086583[more]
back to top
BLAST of WH1 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
enah2.952e-1430.14ENAH actin regulator [Source:ZFIN;Acc:ZDB-GENE-010... [more]
enah4.543e-1429.61ENAH actin regulator [Source:ZFIN;Acc:ZDB-GENE-010... [more]
enah3.252e-1330.14ENAH actin regulator [Source:ZFIN;Acc:ZDB-GENE-010... [more]
enah1.347e-1131.48ENAH actin regulator [Source:ZFIN;Acc:ZDB-GENE-010... [more]
vaspa1.621e-1129.66vasodilator stimulated phosphoprotein a [Source:ZF... [more]
back to top
BLAST of WH1 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
neu16.023e-1437.00neuraminidase 1 (lysosomal sialidase) [Source:Xenb... [more]
sorbs23.432e-1332.50sorbin and SH3 domain containing 2 [Source:Xenbase... [more]
sorbs24.019e-1332.50sorbin and SH3 domain containing 2 [Source:Xenbase... [more]
sorbs25.497e-1332.50sorbin and SH3 domain containing 2 [Source:Xenbase... [more]
sorbs25.874e-1331.90sorbin and SH3 domain containing 2 [Source:Xenbase... [more]
back to top
BLAST of WH1 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Enah2.573e-1332.50ENAH actin regulator [Source:MGI Symbol;Acc:MGI:10... [more]
Enah2.934e-1332.79ENAH actin regulator [Source:MGI Symbol;Acc:MGI:10... [more]
Enah3.086e-1332.50ENAH actin regulator [Source:MGI Symbol;Acc:MGI:10... [more]
Enah3.089e-1332.50ENAH actin regulator [Source:MGI Symbol;Acc:MGI:10... [more]
Enah3.555e-1332.50ENAH actin regulator [Source:MGI Symbol;Acc:MGI:10... [more]
back to top
BLAST of WH1 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8T4F7|ENA_DROME2.012e-1334.21Protein enabled OS=Drosophila melanogaster OX=7227... [more]
sp|Q03173|ENAH_MOUSE1.722e-1232.50Protein enabled homolog OS=Mus musculus OX=10090 G... [more]
sp|Q8N8S7|ENAH_HUMAN2.427e-1232.50Protein enabled homolog OS=Homo sapiens OX=9606 GN... [more]
sp|Q64GL0|EVL_XENLA4.802e-1031.78Ena/VASP-like protein OS=Xenopus laevis OX=8355 GN... [more]
sp|P50551|VASP_CANLF5.768e-1029.81Vasodilator-stimulated phosphoprotein OS=Canis lup... [more]
back to top
BLAST of WH1 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NI702.569e-1836.97Enabled OS=Paragonimus westermani OX=34504 GN=DEA3... [more]
A0A419QAE25.056e-1638.60Protein enabled-like protein OS=Clonorchis sinensi... [more]
H2KS005.056e-1638.60Protein enabled homolog OS=Clonorchis sinensis OX=... [more]
A0A4S2LT785.327e-1638.60WH1 domain-containing protein OS=Opisthorchis feli... [more]
A0A4S2LTA15.330e-1638.60WH1 domain-containing protein OS=Opisthorchis feli... [more]
back to top
BLAST of WH1 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
enah3.737e-1429.33ENAH actin regulator [Source:NCBI gene;Acc:1030321... [more]
enah9.247e-1431.75ENAH actin regulator [Source:NCBI gene;Acc:1030321... [more]
enah9.969e-1428.95ENAH actin regulator [Source:NCBI gene;Acc:1030321... [more]
enah3.221e-1329.45ENAH actin regulator [Source:NCBI gene;Acc:1030321... [more]
enah3.916e-1332.50ENAH actin regulator [Source:NCBI gene;Acc:1030321... [more]
back to top
BLAST of WH1 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000006730.12.545e-1331.30pep scaffold:Pmarinus_7.0:GL476423:313891:330988:1... [more]
SPRED26.416e-729.66sprouty related EVH1 domain containing 2 [Source:H... [more]
back to top
BLAST of WH1 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WH1 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO412089.996e-1633.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WH1 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
enah2.088e-1332.50ENAH actin regulator [Source:NCBI gene;Acc:1053579... [more]
enah2.131e-1332.23ENAH actin regulator [Source:NCBI gene;Acc:1053579... [more]
enah2.490e-1332.23ENAH actin regulator [Source:NCBI gene;Acc:1053579... [more]
enah2.712e-1331.45ENAH actin regulator [Source:NCBI gene;Acc:1053579... [more]
evlb2.100e-1030.84ena/VASP-like protein [Source:NCBI gene;Acc:101159... [more]
back to top
BLAST of WH1 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069908.10.000e+099.48SMESG000069908.1[more]
SMESG000069908.10.000e+096.90SMESG000069908.1[more]
SMESG000069908.11.026e-3090.48SMESG000069908.1[more]
SMESG000063850.11.086e-2137.29SMESG000063850.1[more]
SMESG000052345.11.548e-1130.17SMESG000052345.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032229 ID=SMED30032229|Name=WH1 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2273bp
CCGATCTCTTCAAGATAAAAAATGTAAATGTATTTTTAAAAATATAATTT
GAAATTAGTGAAATGAATAGAAACAGTGAAGTTCCGCTTGTAGCAGCTGA
TGCATTTGTTATGTATTATGATAACTTACTTGGAAAATGGGTTGCAAGTG
GTGCTTCTAAATCCGTCACTGTTGCTAAAGTGCAGTTACTACAACATCTT
ACGACAAATCAATTTAGGATATTTGCTTGGAATCCCATAAATAAAGAGAT
ACTAGTCAGCTCTATTCTTTATTACAATTTACGTTATCAAAAAGCTCATG
CTACATTTCATGAGTGGCGAGATGCGGACACTCAACTGGTTTACGGACTT
CATTTTGCAGATGCAAAGGAAGCTCACATGTTTGGTGATGTTATTTCAAA
GGTGTTTCAATCACTAGAATTAATTTATCAGCAATGTCGAGAACTGCAAG
CAGTTATAAGAGCCAATACTCCTGGCGATCAGTATGGCAGTAAAAGTCAA
AATCTGAAAATAGACATTCAACCAAATTTTAATACCAACTTAACATCCAA
CTCAGTTCTCTGTGAAATGAAATCAAATGAACATTTTACCACTAGTCCAC
CAGTTAATATTGCACCTTTCAAACCTATTCAGAAATCAATATTCTTGTCT
AACTATTCACCAAATCCCACATCTGAGCATTCCATATCCTTTGGTAGTTC
TCCCAGCAATAATTTCGATTTCAACAACACACATATAGATCTCGACACTC
AAGACCTGCCAAATTATGAAAATATAAACAATATCCTACTAAAACATTCA
GAAATGAAATCTCTGTCGATTGGTTCAGAAAACCTTGAATTTAGCAATAG
ATGCCAATCATCGTCCGATGATAGTGTCCGAGGTCTCAAACGTCAGCCAT
CTTCAGCAAGCAGTGGTTATGCTACTGTTGCCAGTATCGCTGATCAGTAT
TCTCCAACGCCTGGTCTTACATCCTCCTTCGCTATGGTAGCTGAAGCTCT
CAACAAAAGCATTTGTGATTCTAAAAGCCAAGTTCAGAGTTATTTAGATT
ATTCAAATTCTGATACAGTACACGAATCAAATGTGCAAATAGATGAACCT
GTGCAATCAGCATTTGCTTCACAATTGCAAAACTTAATACAATTAAGAAA
ACAGAGCAATAACCCAGGACTTACTAAACAAGATTCTATTGGCAATTTCA
ACAGACGTCCAGAAGTCAATCAAAAATATTGCGATGCAACAGTTGAAGCT
GTCACAAACAATAAAGATGTACAAACTTACAGTTCACCTAAAGTCAAACC
GGTTGATGATATCATGTCAGAAATGAGAATAAAGTTACAACGGCGTAAGC
AACTGATTGATGGCCATACTGATCCAAATTATTCTTCTTCGACTGAAAAA
TCTGATGTATGTAGTAGCAGTGCCAGTGACGCTGGATCTTTTGTCAGTAA
CGCAGACAATTCAATCGACAATAAAATTAATTCAATTAAACTCTCTTCTA
CTCTCGATACTCAGTTTGGCAGAAATGTAGCGTTTGATAGTATTAAATCC
AATAAAGTGCTGCTCGAGGATGATGAAAAATCTTCACACTTGTTGGAAGA
AATGAGAGACACGCCTAAAAATATGAATCGTTTGAAGAAACGTTCAGCCG
GTGATATTATGCAAATAACGACTTCATCTTCGATGTTAGCATCTAAAGAT
GATCTCAATCGTATTAAACAAGAAATTACAAATGATTTTCGCAGAGAGTT
ATTGGGTGTTAAGAAAGAAGTTGTAGATGCTATTCGGTTTCATCAGAATG
TATCCTCATGACATTATATATTATATATTTTATTGATACCTTATTCAAGA
GCCTGTATATTTCATTGTAATTCTTTTCCCATGGACATGTATATATATAT
TTATGCTTTGTTTTGCATCGTAATTTTATCTGATAGCTGCTTAAACATTT
ATTCAATTAGTCCCTCAACCGTACCATGCTCAATTACTTGACACTCTTTA
TTTCTAAACACAAACCAGAATTTCACTTTAGATAATTCGATTTTCGGATT
TTTCTTTTATTAAAAAAATTTTGGTATTGGATTTCTTTTCTCCGGACCGT
AAATTCTATTTGTACTTCATCGAAATGAAAACGATTAAACATAAATTTAG
AATGGAGTTTTTCCGCAATTTCTTTTTTTGCTTAGATTATCTGTATGCCT
GTTATGTGAAATTAAGTACGATTGTTTTATTAAATTTTATTATTTGCTGT
GATTATTATTATTATTATTATTA
back to top

protein sequence of SMED30032229-orf-1

>SMED30032229-orf-1 ID=SMED30032229-orf-1|Name=SMED30032229-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=583bp
MNRNSEVPLVAADAFVMYYDNLLGKWVASGASKSVTVAKVQLLQHLTTNQ
FRIFAWNPINKEILVSSILYYNLRYQKAHATFHEWRDADTQLVYGLHFAD
AKEAHMFGDVISKVFQSLELIYQQCRELQAVIRANTPGDQYGSKSQNLKI
DIQPNFNTNLTSNSVLCEMKSNEHFTTSPPVNIAPFKPIQKSIFLSNYSP
NPTSEHSISFGSSPSNNFDFNNTHIDLDTQDLPNYENINNILLKHSEMKS
LSIGSENLEFSNRCQSSSDDSVRGLKRQPSSASSGYATVASIADQYSPTP
GLTSSFAMVAEALNKSICDSKSQVQSYLDYSNSDTVHESNVQIDEPVQSA
FASQLQNLIQLRKQSNNPGLTKQDSIGNFNRRPEVNQKYCDATVEAVTNN
KDVQTYSSPKVKPVDDIMSEMRIKLQRRKQLIDGHTDPNYSSSTEKSDVC
SSSASDAGSFVSNADNSIDNKINSIKLSSTLDTQFGRNVAFDSIKSNKVL
LEDDEKSSHLLEEMRDTPKNMNRLKKRSAGDIMQITTSSSMLASKDDLNR
IKQEITNDFRRELLGVKKEVVDAIRFHQNVSS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0008154actin polymerization or depolymerization
GO:0090502RNA phosphodiester bond hydrolysis, endonucleolytic
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR042180IF_rod_dom_coil1B
IPR038023VASP_sf
IPR000697WH1/EVH1_dom
IPR014885VASP_tetra
IPR011993PH-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0033897ribonuclease T2 activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000697WH1/EVH1 domainSMARTSM00461WH1_2coord: 4..115
e-value: 2.5E-15
score: 67.0
IPR000697WH1/EVH1 domainPFAMPF00568WH1coord: 7..112
e-value: 8.9E-14
score: 51.4
IPR000697WH1/EVH1 domainPROSITEPS50229WH1coord: 1..118
score: 16.815
IPR042180Intermediate filament, rod domain, coil 1BGENE3DG3DSA:1.20.5.1160coord: 542..578
e-value: 1.6E-6
score: 29.3
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 4..127
e-value: 1.3E-21
score: 78.6
IPR014885VASP tetramerisationPFAMPF08776VASP_tetracoord: 546..575
e-value: 1.2E-5
score: 24.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 264..284
NoneNo IPR availablePANTHERPTHR11202VASODILATOR-STIMULATED PHOSPHOPROTEIN/SPROUTY PROTEIN EVH1 DOMAIN CONTAINING PROTEIN 3coord: 6..575
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 6..118
IPR038023VASP tetramerisation domain superfamilySUPERFAMILYSSF118370Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domaincoord: 545..575