SCY1-like protein 2

Overview
NameSCY1-like protein 2
Smed IDSMED30032216
Length (bp)2774
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SCY1-like protein 2 (SMED30032216) t-SNE clustered cells

Violin plots show distribution of expression levels for SCY1-like protein 2 (SMED30032216) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SCY1-like protein 2 (SMED30032216) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SCY1-like protein 2 (SMED30032216) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of SCY1-like protein 2 vs. Ensembl Human
Match: SCYL2 (SCY1 like pseudokinase 2 [Source:HGNC Symbol;Acc:HGNC:19286])

HSP 1 Score: 210.69 bits (535), Expect = 4.894e-57
Identity = 154/617 (24.96%), Postives = 295/617 (47.81%), Query Frame = 2
Query:   53 SLTTKISDSSINIKQSFNVQLITNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSN--SQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIY------IEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEF-RPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQEKID----SLQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKEY 1864
            S+  K+  +   +       ++ NP+ + F +     S G  L W+IF  T+    +E +VF F+KKL +K  K  + +I+ + L++ +Q L+ + H +LL V HPLEE+ D +AF TE +  SL+N+LGN   +      ++    + +   K+G+ Q+ E L +L++S++  H N +P  I++    +WK+ G  F    +N   Q   F    W   LP +  PN +Y+APE  L  +    SDM+SLG V+ +V++K     I     Q IY      +++++RLG         +PEE+R+ V+ +L+     RP+    + + +F+D   + L+    +  +   ++ +    L  +  ++P+ ++ + +   L +   N +   F  P + L+AE           E     ++  +  +   QE I      LQ +++L  K   D ++N ++P V+  LE     IQ     ++   +   +   + + L+          ++ +V+ + L CL  +++ LD   +   ILPFL +I    P VL+  L + K     +   IT + +A +++  L+P ++   L + +F S +  +  ML +++ E+
Sbjct:    3 SMLNKLKSTVTKVTADVTSAVMGNPVTREFDVGRHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKLIDKYQKFEKDQII-DSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWENLPSPISPDIKDYKLYDVETKYGLLQVSEGLSFLHSSVKMVHGNITPENIILNKSGAWKIMGFDFCVSSTNPSEQEPKFPCKEWDPNLPSLCLPNPEYLAPEYILSVSCETASDMYSLGTVMYAVFNK--GKPIFEVNKQDIYKSFSRQLDQLSRLG---SSSLTNIPEEVREHVKLLLNVTPTVRPDADQMTKIPFFDDVGAVTLQYFDTLFQRDNLQKSQFFKGLPKVLPKLPKRVIVQRILPCLTSEFVNPDMVPFVLPNVLLIAE-------ECTKEEYVKLILPELGPVFKQQEPIQILLIFLQKMDLLLTKTPPDEIKNSVLPMVYRALEAPSIQIQELCLNIIPTFANLIDYPSMKNALIPRIKNACLQTSSLAVRVNSLVCLGKILEYLDKWFVLDDILPFLQQIPSKEPAVLMGILGIYKCTFTHKKLGITKEQLAGKVLPHLIPLSIENNLNLNQFNSFISVIKEMLNRLESEH 606          
BLAST of SCY1-like protein 2 vs. Ensembl Human
Match: SCYL2 (SCY1 like pseudokinase 2 [Source:HGNC Symbol;Acc:HGNC:19286])

HSP 1 Score: 213.001 bits (541), Expect = 1.359e-56
Identity = 154/621 (24.80%), Postives = 296/621 (47.67%), Query Frame = 2
Query:   53 SLTTKISDSSINIKQSFNVQLITNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSN--SQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIY------IEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEF-RPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQEKIDS--------LQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKEY 1864
            S+  K+  +   +       ++ NP+ + F +     S G  L W+IF  T+    +E +VF F+KKL +K  K  + +I+ + L++ +Q L+ + H +LL V HPLEE+ D +AF TE +  SL+N+LGN   +      ++    + +   K+G+ Q+ E L +L++S++  H N +P  I++    +WK+ G  F    +N   Q   F    W   LP +  PN +Y+APE  L  +    SDM+SLG V+ +V++K     I     Q IY      +++++RLG         +PEE+R+ V+ +L+     RP+    + + +F+D   + L+    +  +   ++ +    L  +  ++P+ ++ + +   L +   N +   F  P + L+AE           E     ++  +  +   QE I +        LQ +++L  K   D ++N ++P V+  LE     IQ     ++   +   +   + + L+          ++ +V+ + L CL  +++ LD   +   ILPFL +I    P VL+  L + K     +   IT + +A +++  L+P ++   L + +F S +  +  ML +++ E+
Sbjct:    3 SMLNKLKSTVTKVTADVTSAVMGNPVTREFDVGRHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKLIDKYQKFEKDQII-DSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWENLPSPISPDIKDYKLYDVETKYGLLQVSEGLSFLHSSVKMVHGNITPENIILNKSGAWKIMGFDFCVSSTNPSEQEPKFPCKEWDPNLPSLCLPNPEYLAPEYILSVSCETASDMYSLGTVMYAVFNK--GKPIFEVNKQDIYKSFSRQLDQLSRLG---SSSLTNIPEEVREHVKLLLNVTPTVRPDADQMTKIPFFDDVGAVTLQYFDTLFQRDNLQKSQFFKGLPKVLPKLPKRVIVQRILPCLTSEFVNPDMVPFVLPNVLLIAE-------ECTKEEYVKLILPELGPVFKQQEPIQASNMILLIFLQKMDLLLTKTPPDEIKNSVLPMVYRALEAPSIQIQELCLNIIPTFANLIDYPSMKNALIPRIKNACLQTSSLAVRVNSLVCLGKILEYLDKWFVLDDILPFLQQIPSKEPAVLMGILGIYKCTFTHKKLGITKEQLAGKVLPHLIPLSIENNLNLNQFNSFISVIKEMLNRLESEH 610          
BLAST of SCY1-like protein 2 vs. Ensembl Human
Match: SCYL2 (SCY1 like pseudokinase 2 [Source:HGNC Symbol;Acc:HGNC:19286])

HSP 1 Score: 212.616 bits (540), Expect = 1.664e-56
Identity = 154/617 (24.96%), Postives = 295/617 (47.81%), Query Frame = 2
Query:   53 SLTTKISDSSINIKQSFNVQLITNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSN--SQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIY------IEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEF-RPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQEKID----SLQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKEY 1864
            S+  K+  +   +       ++ NP+ + F +     S G  L W+IF  T+    +E +VF F+KKL +K  K  + +I+ + L++ +Q L+ + H +LL V HPLEE+ D +AF TE +  SL+N+LGN   +      ++    + +   K+G+ Q+ E L +L++S++  H N +P  I++    +WK+ G  F    +N   Q   F    W   LP +  PN +Y+APE  L  +    SDM+SLG V+ +V++K     I     Q IY      +++++RLG         +PEE+R+ V+ +L+     RP+    + + +F+D   + L+    +  +   ++ +    L  +  ++P+ ++ + +   L +   N +   F  P + L+AE           E     ++  +  +   QE I      LQ +++L  K   D ++N ++P V+  LE     IQ     ++   +   +   + + L+          ++ +V+ + L CL  +++ LD   +   ILPFL +I    P VL+  L + K     +   IT + +A +++  L+P ++   L + +F S +  +  ML +++ E+
Sbjct:    3 SMLNKLKSTVTKVTADVTSAVMGNPVTREFDVGRHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKLIDKYQKFEKDQII-DSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWENLPSPISPDIKDYKLYDVETKYGLLQVSEGLSFLHSSVKMVHGNITPENIILNKSGAWKIMGFDFCVSSTNPSEQEPKFPCKEWDPNLPSLCLPNPEYLAPEYILSVSCETASDMYSLGTVMYAVFNK--GKPIFEVNKQDIYKSFSRQLDQLSRLG---SSSLTNIPEEVREHVKLLLNVTPTVRPDADQMTKIPFFDDVGAVTLQYFDTLFQRDNLQKSQFFKGLPKVLPKLPKRVIVQRILPCLTSEFVNPDMVPFVLPNVLLIAE-------ECTKEEYVKLILPELGPVFKQQEPIQILLIFLQKMDLLLTKTPPDEIKNSVLPMVYRALEAPSIQIQELCLNIIPTFANLIDYPSMKNALIPRIKNACLQTSSLAVRVNSLVCLGKILEYLDKWFVLDDILPFLQQIPSKEPAVLMGILGIYKCTFTHKKLGITKEQLAGKVLPHLIPLSIENNLNLNQFNSFISVIKEMLNRLESEH 606          
BLAST of SCY1-like protein 2 vs. Ensembl Celegans
Match: ZC581.9 (pep chromosome:WBcel235:I:6665077:6673840:-1 gene:WBGene00022635.1 transcript:ZC581.9b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZC581.9)

HSP 1 Score: 155.221 bits (391), Expect = 1.149e-38
Identity = 97/300 (32.33%), Postives = 160/300 (53.33%), Query Frame = 2
Query:  185 WRIFEATRSKDNEEFSVFYFEKK----LAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPV-SWSSKLPKMAQPNLDYIAPE--IQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNI 1063
            WRIF +     N++ SV  F+KK       KL K +   +  + ++ + Q L  + H ++L + H LEE  D ++FATE+I  +L N++ +                ++   +K G+ QII+ + YL+ S +  H N +P  I +T   +WK+ G  F     N++  N  P   W+ KLP   QP+LD++APE     ++  +  +D+FSLG++IC +Y+     LI+AK+N   Y   V +L    + +S +L   L+  + K+LS DV+ RP  QL SL+K+F+DP +  L  L +I
Sbjct:   40 WRIFNSKSVFGNKDASVLVFDKKSNVKAPPKLGKSKTYSMF-DLIKYETQQLMGLIHPRILHMEHSLEETKDYISFATEQIFGNLENVVTDE--------------SLDRLEIKLGVLQIIDGMSYLHNSAKMLHGNLTPDAIYVTATKTWKIGGFSFA---VNAKEPNCYPCYPWTKKLPPCLQPDLDFLAPENLAPGQTTVTSAADVFSLGVLICWIYAGG-KRLIDAKSNLETYHIVVGQLDAALQCISNELGPNLKDSMAKVLSLDVEVRPTVQLLSLIKHFDDPCLSALRQLDDI 320          
BLAST of SCY1-like protein 2 vs. Ensembl Celegans
Match: ZC581.9 (pep chromosome:WBcel235:I:6665077:6673602:-1 gene:WBGene00022635.1 transcript:ZC581.9d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZC581.9)

HSP 1 Score: 155.606 bits (392), Expect = 1.150e-38
Identity = 97/300 (32.33%), Postives = 160/300 (53.33%), Query Frame = 2
Query:  185 WRIFEATRSKDNEEFSVFYFEKK----LAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPV-SWSSKLPKMAQPNLDYIAPE--IQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNI 1063
            WRIF +     N++ SV  F+KK       KL K +   +  + ++ + Q L  + H ++L + H LEE  D ++FATE+I  +L N++ +                ++   +K G+ QII+ + YL+ S +  H N +P  I +T   +WK+ G  F     N++  N  P   W+ KLP   QP+LD++APE     ++  +  +D+FSLG++IC +Y+     LI+AK+N   Y   V +L    + +S +L   L+  + K+LS DV+ RP  QL SL+K+F+DP +  L  L +I
Sbjct:   53 WRIFNSKSVFGNKDASVLVFDKKSNVKAPPKLGKSKTYSMF-DLIKYETQQLMGLIHPRILHMEHSLEETKDYISFATEQIFGNLENVVTDE--------------SLDRLEIKLGVLQIIDGMSYLHNSAKMLHGNLTPDAIYVTATKTWKIGGFSFA---VNAKEPNCYPCYPWTKKLPPCLQPDLDFLAPENLAPGQTTVTSAADVFSLGVLICWIYAGG-KRLIDAKSNLETYHIVVGQLDAALQCISNELGPNLKDSMAKVLSLDVEVRPTVQLLSLIKHFDDPCLSALRQLDDI 333          
BLAST of SCY1-like protein 2 vs. Ensembl Celegans
Match: ZC581.9 (pep chromosome:WBcel235:I:6665077:6670409:-1 gene:WBGene00022635.1 transcript:ZC581.9a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZC581.9)

HSP 1 Score: 154.836 bits (390), Expect = 1.908e-38
Identity = 97/300 (32.33%), Postives = 160/300 (53.33%), Query Frame = 2
Query:  185 WRIFEATRSKDNEEFSVFYFEKK----LAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPV-SWSSKLPKMAQPNLDYIAPE--IQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNI 1063
            WRIF +     N++ SV  F+KK       KL K +   +  + ++ + Q L  + H ++L + H LEE  D ++FATE+I  +L N++ +                ++   +K G+ QII+ + YL+ S +  H N +P  I +T   +WK+ G  F     N++  N  P   W+ KLP   QP+LD++APE     ++  +  +D+FSLG++IC +Y+     LI+AK+N   Y   V +L    + +S +L   L+  + K+LS DV+ RP  QL SL+K+F+DP +  L  L +I
Sbjct:   78 WRIFNSKSVFGNKDASVLVFDKKSNVKAPPKLGKSKTYSMF-DLIKYETQQLMGLIHPRILHMEHSLEETKDYISFATEQIFGNLENVVTDE--------------SLDRLEIKLGVLQIIDGMSYLHNSAKMLHGNLTPDAIYVTATKTWKIGGFSFA---VNAKEPNCYPCYPWTKKLPPCLQPDLDFLAPENLAPGQTTVTSAADVFSLGVLICWIYAGG-KRLIDAKSNLETYHIVVGQLDAALQCISNELGPNLKDSMAKVLSLDVEVRPTVQLLSLIKHFDDPCLSALRQLDDI 358          
BLAST of SCY1-like protein 2 vs. Ensembl Celegans
Match: ZC581.9 (pep chromosome:WBcel235:I:6665077:6673807:-1 gene:WBGene00022635.1 transcript:ZC581.9c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZC581.9)

HSP 1 Score: 154.836 bits (390), Expect = 2.015e-38
Identity = 97/300 (32.33%), Postives = 160/300 (53.33%), Query Frame = 2
Query:  185 WRIFEATRSKDNEEFSVFYFEKK----LAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPV-SWSSKLPKMAQPNLDYIAPE--IQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNI 1063
            WRIF +     N++ SV  F+KK       KL K +   +  + ++ + Q L  + H ++L + H LEE  D ++FATE+I  +L N++ +                ++   +K G+ QII+ + YL+ S +  H N +P  I +T   +WK+ G  F     N++  N  P   W+ KLP   QP+LD++APE     ++  +  +D+FSLG++IC +Y+     LI+AK+N   Y   V +L    + +S +L   L+  + K+LS DV+ RP  QL SL+K+F+DP +  L  L +I
Sbjct:   85 WRIFNSKSVFGNKDASVLVFDKKSNVKAPPKLGKSKTYSMF-DLIKYETQQLMGLIHPRILHMEHSLEETKDYISFATEQIFGNLENVVTDE--------------SLDRLEIKLGVLQIIDGMSYLHNSAKMLHGNLTPDAIYVTATKTWKIGGFSFA---VNAKEPNCYPCYPWTKKLPPCLQPDLDFLAPENLAPGQTTVTSAADVFSLGVLICWIYAGG-KRLIDAKSNLETYHIVVGQLDAALQCISNELGPNLKDSMAKVLSLDVEVRPTVQLLSLIKHFDDPCLSALRQLDDI 365          
BLAST of SCY1-like protein 2 vs. Ensembl Celegans
Match: cdk-4 (Cyclin-dependent kinase 4 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q9XTR1])

HSP 1 Score: 55.8398 bits (133), Expect = 6.455e-8
Identity = 46/168 (27.38%), Postives = 77/168 (45.83%), Query Frame = 2
Query:  494 INEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDV--KYRPN 991
            + E   KH   QI+ AL +L+T     H +  P  IL+    + KLA  G  ++YSN+       V+            L Y +PE+ L+S Y+ T DM++LG ++  +Y + P  +   +  Q   I         FK+M   + ++   P E +++ D   +YRP 
Sbjct:  141 VPEQQAKHVTAQIVRALDFLHTH-SIIHRDLKPQNILLNRDQTVKLADFGLSKEYSNTTAFTTLVVT------------LWYRSPEVLLQSYYNSTVDMWALGCIVSEIYCRQPLFVGQNEAEQLTDI---------FKKMGTPVGKDW--PSESVIARDSFPQYRPT 284          
BLAST of SCY1-like protein 2 vs. Ensembl Fly
Match: bma (gene:FBgn0085385 transcript:FBtr0331577)

HSP 1 Score: 292.352 bits (747), Expect = 2.896e-85
Identity = 188/630 (29.84%), Postives = 331/630 (52.54%), Query Frame = 2
Query:   80 SINIKQSFNVQLIT--NPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAV--------------------IDINEFN-----LKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFS-PVS-WSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEIL-SSLRAIFIQMPQEILFKVVFKALINRIHNCE--KGEFRPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQEKIDSLQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQ----VATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKE 1861
            S N+  S   Q +   NPI +YF +       G EL+WRI +A R  DN+E SVF FEKK+AEKLHKPRR+E + E L+  ++ L    H ++L++ H +EE+ D++AFA+E I  SLSN+L  H      +                              E+N     LK+G  Q+ EAL YL+ S    H N  P +ILIT +  WKLAGM ++++  N  +LN S P   WS+++ KMAQPNLD++APE Q  S  S  SDMFSLG+VIC+V++     LI A  + S Y +++  L     ++  +LP  L++   +M S D   RP  QL  L+KYF D  I  L+ L  +N +   ++ +   ++L      +P+++ ++ ++  L + I+N E      +P++ L  +   ++            + +  KSI   Q  +  L+ ++++ EK K + +   ++P +F   + +   +Q    VA   +   + + + +  +L  +  +F K   ++ +  + +++L C+  ++D ++  ++  ++LP L  I+  +P++++ ++ +  ++   +   +T + +A  ++ +L+P TVNP L   ++  L+E L  MLE ID++
Sbjct:   12 STNVAASTATQAVADGNPITQYFEIGKPVACAGPELVWRIHDAYRKSDNKECSVFIFEKKIAEKLHKPRRKETITELLKSSVKTLERFRHPRILQIYHTVEESADTLAFASEPIFASLSNVLAFHESKTYEATNVAPAAGGAAASQAQAAANTLPQRPAHAKEYNFLDMELKYGFLQLTEALAYLHYSGHVIHRNVCPSSILITKRGIWKLAGMEYVERM-NENDLNSSIPCPPWSNRVSKMAQPNLDFMAPETQSTSKCSLLSDMFSLGMVICAVFNNG-RPLIQAGNSTSNYAKQMETLDDLVHKLMPRLPIALQEATSRMASRDATARPTAQLLQLIKYFIDTPINALKFLDVVNMKDTQQKSQFYKTTLIEAMPMIPRKLWWQNIWPMLKSEINNNEVLAAVLQPVM-LFVQEATLTEYDTLMSATMKVIYNTPKSI---QASVTILENLHLIIEKTKPEDVTTDIMPMLFYSFDGSTIQVQSAAVVAVANVFDSIDELSIRRMVLPKVKQVFEK---NITDPKIVQNVLMCIERVMDRMERAQVMDEVLPLLANIRIPDPDIIMRTVRIYHKLFVDKTYGLTVETMATNVLPLLIPHTVNPSLNFEQYCYLLEVLQQMLEAIDRQ 632          
BLAST of SCY1-like protein 2 vs. Ensembl Fly
Match: bma (gene:FBgn0085385 transcript:FBtr0331578)

HSP 1 Score: 292.352 bits (747), Expect = 2.896e-85
Identity = 188/630 (29.84%), Postives = 331/630 (52.54%), Query Frame = 2
Query:   80 SINIKQSFNVQLIT--NPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAV--------------------IDINEFN-----LKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFS-PVS-WSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEIL-SSLRAIFIQMPQEILFKVVFKALINRIHNCE--KGEFRPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQEKIDSLQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQ----VATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKE 1861
            S N+  S   Q +   NPI +YF +       G EL+WRI +A R  DN+E SVF FEKK+AEKLHKPRR+E + E L+  ++ L    H ++L++ H +EE+ D++AFA+E I  SLSN+L  H      +                              E+N     LK+G  Q+ EAL YL+ S    H N  P +ILIT +  WKLAGM ++++  N  +LN S P   WS+++ KMAQPNLD++APE Q  S  S  SDMFSLG+VIC+V++     LI A  + S Y +++  L     ++  +LP  L++   +M S D   RP  QL  L+KYF D  I  L+ L  +N +   ++ +   ++L      +P+++ ++ ++  L + I+N E      +P++ L  +   ++            + +  KSI   Q  +  L+ ++++ EK K + +   ++P +F   + +   +Q    VA   +   + + + +  +L  +  +F K   ++ +  + +++L C+  ++D ++  ++  ++LP L  I+  +P++++ ++ +  ++   +   +T + +A  ++ +L+P TVNP L   ++  L+E L  MLE ID++
Sbjct:   12 STNVAASTATQAVADGNPITQYFEIGKPVACAGPELVWRIHDAYRKSDNKECSVFIFEKKIAEKLHKPRRKETITELLKSSVKTLERFRHPRILQIYHTVEESADTLAFASEPIFASLSNVLAFHESKTYEATNVAPAAGGAAASQAQAAANTLPQRPAHAKEYNFLDMELKYGFLQLTEALAYLHYSGHVIHRNVCPSSILITKRGIWKLAGMEYVERM-NENDLNSSIPCPPWSNRVSKMAQPNLDFMAPETQSTSKCSLLSDMFSLGMVICAVFNNG-RPLIQAGNSTSNYAKQMETLDDLVHKLMPRLPIALQEATSRMASRDATARPTAQLLQLIKYFIDTPINALKFLDVVNMKDTQQKSQFYKTTLIEAMPMIPRKLWWQNIWPMLKSEINNNEVLAAVLQPVM-LFVQEATLTEYDTLMSATMKVIYNTPKSI---QASVTILENLHLIIEKTKPEDVTTDIMPMLFYSFDGSTIQVQSAAVVAVANVFDSIDELSIRRMVLPKVKQVFEK---NITDPKIVQNVLMCIERVMDRMERAQVMDEVLPLLANIRIPDPDIIMRTVRIYHKLFVDKTYGLTVETMATNVLPLLIPHTVNPSLNFEQYCYLLEVLQQMLEAIDRQ 632          
BLAST of SCY1-like protein 2 vs. Ensembl Fly
Match: bma (gene:FBgn0085385 transcript:FBtr0331579)

HSP 1 Score: 292.352 bits (747), Expect = 3.808e-85
Identity = 188/630 (29.84%), Postives = 331/630 (52.54%), Query Frame = 2
Query:   80 SINIKQSFNVQLIT--NPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAV--------------------IDINEFN-----LKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFS-PVS-WSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEIL-SSLRAIFIQMPQEILFKVVFKALINRIHNCE--KGEFRPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQEKIDSLQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQ----VATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKE 1861
            S N+  S   Q +   NPI +YF +       G EL+WRI +A R  DN+E SVF FEKK+AEKLHKPRR+E + E L+  ++ L    H ++L++ H +EE+ D++AFA+E I  SLSN+L  H      +                              E+N     LK+G  Q+ EAL YL+ S    H N  P +ILIT +  WKLAGM ++++  N  +LN S P   WS+++ KMAQPNLD++APE Q  S  S  SDMFSLG+VIC+V++     LI A  + S Y +++  L     ++  +LP  L++   +M S D   RP  QL  L+KYF D  I  L+ L  +N +   ++ +   ++L      +P+++ ++ ++  L + I+N E      +P++ L  +   ++            + +  KSI   Q  +  L+ ++++ EK K + +   ++P +F   + +   +Q    VA   +   + + + +  +L  +  +F K   ++ +  + +++L C+  ++D ++  ++  ++LP L  I+  +P++++ ++ +  ++   +   +T + +A  ++ +L+P TVNP L   ++  L+E L  MLE ID++
Sbjct:   12 STNVAASTATQAVADGNPITQYFEIGKPVACAGPELVWRIHDAYRKSDNKECSVFIFEKKIAEKLHKPRRKETITELLKSSVKTLERFRHPRILQIYHTVEESADTLAFASEPIFASLSNVLAFHESKTYEATNVAPAAGGAAASQAQAAANTLPQRPAHAKEYNFLDMELKYGFLQLTEALAYLHYSGHVIHRNVCPSSILITKRGIWKLAGMEYVERM-NENDLNSSIPCPPWSNRVSKMAQPNLDFMAPETQSTSKCSLLSDMFSLGMVICAVFNNG-RPLIQAGNSTSNYAKQMETLDDLVHKLMPRLPIALQEATSRMASRDATARPTAQLLQLIKYFIDTPINALKFLDVVNMKDTQQKSQFYKTTLIEAMPMIPRKLWWQNIWPMLKSEINNNEVLAAVLQPVM-LFVQEATLTEYDTLMSATMKVIYNTPKSI---QASVTILENLHLIIEKTKPEDVTTDIMPMLFYSFDGSTIQVQSAAVVAVANVFDSIDELSIRRMVLPKVKQVFEK---NITDPKIVQNVLMCIERVMDRMERAQVMDEVLPLLANIRIPDPDIIMRTVRIYHKLFVDKTYGLTVETMATNVLPLLIPHTVNPSLNFEQYCYLLEVLQQMLEAIDRQ 632          
BLAST of SCY1-like protein 2 vs. Ensembl Fly
Match: CG1951 (gene:FBgn0039623 transcript:FBtr0085342)

HSP 1 Score: 199.134 bits (505), Expect = 1.020e-52
Identity = 157/607 (25.86%), Postives = 293/607 (48.27%), Query Frame = 2
Query:   56 LTTKISDSSINIKQSFNVQLITNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSP----VSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEF-RPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQEKIDSLQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKE 1861
            +  K   S++    + +  L  N + + + +  Q  + GV L+W+++   +    +E SVF FEKK  E+  K   RE + E LR+ +Q L+ I H  +L V HPLEE+ DS+AFATE +  SL+N++G++VR       E  + D+    ++HG+ Q+ + L++L+   +  H N S  TI+I    SWKL G  F    +N    + +P      +++ L  +AQP+L+Y APE+ L S  +  SD+FSLG++I ++Y+  P  +    ++ S +    N L          +P EL + ++ +L      RP       + YF D  +  L  L ++      ++ +    L  I   +P  +    +   L+    N     F  P + L+AE   +SS   + + +   L  + K  +  Q  +  +Q +++L +    + ++  ++P ++  LE     IQ     ++   S   +   + + +L    K+    +N SV+ + L  +  L++NLD   +  +ILPFL +IQ   P +++  + + K  +      IT   +A + +  LVP +V   L I +F +++  +  M+ ++++E
Sbjct:    3 MINKFYSSAVQTVSTLSGVLPGNNVTREYEVLEQVCTAGVGLMWKVYNGHKKSTKQEVSVFVFEKKSLERWSK-DDRETMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVGDNVR------SEKKLYDV---EIRHGLLQLFDGLQFLHQDAKIVHRNISAETIVINKNRSWKLFGFDFC--IANQPATDGTPHWPFREYTTSLHVLAQPSLEYTAPELALNSVNTPDSDLFSLGVLIFTIYAGKPLKMFG--SDYSSFRRYANDLNQRKYPPMNAVPSELTESLKALLHPSANLRPKLHELKQIAYFQDVGVKTLSYLDSLYQWDNLQKSKFYKGLPQIIPTLPHRVNLHSILPYLVKEFVNSPMIPFVLPNVLLIAE---MSSQREYCDHILPHLKPIFKLTDPIQILLIFMQKMDLLLKLTPAEEVKQSVLPLLYRSLECDMPQIQDLCLAVLPTFSTLIDYNAMKNSVLPRIKKLCLQSSNVSVKVNCLISIGKLLENLDKWLVLDEILPFLQQIQSREPAIIMGIIGIYKIAMTNTKLGITKDVMAHKCIPYLVPLSVENGLTIAQFNTIISLIKEMMGRVEQE 592          
BLAST of SCY1-like protein 2 vs. Ensembl Fly
Match: yata (gene:FBgn0260990 transcript:FBtr0333822)

HSP 1 Score: 58.9214 bits (141), Expect = 1.919e-8
Identity = 61/256 (23.83%), Postives = 110/256 (42.97%), Query Frame = 2
Query:  161 GSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAF-ATEKIHCSLSNILGNHV-RMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPVSWSSKLPKMAQPNLDYIAPE----IQLESNYSETSDMFSLGLVICSVYSKCPHSLIN-------AKTNQSIYIEKVN 889
            G +    IW + +A R    EE SVF ++ +           +  CE  +  ++ L  + H  +L+ +  LE   D M + ATE +     + LG +  ++   ++Q+          L  GI+QI  AL +LN      HNN S +++ +     WKL  +    +Y ++ + N  P    +K+P   +    Y +PE     +L++    + DM+ LG ++   ++       N        K+ QS+Y E V 
Sbjct:   22 GGFDQYSIWTLHKAKRKTTLEEVSVFVYDIRSGS--------DTKCELAKAALKRLKTLRHPSILQYLDSLE--TDKMLYVATEAV-----DPLGTYFSKLGSDNVQK-------GLYLAWGIFQITRALSFLNNDGNLRHNNVSAWSVFVNASGEWKLGSL----EYVSAADGNPMP---PAKIPVTLE---VYDSPEKNDPSKLKAATKCSVDMWGLGCLVWEAFNGVLKQRSNLKDIEHIPKSLQSLYCELVG 245          
BLAST of SCY1-like protein 2 vs. Ensembl Zebrafish
Match: SCYL2 (si:ch211-244b2.1 [Source:ZFIN;Acc:ZDB-GENE-041210-205])

HSP 1 Score: 199.904 bits (507), Expect = 1.466e-52
Identity = 182/793 (22.95%), Postives = 356/793 (44.89%), Query Frame = 2
Query:   53 SLTTKISDSSINIKQSFNVQLITNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPV--SWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKC-PHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEF-RPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQEKID----SLQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKEY-------------WRNHSSPNKNSQTND-DSTPHQVPRIETPD--LANRSKSSGLLNLQNREEPSQISYGIYRNSEISFILAXXXXXXXXXXXXXXXLIQPPVNPNT-KSSPSSPLLCHKQELSSECKLMSSTTGCLENYTSL-NVPLNSGRRHSFGSSTILQSSENMITASVCEGPFFGS 2353
            S+  K+  +   +       ++ NP+ + F +     S G  + WRI+  T+    +E +VF F+KK+ ++  K  + +I+ + L+K IQ L+ + H +LL V HPLEE+ D +AF TE +  SL+N+LG    +      ++    + +   K+G+ Q+ E L +L++ ++  H N     I++    +WK+ G  F    SN  +     V   W   LP +  PN +Y+APE  L  +    SDM+SLG++I +V+++  P   +N +     +  ++++L      +  ++PEE+R+ V+ +LS     RP+    + + +F+D   + L+   ++  +   ++ +    L  +  ++P+ ++   +  AL++   N +   F  P + L+AE           E     ++  +  +   QE +      LQ +++L  K   + ++N ++P V+  +E     IQ     ++   +       + + L+          ++ +V+ + L CL  +++ LD   +  +ILPFL +I    P VL+  L + K     +   I  + +A + +  LV  +++  L + +F S M  +  ML +++ E+              R+ +  N  +Q+ D  STP    ++   D      S ++G+   +N       S  + + S +S  L                  Q P+ P + KS+ ++P     ++L         T+  L N TSL N+ LNSG R        +    N I+++    P  G 
Sbjct:    3 SMLNKLKSTVTKVTADVTSAVMGNPVTREFEVGKHIASGGPGMSWRIYNGTKKSTKQEVAVFVFDKKVIDRYQKFEKDQII-DSLKKGIQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGQWDNLPSPVPTDIKDYKLYDVETKYGLLQVSEGLSFLHSGVKMVHGNLCSENIILNKSGAWKIMGFDFSISSSNPSDAEPKYVCKEWDPNLPPLCLPNPEYVAPEYILSVSCDSASDMYSLGVLIHAVFNEGKPVFKVNKQDIFKSFSRQLDQLSHLSPGVLSQIPEEVRQHVKMLLSVTSNVRPDADQMTKIPFFDDVGAMTLQYFDSLFQRDNLQKSQFFKGLPKVLPKLPKRVVVYRILPALMSEFVNPDMVPFILPNVLLIAE-------ECTKEEYVRLVLPDLTPVFKMQEPVQILLIFLQKMDLLLTKTPPEDIKNSVLPMVYRAVEAPSVQIQELCLNIIPTFANLIEYPSMKNSLIPRIKSTCLQTSSLAVRVNSLVCLGKILEYLDKWFVIDEILPFLQQIPSREPAVLMGILGIYKCTFTHKKLGIPKEHLAGKSLPHLVSLSIDNNLNLNQFNSFMAVIKDMLTRMEAEHKVKLEQLHIMQEQQRSLNITNPINQSEDTKSTPSPATQVRDIDDIFGGSSANAGVNGKENG------SSTVSQPSRVSLTLEEKQRLAKEQEQAAKLRSQQPLAPQSIKSATTTP---QAKDL---------TSSLLNNMTSLNNMSLNSGTR-------TMPMQGNTISSTFPAAPTMGG 762          
BLAST of SCY1-like protein 2 vs. Ensembl Zebrafish
Match: SCYL2 (si:ch211-244b2.1 [Source:ZFIN;Acc:ZDB-GENE-041210-205])

HSP 1 Score: 199.904 bits (507), Expect = 1.466e-52
Identity = 182/793 (22.95%), Postives = 356/793 (44.89%), Query Frame = 2
Query:   53 SLTTKISDSSINIKQSFNVQLITNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPV--SWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKC-PHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEF-RPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQEKID----SLQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKEY-------------WRNHSSPNKNSQTND-DSTPHQVPRIETPD--LANRSKSSGLLNLQNREEPSQISYGIYRNSEISFILAXXXXXXXXXXXXXXXLIQPPVNPNT-KSSPSSPLLCHKQELSSECKLMSSTTGCLENYTSL-NVPLNSGRRHSFGSSTILQSSENMITASVCEGPFFGS 2353
            S+  K+  +   +       ++ NP+ + F +     S G  + WRI+  T+    +E +VF F+KK+ ++  K  + +I+ + L+K IQ L+ + H +LL V HPLEE+ D +AF TE +  SL+N+LG    +      ++    + +   K+G+ Q+ E L +L++ ++  H N     I++    +WK+ G  F    SN  +     V   W   LP +  PN +Y+APE  L  +    SDM+SLG++I +V+++  P   +N +     +  ++++L      +  ++PEE+R+ V+ +LS     RP+    + + +F+D   + L+   ++  +   ++ +    L  +  ++P+ ++   +  AL++   N +   F  P + L+AE           E     ++  +  +   QE +      LQ +++L  K   + ++N ++P V+  +E     IQ     ++   +       + + L+          ++ +V+ + L CL  +++ LD   +  +ILPFL +I    P VL+  L + K     +   I  + +A + +  LV  +++  L + +F S M  +  ML +++ E+              R+ +  N  +Q+ D  STP    ++   D      S ++G+   +N       S  + + S +S  L                  Q P+ P + KS+ ++P     ++L         T+  L N TSL N+ LNSG R        +    N I+++    P  G 
Sbjct:    3 SMLNKLKSTVTKVTADVTSAVMGNPVTREFEVGKHIASGGPGMSWRIYNGTKKSTKQEVAVFVFDKKVIDRYQKFEKDQII-DSLKKGIQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGQWDNLPSPVPTDIKDYKLYDVETKYGLLQVSEGLSFLHSGVKMVHGNLCSENIILNKSGAWKIMGFDFSISSSNPSDAEPKYVCKEWDPNLPPLCLPNPEYVAPEYILSVSCDSASDMYSLGVLIHAVFNEGKPVFKVNKQDIFKSFSRQLDQLSHLSPGVLSQIPEEVRQHVKMLLSVTSNVRPDADQMTKIPFFDDVGAMTLQYFDSLFQRDNLQKSQFFKGLPKVLPKLPKRVVVYRILPALMSEFVNPDMVPFILPNVLLIAE-------ECTKEEYVRLVLPDLTPVFKMQEPVQILLIFLQKMDLLLTKTPPEDIKNSVLPMVYRAVEAPSVQIQELCLNIIPTFANLIEYPSMKNSLIPRIKSTCLQTSSLAVRVNSLVCLGKILEYLDKWFVIDEILPFLQQIPSREPAVLMGILGIYKCTFTHKKLGIPKEHLAGKSLPHLVSLSIDNNLNLNQFNSFMAVIKDMLTRMEAEHKVKLEQLHIMQEQQRSLNITNPINQSEDTKSTPSPATQVRDIDDIFGGSSANAGVNGKENG------SSTVSQPSRVSLTLEEKQRLAKEQEQAAKLRSQQPLAPQSIKSATTTP---QAKDL---------TSSLLNNMTSLNNMSLNSGTR-------TMPMQGNTISSTFPAAPTMGG 762          
BLAST of SCY1-like protein 2 vs. Ensembl Zebrafish
Match: scyl1 (SCY1-like, kinase-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-8915])

HSP 1 Score: 60.8474 bits (146), Expect = 7.347e-9
Identity = 60/275 (21.82%), Postives = 107/275 (38.91%), Query Frame = 2
Query:  182 IWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPVSWSSKLPKMAQPNLD-YIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLF 1003
            IW +    R    E  SVF +E          +  E   +  +   +    + H  +L  V  LE    S+   TE +       L  H+++      +      ++  +  G++QI++AL +L      NHNN   + + +     WKL G+  +       ++   P       PK+  P+L+ Y  PE         T D++ LG +I  V++    SL  A + +S+                 K+P++L     +++  + K RPNP  F
Sbjct:   27 IWTLSRGKRKSTGEPVSVFVYEVS--------QGTEEQTQLAKAAFKRTKTLRHPNILSYVDGLE-TEKSLYIVTEPV-----TPLAAHLKL------QAEKGGASDLEVSWGLHQIVKALSFLVNDCHLNHNNLGMWAVFVDRAGEWKLGGLDHVTS-EQGDSITLPP-------PKVINPDLERYDPPESPNSGGEKWTGDVWRLGCLIWEVFN---GSLPRASSLRSLG----------------KIPKQLVPHYCELVGANPKIRPNPARF 254          
BLAST of SCY1-like protein 2 vs. Ensembl Zebrafish
Match: cdk6 (cyclin-dependent kinase 6 [Source:ZFIN;Acc:ZDB-GENE-060503-786])

HSP 1 Score: 53.5286 bits (127), Expect = 6.026e-7
Identity = 44/166 (26.51%), Postives = 78/166 (46.99%), Query Frame = 2
Query:  443 NHVRMDLSSIQELAV-IDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEE 937
             HV  DL++  E A    +    +K  +YQ+++ L +L+ S +  H +  P  IL+T+    KLA  G  + YS    L    V+            L Y APE+ L+S+Y+   D++S+G +   ++ + P  L    ++       V++LG  F  + +  PE+
Sbjct:   96 EHVDQDLTTYLEKAPDPGVPPETIKDMMYQLLQGLDFLH-SHRVVHRDLKPQNILVTSGGQIKLADFGLARIYSFQMALTSVVVT------------LWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRRP--LFRGNSD-------VDQLGKIFDVVGVPSPED 239          
BLAST of SCY1-like protein 2 vs. Ensembl Zebrafish
Match: cdk6 (cyclin-dependent kinase 6 [Source:ZFIN;Acc:ZDB-GENE-060503-786])

HSP 1 Score: 53.1434 bits (126), Expect = 7.412e-7
Identity = 44/166 (26.51%), Postives = 77/166 (46.39%), Query Frame = 2
Query:  443 NHVRMDLSSIQELAV-IDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEE 937
             HV  DL++  E A    +    +K  +YQ+++ L +L+ S +  H +  P  IL+T+    KLA  G  + YS    L    V             L Y APE+ L+S+Y+   D++S+G +   ++ + P  L    ++       V++LG  F  + +  PE+
Sbjct:   96 EHVDQDLTTYLEKAPDPGVPPETIKDMMYQLLQGLDFLH-SHRVVHRDLKPQNILVTSGGQIKLADFGLARIYSFQMALTSVVVV-----------TLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRRP--LFRGNSD-------VDQLGKIFDVVGVPSPED 240          
BLAST of SCY1-like protein 2 vs. Ensembl Xenopus
Match: gatad2b (GATA zinc finger domain containing 2B [Source:Xenbase;Acc:XB-GENE-5995517])

HSP 1 Score: 219.55 bits (558), Expect = 7.363e-59
Identity = 156/617 (25.28%), Postives = 303/617 (49.11%), Query Frame = 2
Query:   53 SLTTKISDSSINIKQSFNVQLITNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSN--SQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIY------IEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEF-RPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQEKID----SLQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKEY 1864
            S+  K+  +   +       ++ NP+ + F +     S G  L W+IF  T+    +E +VF F+KK+ +K  K  + +I+ + L++ +Q L+ + H +LL V HPLEE+ D +AF TE +  SL+N+LG+   +      E+    + +   K+G+ Q+ E L +L++S++  H N +P  I++    +WK+ G  F    +N   Q   F    W   LP +  PN +Y+APE  L  +    SDM+SLG++I +VY+K     I     Q IY      +++++RL      + + +PEE+++ V+ +L+     RP+    + + +F+D  ++ L+   ++  Q   ++ +    L  +  ++P+ ++ + +  AL +   N +   F  P + L+AE           E     ++  +  +   QE I      LQ +++L  K   D +RN ++P V+  LE     IQ     ++   +   +   + + L+          ++ +V+ + L CL  +++ LD   +  ++LPFL +I    P VL+  L + K     +   IT + +A +++  L+P +++  L +++F S M  +  ML K++ E+
Sbjct:    3 SMLNKLKSTVTKVTADVTSAVMGNPVTREFDVGKHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKIIDKYQKYEKDQII-DSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGSWDNLPSPLPPEIREHKLFDAEAKYGLLQVSEGLSFLHSSVKMIHANLTPENIILNKSGAWKIMGFDFCNPATNPSDQEAKFVCKEWDPNLPPLCLPNPEYLAPEYILSVSCDPASDMYSLGVIIHAVYNK--GKTIFEVNKQDIYKSFSRQLDQLSRLN---PNVLVNIPEEVKEHVKLLLNVTSTVRPDADQMTKIPFFDDVGVVTLQYFDSLFQQDNLQKSQFFKELPKVLQKLPKRVVVQRILPALTSEFVNPDMVPFVLPNVLLIAE-------ECTKEEYTKLILPDLGPVFRQQEPIQILLIFLQKMDLLLTKTPPDEIRNSVLPMVYRALEAPSIQIQELCLNIIPTFANLIDYPSMKNSLIPRIKNACLQTSSLAVRVNSLVCLGKILEYLDKWFVIDELLPFLQQIPSREPAVLMGILGIYKCTFTHKKLGITKEQLAGKVLPHLIPLSIDNNLNLSQFNSFMAVIKEMLNKLESEH 606          
BLAST of SCY1-like protein 2 vs. Ensembl Xenopus
Match: gatad2b (GATA zinc finger domain containing 2B [Source:Xenbase;Acc:XB-GENE-5995517])

HSP 1 Score: 212.231 bits (539), Expect = 4.525e-57
Identity = 152/607 (25.04%), Postives = 296/607 (48.76%), Query Frame = 2
Query:   53 SLTTKISDSSINIKQSFNVQLITNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSN--SQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIY------IEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEF-RPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQEKIDS--------LQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLM 1822
            S+  K+  +   +       ++ NP+ + F +     S G  L W+IF  T+    +E +VF F+KK+ +K  K  + +I+ + L++ +Q L+ + H +LL V HPLEE+ D +AF TE +  SL+N+LG+   +      E+    + +   K+G+ Q+ E L +L++S++  H N +P  I++    +WK+ G  F    +N   Q   F    W   LP +  PN +Y+APE  L  +    SDM+SLG++I +VY+K     I     Q IY      +++++RL      + + +PEE+++ V+ +L+     RP+    + + +F+D  ++ L+   ++  Q   ++ +    L  +  ++P+ ++ + +  AL +   N +   F  P + L+AE           E     ++  +  +   QE I +        LQ +++L  K   D +RN ++P V+  LE     IQ     ++   +   +   + + L+          ++ +V+ + L CL  +++ LD   +  ++LPFL +I    P VL+  L + K     +   IT + +A +++  L+P +++  L +++F S M
Sbjct:    3 SMLNKLKSTVTKVTADVTSAVMGNPVTREFDVGKHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKIIDKYQKYEKDQII-DSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGSWDNLPSPLPPEIREHKLFDAEAKYGLLQVSEGLSFLHSSVKMIHANLTPENIILNKSGAWKIMGFDFCNPATNPSDQEAKFVCKEWDPNLPPLCLPNPEYLAPEYILSVSCDPASDMYSLGVIIHAVYNK--GKTIFEVNKQDIYKSFSRQLDQLSRLN---PNVLVNIPEEVKEHVKLLLNVTSTVRPDADQMTKIPFFDDVGVVTLQYFDSLFQQDNLQKSQFFKELPKVLQKLPKRVVVQRILPALTSEFVNPDMVPFVLPNVLLIAE-------ECTKEEYTKLILPDLGPVFRQQEPIQASNMILLIFLQKMDLLLTKTPPDEIRNSVLPMVYRALEAPSIQIQELCLNIIPTFANLIDYPSMKNSLIPRIKNACLQTSSLAVRVNSLVCLGKILEYLDKWFVIDELLPFLQQIPSREPAVLMGILGIYKCTFTHKKLGITKEQLAGKVLPHLIPLSIDNNLNLSQFNSFM 596          
BLAST of SCY1-like protein 2 vs. Ensembl Xenopus
Match: gatad2b (GATA zinc finger domain containing 2B [Source:Xenbase;Acc:XB-GENE-5995517])

HSP 1 Score: 212.231 bits (539), Expect = 5.409e-57
Identity = 152/607 (25.04%), Postives = 296/607 (48.76%), Query Frame = 2
Query:   53 SLTTKISDSSINIKQSFNVQLITNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSN--SQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIY------IEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEF-RPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQEKIDS--------LQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLM 1822
            S+  K+  +   +       ++ NP+ + F +     S G  L W+IF  T+    +E +VF F+KK+ +K  K  + +I+ + L++ +Q L+ + H +LL V HPLEE+ D +AF TE +  SL+N+LG+   +      E+    + +   K+G+ Q+ E L +L++S++  H N +P  I++    +WK+ G  F    +N   Q   F    W   LP +  PN +Y+APE  L  +    SDM+SLG++I +VY+K     I     Q IY      +++++RL      + + +PEE+++ V+ +L+     RP+    + + +F+D  ++ L+   ++  Q   ++ +    L  +  ++P+ ++ + +  AL +   N +   F  P + L+AE           E     ++  +  +   QE I +        LQ +++L  K   D +RN ++P V+  LE     IQ     ++   +   +   + + L+          ++ +V+ + L CL  +++ LD   +  ++LPFL +I    P VL+  L + K     +   IT + +A +++  L+P +++  L +++F S M
Sbjct:    3 SMLNKLKSTVTKVTADVTSAVMGNPVTREFDVGKHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKIIDKYQKYEKDQII-DSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGSWDNLPSPLPPEIREHKLFDAEAKYGLLQVSEGLSFLHSSVKMIHANLTPENIILNKSGAWKIMGFDFCNPATNPSDQEAKFVCKEWDPNLPPLCLPNPEYLAPEYILSVSCDPASDMYSLGVIIHAVYNK--GKTIFEVNKQDIYKSFSRQLDQLSRLN---PNVLVNIPEEVKEHVKLLLNVTSTVRPDADQMTKIPFFDDVGVVTLQYFDSLFQQDNLQKSQFFKELPKVLQKLPKRVVVQRILPALTSEFVNPDMVPFVLPNVLLIAE-------ECTKEEYTKLILPDLGPVFRQQEPIQASNMILLIFLQKMDLLLTKTPPDEIRNSVLPMVYRALEAPSIQIQELCLNIIPTFANLIDYPSMKNSLIPRIKNACLQTSSLAVRVNSLVCLGKILEYLDKWFVIDELLPFLQQIPSREPAVLMGILGIYKCTFTHKKLGITKEQLAGKVLPHLIPLSIDNNLNLSQFNSFM 596          
BLAST of SCY1-like protein 2 vs. Ensembl Xenopus
Match: gatad2b (GATA zinc finger domain containing 2B [Source:Xenbase;Acc:XB-GENE-5995517])

HSP 1 Score: 212.231 bits (539), Expect = 7.765e-57
Identity = 152/603 (25.21%), Postives = 295/603 (48.92%), Query Frame = 2
Query:   53 SLTTKISDSSINIKQSFNVQLITNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSN--SQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIY------IEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEF-RPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQEKID----SLQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLM 1822
            S+  K+  +   +       ++ NP+ + F +     S G  L W+IF  T+    +E +VF F+KK+ +K  K  + +I+ + L++ +Q L+ + H +LL V HPLEE+ D +AF TE +  SL+N+LG+   +      E+    + +   K+G+ Q+ E L +L++S++  H N +P  I++    +WK+ G  F    +N   Q   F    W   LP +  PN +Y+APE  L  +    SDM+SLG++I +VY+K     I     Q IY      +++++RL      + + +PEE+++ V+ +L+     RP+    + + +F+D  ++ L+   ++  Q   ++ +    L  +  ++P+ ++ + +  AL +   N +   F  P + L+AE           E     ++  +  +   QE I      LQ +++L  K   D +RN ++P V+  LE     IQ     ++   +   +   + + L+          ++ +V+ + L CL  +++ LD   +  ++LPFL +I    P VL+  L + K     +   IT + +A +++  L+P +++  L +++F S M
Sbjct:    3 SMLNKLKSTVTKVTADVTSAVMGNPVTREFDVGKHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKIIDKYQKYEKDQII-DSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGSWDNLPSPLPPEIREHKLFDAEAKYGLLQVSEGLSFLHSSVKMIHANLTPENIILNKSGAWKIMGFDFCNPATNPSDQEAKFVCKEWDPNLPPLCLPNPEYLAPEYILSVSCDPASDMYSLGVIIHAVYNK--GKTIFEVNKQDIYKSFSRQLDQLSRLN---PNVLVNIPEEVKEHVKLLLNVTSTVRPDADQMTKIPFFDDVGVVTLQYFDSLFQQDNLQKSQFFKELPKVLQKLPKRVVVQRILPALTSEFVNPDMVPFVLPNVLLIAE-------ECTKEEYTKLILPDLGPVFRQQEPIQILLIFLQKMDLLLTKTPPDEIRNSVLPMVYRALEAPSIQIQELCLNIIPTFANLIDYPSMKNSLIPRIKNACLQTSSLAVRVNSLVCLGKILEYLDKWFVIDELLPFLQQIPSREPAVLMGILGIYKCTFTHKKLGITKEQLAGKVLPHLIPLSIDNNLNLSQFNSFM 592          
BLAST of SCY1-like protein 2 vs. Ensembl Xenopus
Match: gatad2b (GATA zinc finger domain containing 2B [Source:Xenbase;Acc:XB-GENE-5995517])

HSP 1 Score: 212.231 bits (539), Expect = 1.211e-56
Identity = 152/607 (25.04%), Postives = 296/607 (48.76%), Query Frame = 2
Query:   53 SLTTKISDSSINIKQSFNVQLITNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSN--SQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIY------IEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEF-RPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQEKIDS--------LQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLM 1822
            S+  K+  +   +       ++ NP+ + F +     S G  L W+IF  T+    +E +VF F+KK+ +K  K  + +I+ + L++ +Q L+ + H +LL V HPLEE+ D +AF TE +  SL+N+LG+   +      E+    + +   K+G+ Q+ E L +L++S++  H N +P  I++    +WK+ G  F    +N   Q   F    W   LP +  PN +Y+APE  L  +    SDM+SLG++I +VY+K     I     Q IY      +++++RL      + + +PEE+++ V+ +L+     RP+    + + +F+D  ++ L+   ++  Q   ++ +    L  +  ++P+ ++ + +  AL +   N +   F  P + L+AE           E     ++  +  +   QE I +        LQ +++L  K   D +RN ++P V+  LE     IQ     ++   +   +   + + L+          ++ +V+ + L CL  +++ LD   +  ++LPFL +I    P VL+  L + K     +   IT + +A +++  L+P +++  L +++F S M
Sbjct:    3 SMLNKLKSTVTKVTADVTSAVMGNPVTREFDVGKHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKIIDKYQKYEKDQII-DSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGSWDNLPSPLPPEIREHKLFDAEAKYGLLQVSEGLSFLHSSVKMIHANLTPENIILNKSGAWKIMGFDFCNPATNPSDQEAKFVCKEWDPNLPPLCLPNPEYLAPEYILSVSCDPASDMYSLGVIIHAVYNK--GKTIFEVNKQDIYKSFSRQLDQLSRLN---PNVLVNIPEEVKEHVKLLLNVTSTVRPDADQMTKIPFFDDVGVVTLQYFDSLFQQDNLQKSQFFKELPKVLQKLPKRVVVQRILPALTSEFVNPDMVPFVLPNVLLIAE-------ECTKEEYTKLILPDLGPVFRQQEPIQASNMILLIFLQKMDLLLTKTPPDEIRNSVLPMVYRALEAPSIQIQELCLNIIPTFANLIDYPSMKNSLIPRIKNACLQTSSLAVRVNSLVCLGKILEYLDKWFVIDELLPFLQQIPSREPAVLMGILGIYKCTFTHKKLGITKEQLAGKVLPHLIPLSIDNNLNLSQFNSFM 596          
BLAST of SCY1-like protein 2 vs. Ensembl Mouse
Match: Scyl2 (SCY1-like 2 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1289172])

HSP 1 Score: 214.157 bits (544), Expect = 3.274e-57
Identity = 155/618 (25.08%), Postives = 298/618 (48.22%), Query Frame = 2
Query:   53 SLTTKISDSSINIKQSFNVQLITNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSN--SQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKC-PHSLINAKTNQSIY------IEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEF-RPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQEKID----SLQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKEY 1864
            S+  K+  +   +       ++ NP+ + F +     S G  L W+IF  T+    +E +VF F+KKL +K  K  + +I+ + L++ +Q L+ + H +LL V HPLEE+ D +AF TE +  SL+N+LGN   +  S   ++    + +   K+G+ Q+ E L +L++S++  H N +P  +++    +WK+ G  F    SN   Q   F    W   LP +  PN +Y+APE  L  +    SDM+SLG V+ +V+++  P   +N    Q IY      +++++RLG         +PEE+R+ V+ +L+     RP+    + + +F+D   + L+    +  +   ++ +    L  +  ++P+ ++ + +   L +   N +   F  P + L+AE           E     ++  +  +   QE I      LQ +++L  K   D ++N ++P V+  LE     IQ     ++   +   +   + + L+          ++ +V+ + L CL  +++ LD   +   ILPFL +I    P VL+  L + K     +   IT + +A +++  L+P ++   L + +F S +  +  ML +++ E+
Sbjct:    3 SMLNKLKSTVTKVTADVTSAVMGNPVTREFDVGRHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKLIDKYQKFEKDQII-DSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWENLPSSISPDIKDYKLYDVETKYGLLQVSEGLSFLHSSVKMVHGNVTPENVILNKSGAWKIMGFDFCVSSSNPSEQEPKFPCKEWDPNLPSLCLPNPEYLAPEYILSVSCETASDMYSLGAVMYAVFNQGRPIFEVN---KQDIYKSFSRQLDQLSRLG---SSSLTSIPEEVREHVKLLLNVTPTVRPDADQMTKIPFFDDVGAVTLQYFDTLFQRDNLQKSQFFKGLPKVLPKLPKRVIVQRILPCLTSEFVNPDMVPFVLPNVLLIAE-------ECTKEEYIKLILPELGPVFKQQEPIQILLIFLQKMDLLLTKTPPDEIKNSVLPMVYRALEAPSIQIQELCLNIIPTFANLIDYPSMKNALIPRIKNACLQTSSLAVRVNSLVCLGKILEYLDKWFVLDDILPFLQQIPSKEPAVLMGILGIYKCTFTHKKLGITKEQLAGKVLPHLIPLSIENNLNLNQFSSFIAVIKEMLSRLESEH 606          
BLAST of SCY1-like protein 2 vs. Ensembl Mouse
Match: Scyl2 (SCY1-like 2 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1289172])

HSP 1 Score: 214.157 bits (544), Expect = 3.360e-57
Identity = 155/618 (25.08%), Postives = 298/618 (48.22%), Query Frame = 2
Query:   53 SLTTKISDSSINIKQSFNVQLITNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSN--SQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKC-PHSLINAKTNQSIY------IEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEF-RPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQEKID----SLQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKEY 1864
            S+  K+  +   +       ++ NP+ + F +     S G  L W+IF  T+    +E +VF F+KKL +K  K  + +I+ + L++ +Q L+ + H +LL V HPLEE+ D +AF TE +  SL+N+LGN   +  S   ++    + +   K+G+ Q+ E L +L++S++  H N +P  +++    +WK+ G  F    SN   Q   F    W   LP +  PN +Y+APE  L  +    SDM+SLG V+ +V+++  P   +N    Q IY      +++++RLG         +PEE+R+ V+ +L+     RP+    + + +F+D   + L+    +  +   ++ +    L  +  ++P+ ++ + +   L +   N +   F  P + L+AE           E     ++  +  +   QE I      LQ +++L  K   D ++N ++P V+  LE     IQ     ++   +   +   + + L+          ++ +V+ + L CL  +++ LD   +   ILPFL +I    P VL+  L + K     +   IT + +A +++  L+P ++   L + +F S +  +  ML +++ E+
Sbjct:    3 SMLNKLKSTVTKVTADVTSAVMGNPVTREFDVGRHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKLIDKYQKFEKDQII-DSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWENLPSSISPDIKDYKLYDVETKYGLLQVSEGLSFLHSSVKMVHGNVTPENVILNKSGAWKIMGFDFCVSSSNPSEQEPKFPCKEWDPNLPSLCLPNPEYLAPEYILSVSCETASDMYSLGAVMYAVFNQGRPIFEVN---KQDIYKSFSRQLDQLSRLG---SSSLTSIPEEVREHVKLLLNVTPTVRPDADQMTKIPFFDDVGAVTLQYFDTLFQRDNLQKSQFFKGLPKVLPKLPKRVIVQRILPCLTSEFVNPDMVPFVLPNVLLIAE-------ECTKEEYIKLILPELGPVFKQQEPIQILLIFLQKMDLLLTKTPPDEIKNSVLPMVYRALEAPSIQIQELCLNIIPTFANLIDYPSMKNALIPRIKNACLQTSSLAVRVNSLVCLGKILEYLDKWFVLDDILPFLQQIPSKEPAVLMGILGIYKCTFTHKKLGITKEQLAGKVLPHLIPLSIENNLNLNQFSSFIAVIKEMLSRLESEH 606          
BLAST of SCY1-like protein 2 vs. Ensembl Mouse
Match: Cdk6 (cyclin-dependent kinase 6 [Source:MGI Symbol;Acc:MGI:1277162])

HSP 1 Score: 50.0618 bits (118), Expect = 9.042e-6
Identity = 34/131 (25.95%), Postives = 64/131 (48.85%), Query Frame = 2
Query:  446 HVRMDLSS-IQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCP 835
            HV  DL++ + ++    +    +K  ++Q++  L +L+ S +  H +  P  IL+T+    KLA  G  + YS    L    V+            L Y APE+ L+S+Y+   D++S+G +   ++ + P
Sbjct:  100 HVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLH-SHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVT------------LWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKP 217          
BLAST of SCY1-like protein 2 vs. Ensembl Mouse
Match: Cdk6 (cyclin-dependent kinase 6 [Source:MGI Symbol;Acc:MGI:1277162])

HSP 1 Score: 50.0618 bits (118), Expect = 9.042e-6
Identity = 34/131 (25.95%), Postives = 64/131 (48.85%), Query Frame = 2
Query:  446 HVRMDLSS-IQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCP 835
            HV  DL++ + ++    +    +K  ++Q++  L +L+ S +  H +  P  IL+T+    KLA  G  + YS    L    V+            L Y APE+ L+S+Y+   D++S+G +   ++ + P
Sbjct:  100 HVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLH-SHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVT------------LWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKP 217          
BLAST of SCY1-like protein 2 vs. UniProt/SwissProt
Match: sp|Q8CFE4|SCYL2_MOUSE (SCY1-like protein 2 OS=Mus musculus OX=10090 GN=Scyl2 PE=1 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 2.350e-56
Identity = 155/618 (25.08%), Postives = 298/618 (48.22%), Query Frame = 2
Query:   53 SLTTKISDSSINIKQSFNVQLITNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSN--SQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKC-PHSLINAKTNQSIY------IEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEF-RPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQEKID----SLQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKEY 1864
            S+  K+  +   +       ++ NP+ + F +     S G  L W+IF  T+    +E +VF F+KKL +K  K  + +I+ + L++ +Q L+ + H +LL V HPLEE+ D +AF TE +  SL+N+LGN   +  S   ++    + +   K+G+ Q+ E L +L++S++  H N +P  +++    +WK+ G  F    SN   Q   F    W   LP +  PN +Y+APE  L  +    SDM+SLG V+ +V+++  P   +N    Q IY      +++++RLG         +PEE+R+ V+ +L+     RP+    + + +F+D   + L+    +  +   ++ +    L  +  ++P+ ++ + +   L +   N +   F  P + L+AE           E     ++  +  +   QE I      LQ +++L  K   D ++N ++P V+  LE     IQ     ++   +   +   + + L+          ++ +V+ + L CL  +++ LD   +   ILPFL +I    P VL+  L + K     +   IT + +A +++  L+P ++   L + +F S +  +  ML +++ E+
Sbjct:    3 SMLNKLKSTVTKVTADVTSAVMGNPVTREFDVGRHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKLIDKYQKFEKDQII-DSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWENLPSSISPDIKDYKLYDVETKYGLLQVSEGLSFLHSSVKMVHGNVTPENVILNKSGAWKIMGFDFCVSSSNPSEQEPKFPCKEWDPNLPSLCLPNPEYLAPEYILSVSCETASDMYSLGAVMYAVFNQGRPIFEVN---KQDIYKSFSRQLDQLSRLG---SSSLTSIPEEVREHVKLLLNVTPTVRPDADQMTKIPFFDDVGAVTLQYFDTLFQRDNLQKSQFFKGLPKVLPKLPKRVIVQRILPCLTSEFVNPDMVPFVLPNVLLIAE-------ECTKEEYIKLILPELGPVFKQQEPIQILLIFLQKMDLLLTKTPPDEIKNSVLPMVYRALEAPSIQIQELCLNIIPTFANLIDYPSMKNALIPRIKNACLQTSSLAVRVNSLVCLGKILEYLDKWFVLDDILPFLQQIPSKEPAVLMGILGIYKCTFTHKKLGITKEQLAGKVLPHLIPLSIENNLNLNQFSSFIAVIKEMLSRLESEH 606          
BLAST of SCY1-like protein 2 vs. UniProt/SwissProt
Match: sp|Q6P3W7|SCYL2_HUMAN (SCY1-like protein 2 OS=Homo sapiens OX=9606 GN=SCYL2 PE=1 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 7.991e-56
Identity = 154/617 (24.96%), Postives = 295/617 (47.81%), Query Frame = 2
Query:   53 SLTTKISDSSINIKQSFNVQLITNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSN--SQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIY------IEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEF-RPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQEKID----SLQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKEY 1864
            S+  K+  +   +       ++ NP+ + F +     S G  L W+IF  T+    +E +VF F+KKL +K  K  + +I+ + L++ +Q L+ + H +LL V HPLEE+ D +AF TE +  SL+N+LGN   +      ++    + +   K+G+ Q+ E L +L++S++  H N +P  I++    +WK+ G  F    +N   Q   F    W   LP +  PN +Y+APE  L  +    SDM+SLG V+ +V++K     I     Q IY      +++++RLG         +PEE+R+ V+ +L+     RP+    + + +F+D   + L+    +  +   ++ +    L  +  ++P+ ++ + +   L +   N +   F  P + L+AE           E     ++  +  +   QE I      LQ +++L  K   D ++N ++P V+  LE     IQ     ++   +   +   + + L+          ++ +V+ + L CL  +++ LD   +   ILPFL +I    P VL+  L + K     +   IT + +A +++  L+P ++   L + +F S +  +  ML +++ E+
Sbjct:    3 SMLNKLKSTVTKVTADVTSAVMGNPVTREFDVGRHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKLIDKYQKFEKDQII-DSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWENLPSPISPDIKDYKLYDVETKYGLLQVSEGLSFLHSSVKMVHGNITPENIILNKSGAWKIMGFDFCVSSTNPSEQEPKFPCKEWDPNLPSLCLPNPEYLAPEYILSVSCETASDMYSLGTVMYAVFNK--GKPIFEVNKQDIYKSFSRQLDQLSRLG---SSSLTNIPEEVREHVKLLLNVTPTVRPDADQMTKIPFFDDVGAVTLQYFDTLFQRDNLQKSQFFKGLPKVLPKLPKRVIVQRILPCLTSEFVNPDMVPFVLPNVLLIAE-------ECTKEEYVKLILPELGPVFKQQEPIQILLIFLQKMDLLLTKTPPDEIKNSVLPMVYRALEAPSIQIQELCLNIIPTFANLIDYPSMKNALIPRIKNACLQTSSLAVRVNSLVCLGKILEYLDKWFVLDDILPFLQQIPSKEPAVLMGILGIYKCTFTHKKLGITKEQLAGKVLPHLIPLSIENNLNLNQFNSFISVIKEMLNRLESEH 606          
BLAST of SCY1-like protein 2 vs. UniProt/SwissProt
Match: sp|Q9P7X5|PPK32_SCHPO (Protein kinase domain-containing protein ppk32 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk32 PE=1 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 5.523e-39
Identity = 147/582 (25.26%), Postives = 273/582 (46.91%), Query Frame = 2
Query:  185 WRIFEATRSKDNEEFSVFYFEKKLAEKLHKPR------RREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNIL----GNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEE-LRKPVEKMLSFDVKYRPNPQLFSLLK--YFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEFRPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQEKID--SLQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIF--FSVNNK-SVQESILECLSCLIDN--LDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKEYWR 1870
            W ++ A++   NEE SVF F+KK    L K        +   V E LRKD+ +LS + H  LL+VV PLEE+  SM+F T +I   L + +    G       S+  + +   + E  ++ G+ QII+ L +L+ S +  H N  P ++++  +  WKL G  F Q    S    F+   +   +P   Q ++D++APE          SD+FS G +I S+++K   S+INA  +   Y +++  L       S  LP E L+  +++ L+ D K R +  +F L +  YF    I  L  L +  ++   ++V  + SL       P  I  + +   L++  H  ++     ++  + EI +     +F   +F  +  +I + N   E++     Q ++ L  K+      + ++PF++G  EN+  ++Q  +  ++G L    +   +      I PK++  FSV N+  V+ +IL+  +  I+   LD+  I  K+LP L K++   P V++     +  +       I  + +  Q++  L   +V+P L + ++   M  +  + + + K + +
Sbjct:   32 WTVYSASKKGTNEEVSVFTFDKKNLSTLLKRGSIDSNLKTNYVLELLRKDVSSLSRLRHPSLLQVVEPLEESKSSMSFVTRRIQSMLQDFIKSSNGGFSNYGSSANGKSSGNALEEVEIQKGLLQIIDGLVFLHGSAKVIHYNIRPSSVVVDAKGDWKLCGFSFSQSV-ESARYEFNDYDFG--IPSSLQQSMDFLAPEYITHEIAGPESDVFSFGCLIYSIFNKN-QSIINANNHLLSYEKEITSLNSPTFIESKNLPSENLKSLLKETLAVDPKQRAS--MFELERSPYFTGSAIAALRFLESFPEKLPSEKVSFMESLSKNLTTFPYRIQSQKILPTLLD--HLNDQKLVPSLLPCIFEISKGLDSSIFSSKVFTAIFPIISAANSYPERVPLCIFQYMDCLKSKLPSGEFLSKIVPFIYGCFENSSLNVQTTSIQILGTLLDIIDVTTVKSS---ICPKLYHSFSVTNQLDVKVAILDTFNVFINQKFLDSFAIVDKLLPVLEKVKTREPTVVMG----MVTVYISAGAIIPEETVHEQVIPRLWILSVSPSLSLEQYNKCMREIRSLSDAVQKSHAK 598          
BLAST of SCY1-like protein 2 vs. UniProt/SwissProt
Match: sp|Q55BQ3|SCY2_DICDI (Probable inactive serine/threonine-protein kinase scy2 OS=Dictyostelium discoideum OX=44689 GN=scy2 PE=3 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 3.594e-32
Identity = 154/634 (24.29%), Postives = 281/634 (44.32%), Query Frame = 2
Query:  170 GVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAV---------IDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGF---------------IQKYSNSQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIYIEKVNRLGI----------EFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEFRPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQE---KIDSLQLVN--MLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIF------FSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKI-QYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKEY------WRNHSSPNKNSQTNDDS 1915
            G +  W+I+++T+   N E S+F FEKKL EK+ K    E V   L+K+   L  + H  +L+VV  +EE    + FATE I  +L ++LG + +   S++ + +              E  LK GI+QI++ L +LN + +  H N SP +I IT    WKL G+GF               +Q     Q ++      SS       P LDY+APE   +  +   SD+FS+G +I  +        +  K   S  I ++ +LG+            ++ ++         V  +L  D   R + + F    +F D +   L  L NI+ +  + +++    L  I  Q    I    +   L++ I N      R I  LL  I+ IS+  +  E     ++  I +I  ++E   ++ S  L N  ML +K   D ++ IL+P   G +     +I     +    +++F + + I    + + P++       F V+   ++   ++  + L+ +++   I   +LP L KI   DN  V++ SL    + L K+   +  + +A  ++  L+P + +  + + +FK++M+ +  +L   ++E        + ++SP      ND S
Sbjct:   37 GQDKFWKIYQSTKKTTNTECSLFVFEKKLYEKVSK-SNLENVITFLKKEATTLQRLRHPSILQVVSVMEETKTHIHFATEPILATLEDLLGYYRQRKKSTVDQSSQSEEGYKKKDFTFEELELKAGIFQILDGLLFLNQTAKLLHRNISPESIFITKDLKWKLGGLGFTCSIETKEPPISNLSLQDLREYQYISGGGGGESSNNSNYILPQLDYLAPEFISQRKFETNSDLFSIGRLIFELSIN-----LEQKALDSHLISQLPKLGVISYYNTMIEQVRRQSTMNTQRSDSAKVCTILLGDPMLRGDLENFIRSSFFQDVLTKTLLYLANISQKEDESKLQFFRGLLRIVQQFSPRIQNNYILPVLLSEISND-----RIIYVLLPNIMSISANHVKKETFQSKVLPAISNILQSKEPKPEVLSCVLENLPMLLQKCSLDQIKKILLPICLGSMCGPTNEIIFQCLSTAQPIAKFFDTDMI---SVAVIPRLTNLCVGGFPVH---IRTKAIQWFTLLVPSIEKKIIVDSLLPNLEKILAGDNSPVILQSLVETYEALSKK---LGGELLAKSVLPALIPLSSDKHIDLEQFKTVMKVIRDILNTYEQERINELSNLQRYTSPTPTKDENDTS 650          
BLAST of SCY1-like protein 2 vs. UniProt/SwissProt
Match: sp|P53009|SCY1_YEAST (Protein kinase-like protein SCY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCY1 PE=1 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.507e-21
Identity = 131/531 (24.67%), Postives = 237/531 (44.63%), Query Frame = 2
Query:  233 VFYFEKKLAEK--LH------KPRRREIVC-----ECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLN--FSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIYIEKVNRLGIEFKEMSL-----KLPEELRKPVEKMLSFDVKYR-PNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHN-CEKG--EFRPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSIN-------DTQEKIDSLQLVNMLSEKMK-DDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILD------HLLMIFPKIFFSVNNKSVQESILECLSCLIDN--LDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQI 1705
            +F F+KK  E   LH      K   R+ V      E LR    NL+ + H  +L ++ PLEE++ +  F TE +  SL  +       + + +Q     +I    ++ GI Q++ AL +++    + H N  P  I I   + WK++G+G++ K     N +  F P  +  ++P      L+Y APEI  E+  +  +D FSLGL+I  +Y+     L  ++ + S Y  + N+   +   MS      K+P++LR  + K+++ D+  R  N  L    ++F DP++  L  L ++  +  +++   L  L  +  + P  +L K     L+  +   C +     + +   L  I++I S      F       L+   N        T   ID+L   + L +K+K  D L NIL P     L +++ DI V     +  LSQ      +LD       LL +   +F    + +V+ + + C   +I++  +D+    + +LP    ++  +P +L   L L + +
Sbjct:   47 IFMFDKKQFENYLLHYGIIKSKSGSRDKVLIQEAYEILRNQANNLAKLKHPNILTLIEPLEEHSKNFMFVTEFVTSSLETVFRETDDEEQNFLQGHVKDNIV---VQRGILQLVNALDFVHNRASFVHLNIQPRAIFINENSDWKISGLGYLVKIPPGTNTSEYFLP-QYDPRVPPFMHLQLNYTAPEIVFENTLTFKNDYFSLGLLIYFLYTG--KDLFRSENSTSEYKLEYNKFESKISTMSWDNIFSKVPQKLRHCIPKLINRDIYSRYDNITLILDSEFFQDPLVKTLNFLDDLPTKNNEEKYVFLEGLVNLLPEFPPALLQKKFLPILLELLSQFCAEKVVSDKCVGKSLDLIIKIGSTLSQLSFQEKVYPVLLSDANFPVLLKKATICLIDNL---DTLKQKVKRSDFLENILKPLFNYVLHDSESDITVVCQEKL--LSQIPLALEVLDFPTVKQFLLPLLSNLFTKTTSLTVKNTCVTCFQIMIEHKSIDSYTCSETVLPLFKSMKTRDPRILSKLLKLFETV 566          
BLAST of SCY1-like protein 2 vs. TrEMBL
Match: A0A3S1BIN6 (Protein kinase domain-containing protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_007528 PE=4 SV=1)

HSP 1 Score: 395.971 bits (1016), Expect = 3.833e-119
Identity = 216/586 (36.86%), Postives = 354/586 (60.41%), Query Frame = 2
Query:  119 TNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEFRPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQEKIDSLQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLL--MIFPK---IFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKE 1861
             NPI K+F+L  QTGS GVE+ W+I+EA R +D +E SVF FEK++A+KLHKPRRRE+V E LRKD+  L  + H K+L V+H LEE +DS+AFA+E +  SLSN+LG H R+      ++   D  E  +KHGI QI +AL Y++   +  H N  P+++L+  +  WK+ G GF +K  + +    +   WSSK+PKMAQP+L+++APE+QL    +  SDMFS+G+VICS+Y+    SLINA+ N ++Y+++++++   F E++ K+P +L +PVEKM++ D++YRP  QLFSLLKYFNDPV++ L  +   + +   +RVE  +SL  +   +P++IL+  V   +++     E   F   +  L  I+  ++   + + +  +   ++ +    Q  +  L  ++++  K   D ++  ++PFVF  L+++    Q A    +  +     +E + D++L  ++ PK   +FF  +N  ++ + L C+  L+D+LD   I   ILPFL  I   +P+V+   + + K +L  +   +T   IA ++M  L+P TVNP L + +F  LME L  ML+ +D +
Sbjct:  182 VNPILKHFSLGKQTGSAGVEMTWKIYEAVRLEDKKEASVFVFEKRIADKLHKPRRREVVAETLRKDVSYLEKLKHPKILTVLHGLEECHDSLAFASEPVFASLSNVLGIHERLPSPLPPDIRDHDFIELEIKHGIVQITDALSYIHNKERLVHCNLGPHSVLLNKKGGWKIFGFGFAEKIKDGKE-GCTGNPWSSKVPKMAQPDLNFMAPEVQLHKTCTPLSDMFSVGMVICSIYNMG-RSLINAEHNPNLYVKQMDQMHEAFGEVAHKMPLQLVEPVEKMINKDIRYRPTAQLFSLLKYFNDPVVISLHGMDMCDRREPAQRVEAYASLSQVVPNIPRKILYSYVLPDILSECRCPEAIIF--ALPTLLTIIDYATRADYVDIIMPEFRAILANNKPVQATVYILSKLDIILSKSPQDEIKVEVLPFVFNTLDSSSLQAQEAALNAVAVI-----REHLDDNILRKVVLPKAKSLFFRSSNVRIRINALTCIDHLLDSLDKMLILDNILPFLANISGQDPDVITCVVGIYKHMLSDKKFGLTHNLIATKVMPTLIPHTVNPGLSMEQFGGLMEVLRDMLDHVDTQ 758          
BLAST of SCY1-like protein 2 vs. TrEMBL
Match: A0A210PE94 (SCY1-like protein 2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT08501 PE=4 SV=1)

HSP 1 Score: 386.726 bits (992), Expect = 1.207e-116
Identity = 219/594 (36.87%), Postives = 356/594 (59.93%), Query Frame = 2
Query:   89 IKQSFNVQLITNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVY-SKCPHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCE--KGEFRPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQEKIDSLQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKE 1861
            IKQ+   +  +NPI KYF +  QTGSYG E++W+I++A R +D +E SV  FEKK+A+KLHKPRRRE V E LR+ +Q L    H +LL ++HPLEE+++S+AFATE +  SL+N+LG + R+   +  E+   +  ++ +++GI QI EAL YL+   Q  H N SP +ILIT + +WKLA + F +   + ++       WS+K+PKMAQP+L+YIAPE Q        SDMF+LG+VIC+++ +  P  LI A+ N + Y+++++++  +F +++ K+P  L +PVEKM++ D++YRP  Q F LLKYFNDP++ GL+ L NI+     +R E+ S +  I   +P++IL++ VF AL       +       P++ L+    R   +     F  + +    K +  T   +D L  V M   K   D +R+ ++PFVF  LE+     Q A    +G + ++ +   + + +L     ++   +N  V+ + L C+  L+D+L+   I  ++LPFL  I   +P++++A + + K +L  +   +T   IA ++M  L+P TVNP L + +F +LME L  MLE+ID++
Sbjct:    7 IKQTITSE-DSNPITKYFEIGRQTGSYGPEMVWKIYDAVRKEDKKEASVCIFEKKIADKLHKPRRRETVSEILRQGVQLLEKFKHPRLLGILHPLEESHNSLAFATEPLFASLANVLGRYDRIPTPAPPEIRDHEFLDYEIQYGILQITEALCYLHAVEQMVHKNVSPQSILITKRGTWKLAALCFAETVRDGKDSVIC-HPWSTKVPKMAQPDLNYIAPETQNSKYCYFLSDMFALGMVICTIFNTGVP--LIEAEHNTTTYLKQLDQIPEKFSDVAHKMPLPLVEPVEKMINKDIRYRPTAQFFCLLKYFNDPILRGLQQLDNIDIMEYCQRAEVYSFVAQIIPSIPKKILYRHVFPALCLECSTADTITSALSPLLTLIDFATREEYVEKILPFFRLIMNSP-KPVQATVYILDKLDTVLM---KSPADEIRSEVLPFVFNSLESNSLQAQEAALNAIGIIKEYLDDGVMRNMVLPRAKALYHKGSNVRVKLNALSCIDYLLDSLNKMIILDEVLPFLTDITGHDPDIVMAVVGIYKHMLSDKKFGLTHNLIATKVMPPLIPHTVNPGLSMEKFGALMEVLREMLEQIDRK 592          
BLAST of SCY1-like protein 2 vs. TrEMBL
Match: V4BF47 (Protein kinase domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_127669 PE=4 SV=1)

HSP 1 Score: 377.481 bits (968), Expect = 1.008e-115
Identity = 215/602 (35.71%), Postives = 359/602 (59.63%), Query Frame = 2
Query:  119 TNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVI-----------------DINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESL---LNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEFRPI-IDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQEKIDSLQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKE 1861
            +NPI K++ L+ Q G+ G E +W+IFEA R +D++E SVF+FEKK+A+KLHKPRRRE V E LRKD+  LS I H K++ + H +EE +DS+AFATE I  SLSNILGN+ RM  +  QEL ++                 +  +  +K+GI+QI EAL +L++S    H N  P +ILIT + +WKLA +GF++K    +    S  SW++K+PKMAQP+L++IAPE+QLE   +  SDMFSLG+VIC++Y+    SLI+A     +Y+++++++   F  ++ ++P +L +PVEKM++ D +YRP  QLFS+LKYF DPV+ GL+ L   +  + +   +R E  ++L  +   MP++IL++ VF  L     +C+ GE     +  +  ++  +    + + +  +  +++ S    Q  +  L  ++++  K   + +++ ++P VF  L++     Q A  +    + ++ +   I   +L     +F+   N  ++ + L C+  ++D+L    I  ++LPFL  I   + +V++A + + K +L  +   +T   IA ++M  L+P TVNP L + +F  LME L  MLE+ID++
Sbjct:   11 SNPILKHYDLQRQVGTAGPENVWKIFEAIRLEDSKEASVFWFEKKVADKLHKPRRRETVSEILRKDVTQLSRIRHPKIISIQHGVEECHDSLAFATEPIFASLSNILGNYERMPANIPQELKIMQKRNIFGMRRVPFTGDHEFIDMEIKYGIFQITEALSFLHSSEHLIHRNVCPQSILITKRGAWKLASLGFVEKTKEGK--KSSCQSWTTKIPKMAQPDLNFIAPEVQLEKICTPLSDMFSLGMVICAIYNSG-KSLISADHLPGLYVKQLDQMHETFGIVAHRMPLQLVEPVEKMINRDTRYRPTAQLFSMLKYFTDPVVSGLQLLDAAVAADRKDPVQRAEAYANLSQVIPIMPRKILYRNVFPTL---CQDCKSGESMVFALPAMLTMIDFAPRDDYIDIILPEFRNIMSSSKPVQATVYILNKLDIILSKTPLEEIKSEVLPLVFNTLDSQSLQAQEAALSAFSVIKEYLDDNIIRKMVLPRAKSLFYRSTNVRLRINALTCIDHMLDSLGKMLILDEVLPFLTDITCQDADVVMAVVGVYKHMLSDKKFGLTHNLIATKVMPSLIPHTVNPGLSMEQFGDLMEVLREMLEQIDRQ 606          
BLAST of SCY1-like protein 2 vs. TrEMBL
Match: A0A2T7NRI7 (Protein kinase domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_17064 PE=4 SV=1)

HSP 1 Score: 377.096 bits (967), Expect = 1.450e-113
Identity = 223/590 (37.80%), Postives = 355/590 (60.17%), Query Frame = 2
Query:  119 TNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPVS-WSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEFRPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSIN---DTQEKIDSLQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLL--MIFPK---IFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKE 1861
             NPI  YF L  QTGS G EL W+IFEA R +D +E SVF FEKK+A+KLHKPRRR++V E L+K+   L    H ++L +VH +EE +DS+AFATE +  SL+N+LGN+ R+  +  QE+   D  E  +K GI QI EAL +L+++ Q  H N +P +IL+T +  WKLAG  F +K  + +    SPV  W++K+PKMAQP+L+++ PE+QL    S  SDMFSLG+V+C++Y+   HSLI A  N ++Y+++++++   F  ++ K+P  L +PVEKM++ D++YRP+  LFSLLKYFND V++ L +L   + +    R E    L  +   +P+++L+K V   +++   +C+   F  II  L  ++ I      D++  + L D    +      Q  +  L  ++++  K   + +R  ++P VF  L+++    Q A    +G +     KE++ D++L  M+ PK   +FF   N  ++ + L C+  L+++LD   I   +LPFL  I   +P+V+V  + + K +L  +   +T   +A ++M  L+P TVNP L + +F SLME L  MLE++DK+
Sbjct:   45 VNPITNYFDLGRQTGSAGPELAWKIFEAVRKEDKKEVSVFLFEKKIADKLHKPRRRDVVTEVLKKEPWYLERFRHPQILGLVHGIEECHDSIAFATEPVLASLANVLGNYERLPANIPQEIKDHDFIEMEIKLGILQIAEALSHLHSTEQLIHRNVNPQSILLTYRGVWKLAGFYFAEKIKDGK--ESSPVQPWTNKVPKMAQPDLNFLPPEMQLGRTCSPLSDMFSLGMVVCAIYNAG-HSLIAADHNPNLYVKQLDQMHDMFGVVAHKMPMALVEPVEKMINKDLRYRPSAHLFSLLKYFNDTVVINLHALACTDRRDPAGRAEAYVGLSQVIPNIPRKVLYKHVLPTVVD---DCKM--FDSIIYALPTLLTIIDFATRDDYCDLILRDFCTVLGMPKPVQATVYILNKLDIILTKTPLEDIRTEILPMVFNTLDSSSLQAQEAAIAAIGVV-----KEYLDDNILRKMVLPKAKSLFFRSTNVKMRINALSCVDHLLESLDKMLILDDVLPFLTDITCQDPDVIVTIVSIYKHMLSDKRFGLTHNLLATKVMPSLIPHTVNPGLNMEQFSSLMEVLRDMLEQVDKQ 621          
BLAST of SCY1-like protein 2 vs. TrEMBL
Match: A0A267ELE3 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022417g1 PE=4 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 1.981e-106
Identity = 205/581 (35.28%), Postives = 339/581 (58.35%), Query Frame = 2
Query:  122 NPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFI--QMPQEILFKVVFKALINRIHNCEKGEFRP-IIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQEKIDSLQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKID 1855
            NPI K F LR QTGS G E +W++ +A R  D +E S+F F+KK+AEKLHKP+R+E V E LR++I+ L    H KLL++ HP+EE N+++AFATE +  SL+N LGNH R+      EL      +  +KHGI+Q+ EAL+YL+++ +  H N +  ++LIT +  WKL+G+GF++K S+S + +F+   W+ KLPKMAQP+LD++AP++Q+    ++  D+FSLGLVI +V++    SL++A+ +   Y  +V  L +   +   +LP EL   +EKML  D K+RP+ QL S+ KYF DP++L LE L     + ++++ E    L    +  Q P+ ILFK V   +   +      +  P ++  L      S    F   L   L+ +++     Q  +  ++  ++L EK+ D+ +R  L+P VF  LE++    Q A       L    +   +   +L     +F   ++  ++ + L CL  L+D LD   I + +LPFL+ I + +P++ +A +++ K++L  +   +T   IA +++  L+P TVNP L+  +F+ +METL+ M  +++
Sbjct:   24 NPICKLFQLRRQTGSAGQEQLWKVIDAVRHDDGKECSIFIFDKKIAEKLHKPKRKETVSEVLRREIRYLERFKHPKLLQIWHPVEECNENLAFATEPVWGSLANFLGNHERIAQPVPSELKE-GFTDLEIKHGIHQVNEALKYLHSTQKVIHGNLNLGSVLITKRGCWKLSGLGFVEKSSSSHD-SFNFTQWTPKLPKMAQPDLDFMAPDLQIHGKATQACDIFSLGLVIHAVFNGGV-SLLDARRSCQQYHRRVEELPVNLPKALTQLPCELSDLLEKMLDRDPKHRPSAQLLSMNKYFQDPLLLALEGLTTCEAKTMEQKKEFFGLLMQTMMREQFPKSILFKRVCPLIAENLQVA--ADLTPYVLPCLLRAAMQSGPEEFRLHLREPLLAVLRRPKTAQTSVVLVEHTDVLVEKLDDEEIRGDLLPLVFSTLESSSATGQEAALNSFSVLQDHIDNATLRKLILPKAKSVFQRSSSLMMRMNALACLEQLMDRLDKMTILEDLLPFLLDISFSDPDIYMAVINIYKRMLTDKKFGLTYNVIATKVLPHLIPYTVNPNLRRDDFRCVMETLNAMWSRLE 599          
BLAST of SCY1-like protein 2 vs. Ensembl Cavefish
Match: si:ch211-244b2.1 (SCY1 like pseudokinase 2 [Source:NCBI gene;Acc:103035475])

HSP 1 Score: 201.83 bits (512), Expect = 3.183e-53
Identity = 146/612 (23.86%), Postives = 291/612 (47.55%), Query Frame = 2
Query:   53 SLTTKISDSSINIKQSFNVQLITNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPV--SWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKC-PHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEF-RPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQEKID----SLQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKEY 1864
            S+  K+  +   +       ++ NP+ + F +     S G  + WRI+  T+    +E +VF F+KK+ ++  K  + +I+ + L+K +Q L+ + H +LL V HPLEE+ D +AF TE +  SL+N+LG    +      ++    + +   K+G+ QI E L +L++ ++  H N  P  I++    +WK+ G  F    SN  +     V   W    P +  PN +Y+APE  L  +    SDM+SLG+V+ +V+++  P   +N +     +  ++++L      +  K+P+E+R+ V+ +LS     RP+    + + +F+D   + L+   ++  +   ++ +    L  +  ++P+ ++   +  AL +   N +   F  P + L+AE           E     ++  +  +   QE I      LQ +++L  K   + ++N ++P V+  LE     IQ     ++   +   +   + + L+          ++ +V+ + L CL  +++ LD   +  +ILPFL +I    P VL+  L + K     +   I  + +A + +  LV  ++   L + +F S M  +  ML +++ E+
Sbjct:    3 SMLNKLKSTVTKVTADVTSAVMGNPVTREFEVGRHIASGGPGMCWRIYNGTKKSTKQEVAVFVFDKKIVDRYQKFEKDQII-DSLKKGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGQWDNLPSPVPTDIKDYKLYDVETKYGLLQISEGLSFLHSGVKMVHGNLCPENIILNKSGAWKIMGFDFSISSSNPSDAEPKYVCKEWDPNSPPLCLPNPEYVAPEYILSVSCDSASDMYSLGVVVHAVFNEGKPVFRVNKQDIFKSFSRQLDQLSRLSPGVLSKIPDEVREHVKMLLSVTANVRPDADQMTKIPFFDDVGAVTLQYFDSLFQRDNLQKSQFYKGLPKVLPKLPKRVVVYRILPALTSEFVNPDMVPFVLPNVLLIAE-------ECTKEEYVRLILPDLTPVFKQQEPIQILLIFLQKMDLLLTKTPPEDIKNSVLPMVYRALEAPSIQIQELCLNIIPSFANLIDYPSMKNALIPRIKSACLQTSSLAVRVNSLVCLGKILEYLDKWFVIDEILPFLQQIPSREPAVLMGILGIYKCTFAHKKLGIPKEHLAGKSVPHLVSISIENNLNLNQFNSFMAVIREMLNRMEAEH 606          
BLAST of SCY1-like protein 2 vs. Ensembl Cavefish
Match: si:ch211-244b2.1 (SCY1 like pseudokinase 2 [Source:NCBI gene;Acc:103035475])

HSP 1 Score: 201.83 bits (512), Expect = 3.352e-53
Identity = 146/616 (23.70%), Postives = 292/616 (47.40%), Query Frame = 2
Query:   53 SLTTKISDSSINIKQSFNVQLITNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPV--SWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKC-PHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEF-RPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQEKIDS--------LQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKEY 1864
            S+  K+  +   +       ++ NP+ + F +     S G  + WRI+  T+    +E +VF F+KK+ ++  K  + +I+ + L+K +Q L+ + H +LL V HPLEE+ D +AF TE +  SL+N+LG    +      ++    + +   K+G+ QI E L +L++ ++  H N  P  I++    +WK+ G  F    SN  +     V   W    P +  PN +Y+APE  L  +    SDM+SLG+V+ +V+++  P   +N +     +  ++++L      +  K+P+E+R+ V+ +LS     RP+    + + +F+D   + L+   ++  +   ++ +    L  +  ++P+ ++   +  AL +   N +   F  P + L+AE           E     ++  +  +   QE I +        LQ +++L  K   + ++N ++P V+  LE     IQ     ++   +   +   + + L+          ++ +V+ + L CL  +++ LD   +  +ILPFL +I    P VL+  L + K     +   I  + +A + +  LV  ++   L + +F S M  +  ML +++ E+
Sbjct:    3 SMLNKLKSTVTKVTADVTSAVMGNPVTREFEVGRHIASGGPGMCWRIYNGTKKSTKQEVAVFVFDKKIVDRYQKFEKDQII-DSLKKGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGQWDNLPSPVPTDIKDYKLYDVETKYGLLQISEGLSFLHSGVKMVHGNLCPENIILNKSGAWKIMGFDFSISSSNPSDAEPKYVCKEWDPNSPPLCLPNPEYVAPEYILSVSCDSASDMYSLGVVVHAVFNEGKPVFRVNKQDIFKSFSRQLDQLSRLSPGVLSKIPDEVREHVKMLLSVTANVRPDADQMTKIPFFDDVGAVTLQYFDSLFQRDNLQKSQFYKGLPKVLPKLPKRVVVYRILPALTSEFVNPDMVPFVLPNVLLIAE-------ECTKEEYVRLILPDLTPVFKQQEPIQASNMILLIFLQKMDLLLTKTPPEDIKNSVLPMVYRALEAPSIQIQELCLNIIPSFANLIDYPSMKNALIPRIKSACLQTSSLAVRVNSLVCLGKILEYLDKWFVIDEILPFLQQIPSREPAVLMGILGIYKCTFAHKKLGIPKEHLAGKSVPHLVSISIENNLNLNQFNSFMAVIREMLNRMEAEH 610          
BLAST of SCY1-like protein 2 vs. Ensembl Cavefish
Match: si:ch211-244b2.1 (SCY1 like pseudokinase 2 [Source:NCBI gene;Acc:103035475])

HSP 1 Score: 194.897 bits (494), Expect = 4.995e-51
Identity = 146/612 (23.86%), Postives = 289/612 (47.22%), Query Frame = 2
Query:   53 SLTTKISDSSINIKQSFNVQLITNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPV--SWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKC-PHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEF-RPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQEKID----SLQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKEY 1864
            S+  K+  +   +       ++ NP+ + F +     S G  + WRI+  T+    +E +VF F+KK+ ++  K  + +I+ + L+K +Q L+ + H +LL V HPLEE+ D +AF TE +  SL+N+LG    +      ++    + +   K+G+ QI E L +L++ ++  H N  P  I++    +WK+ G  F    SN  +     V   W    P +  PN +Y+APE  L  +    SDM+SLG+V+ +V+++  P   +N +     +  ++++L      +  K+P+E+R+ V+ +LS     RP+    + + +F+D   + L+   ++  +   ++ +    L  +  ++P+ ++   +  AL +   N +   F  P + L+AE           E     ++  +  +   QE I      LQ +++L  K   + ++N ++P V+  LE     IQ     ++   +   +   + + L+          ++ +V+ + L CL  +++ LD   +  +ILPFL +I    P VL+        IL      I  + +A + +  LV  ++   L + +F S M  +  ML +++ E+
Sbjct:    3 SMLNKLKSTVTKVTADVTSAVMGNPVTREFEVGRHIASGGPGMCWRIYNGTKKSTKQEVAVFVFDKKIVDRYQKFEKDQII-DSLKKGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGQWDNLPSPVPTDIKDYKLYDVETKYGLLQISEGLSFLHSGVKMVHGNLCPENIILNKSGAWKIMGFDFSISSSNPSDAEPKYVCKEWDPNSPPLCLPNPEYVAPEYILSVSCDSASDMYSLGVVVHAVFNEGKPVFRVNKQDIFKSFSRQLDQLSRLSPGVLSKIPDEVREHVKMLLSVTANVRPDADQMTKIPFFDDVGAVTLQYFDSLFQRDNLQKSQFYKGLPKVLPKLPKRVVVYRILPALTSEFVNPDMVPFVLPNVLLIAE-------ECTKEEYVRLILPDLTPVFKQQEPIQILLIFLQKMDLLLTKTPPEDIKNSVLPMVYRALEAPSIQIQELCLNIIPSFANLIDYPSMKNALIPRIKSACLQTSSLAVRVNSLVCLGKILEYLDKWFVIDEILPFLQQIPSREPAVLMG-------ILASLFTGIPKEHLAGKSVPHLVSISIENNLNLNQFNSFMAVIREMLNRMEAEH 599          
BLAST of SCY1-like protein 2 vs. Ensembl Cavefish
Match: cdk6 (cyclin dependent kinase 6 [Source:NCBI gene;Acc:103047757])

HSP 1 Score: 53.5286 bits (127), Expect = 4.352e-7
Identity = 39/142 (27.46%), Postives = 68/142 (47.89%), Query Frame = 2
Query:  443 NHVRMDLSSIQELAV-IDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQ 865
             HV  DL++  E A    +    +K  +YQ+++ L +L+ S +  H +  P  IL+T+    KLA  G  + YS    L    V+            L Y APE+ L+S+Y+   D++S+G +   ++ + P    N+  +Q
Sbjct:   96 EHVDQDLTTYLEKAPDPGVPPETIKDMMYQLLQGLDFLH-SHRVVHRDLKPQNILVTSGGQIKLADFGLARIYSFQMALTSVVVT------------LWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRRPLFRGNSDVDQ 224          
BLAST of SCY1-like protein 2 vs. Ensembl Cavefish
Match: scyl1 (SCY1 like pseudokinase 1 [Source:NCBI gene;Acc:103037485])

HSP 1 Score: 53.5286 bits (127), Expect = 1.005e-6
Identity = 58/275 (21.09%), Postives = 105/275 (38.18%), Query Frame = 2
Query:  182 IWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPVSWSSKLPKMAQPNLD-YIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLF 1003
            IW +    R    E  S+F +E  +A+        E   +  +   + +  + H  +L  V  LE  + S+   TE +       L  H++    S          E  +  G++Q ++AL +L       HNN   + I +     WKL G+  +      +  +  P        K+  P+L+ Y  PE         + D++ LG +I  V++     L  A + +S+                 K+P++L     +++  + K RPNP  F
Sbjct:   27 IWTLHRGKRKTTGEPVSIFLYE--VAQGT------EEQTQLAKAAFKRMKTLRHPNILSYVDGLE-TDKSLYLVTEPV-----TPLAAHLKARSESGGS------GELEISWGLHQTVKALSFLVNDCHLLHNNLGTWAIFVDRAGEWKLGGLDHVTS-DQGEPTSLPPA-------KVVNPDLEKYDPPESPNSGGEKWSGDVWRLGCLIWEVFNG---PLPRASSLRSLG----------------KIPKQLVPHYCELVGANPKARPNPARF 254          
BLAST of SCY1-like protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003368.1 (pep scaffold:Pmarinus_7.0:GL479057:9948:36045:-1 gene:ENSPMAG00000003073.1 transcript:ENSPMAT00000003368.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 218.009 bits (554), Expect = 3.917e-59
Identity = 155/614 (25.24%), Postives = 304/614 (49.51%), Query Frame = 2
Query:   56 LTTKISDSSINIKQSFNVQLITNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSN--SQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQ-----SIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEFRPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQEKIDS----LQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKEY 1864
            L + ++  + ++  + +V ++ NP+ + F +     S G  L W+I+   +    +E +VF FEKK  ++L +   RE   E L++ +Q L+ + H +LL V HP+EE+ D +AF TE +  SLSN+LG H  +      E+    +++   K+G+ Q+ E L +L+  ++  H N +P  I++    +WK+ G  F    SN   + + F+   W   LP M QP ++++APE  L  +    SDM+SLG+++ +V++K         T+      S +++K++ LG    +   K+PE++R  ++ +L+     RP+    + + YF+D   + L+ L ++  +   ++ +    L  +  ++P+ ++ + V  +L     N +   F     +L  ++ I+     +E++ M L DLI  +   QE I      LQ +++L  K   + ++  ++P +F  LE     IQ     ++   +       + + L+           + +V+ + L CL  L++++D   +  +ILPFL +I    P VL+  L + K     +   IT + +A + +  L+P  ++  L + +F S M  +  ML K++ E+
Sbjct:    8 LKSTVTKVTADVTSAVSV-VLGNPVTREFEITRHVASGGPALSWKIYHGFKKSTKQEVAVFVFEKKQVDRLGR-TEREHAVEVLKRGVQQLTRLRHPRLLTVQHPIEESRDCLAFCTEPVFASLSNVLGQHENLPCPVPLEIRDHQLHDVETKYGLLQLAEGLSFLHNGVKMVHGNLTPENIVLNKNGAWKIMGFDFCISSSNPSEREVAFTCKEWVPDLPPMCQPRIEFLAPEYILSVSCDVASDMYSLGMLMYAVFNKGQPIFQMDGTHDMFKSFSRHLDKLSNLGPSVMQ---KVPEDVRDHLKMLLNVTPTVRPDADQLAKIPYFDDVGAMTLQYLDSLFQRDNLQKSQFFKGLSKVLSKLPKRVVQQRVLPSLTTEFVNPDMVPF-----VLPNVLLIAEDCTKEEYVRMVLPDLI-PVFKLQEPIQVLLIFLQKMDLLLTKTPAEDIKQHVLPMIFRALEAPSTQIQELCLGIIPTFANLIEYPSMKNALIPRIKNSCLQTTSLAVRVNALVCLGKLLEHMDKWYVLDEILPFLQQIPSKEPAVLMGILGIYKCTFSHKKLGITKEILAGKALPHLIPLCIDNNLNLNQFNSYMGMIREMLSKVESEH 610          
BLAST of SCY1-like protein 2 vs. Ensembl Sea Lamprey
Match: cdk4 (cyclin-dependent kinase 4 [Source:ZFIN;Acc:ZDB-GENE-060929-974])

HSP 1 Score: 53.5286 bits (127), Expect = 1.076e-7
Identity = 48/176 (27.27%), Postives = 79/176 (44.89%), Query Frame = 2
Query:  326 LSNIYHNKLLKVVHPLEENN-----DSMAFATEKIHCSLSNILGNHVRMDLSSIQELA-VIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCP 835
            LS I    LL+ +   E  N     D  A +       L+ +   HV  DLS+  E A    +    +K  ++Q++  L +L+T  +  H +  P  IL+T+    KLA  G  + YS    L    V+            L Y APE+ L+S+Y+ T D++S+G +   ++ + P
Sbjct:   58 LSTIREVALLRQLETFEHPNVVRLFDVCATSRTDRETRLTLVF-EHVDQDLSTYLEKAPAPGLPADKIKDMMHQLLSGLDFLHTH-RVVHRDLKPQNILVTSDGQVKLADFGLARIYSFQMALTSVVVT------------LWYRAPEVLLQSSYATTVDLWSVGCIFAEMFRRRP 219          
BLAST of SCY1-like protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006430.1 (pep scaffold:Pmarinus_7.0:GL483757:727:12608:1 gene:ENSPMAG00000005813.1 transcript:ENSPMAT00000006430.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 3.748e-6
Identity = 57/241 (23.65%), Postives = 98/241 (40.66%), Query Frame = 2
Query:  320 QNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPVSWSSKLPKMAQPNLDYIAPEI--QLESNYSE-------TSDMFSLGLVICSVYSK---CPHSLINAKTNQSIYIEKVNRLGIEFKEMSL------------KLPEELRKPVEKMLSF 970
            Q L  I H +L + V      ++ +    E    S+  IL   VR+    + ++A             YQ++E L  LN     +H   SP+ IL+T Q   KLA  G     +    ++F           + +P+  Y+APE+  Q  + + E        SD++SLG+++  ++      P + I  K      ++ + +LG E   ++              LPE+LR  + K L F
Sbjct:   43 QVLKTITHPRLCQYVDIARGKHERLMVVLEHHEDSVERILSEGVRLSTQKLMQIA-------------YQVLEGLENLNGR-GIDHAAISPHNILLTMQGDVKLAKFGIYYMTNGGTAVDF----------PIGEPS--YMAPEVVAQGPARHGEKRAPIGPKSDVWSLGIILLQLWLGEKLWPRASIAEK------MKAIVKLGSEHDVVAAMLRAHGGSHSAEDLPEDLRSLLGKCLVF 251          
BLAST of SCY1-like protein 2 vs. Ensembl Yeast
Match: SCY1 (Putative kinase; suppressor of GTPase mutant; similar to bovine rhodopsin kinase; may have a role in intracellular sterol transport [Source:SGD;Acc:S000003051])

HSP 1 Score: 103.99 bits (258), Expect = 3.610e-23
Identity = 131/531 (24.67%), Postives = 237/531 (44.63%), Query Frame = 2
Query:  233 VFYFEKKLAEK--LH------KPRRREIVC-----ECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLN--FSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIYIEKVNRLGIEFKEMSL-----KLPEELRKPVEKMLSFDVKYR-PNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHN-CEKG--EFRPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSIN-------DTQEKIDSLQLVNMLSEKMK-DDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILD------HLLMIFPKIFFSVNNKSVQESILECLSCLIDN--LDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQI 1705
            +F F+KK  E   LH      K   R+ V      E LR    NL+ + H  +L ++ PLEE++ +  F TE +  SL  +       + + +Q     +I    ++ GI Q++ AL +++    + H N  P  I I   + WK++G+G++ K     N +  F P  +  ++P      L+Y APEI  E+  +  +D FSLGL+I  +Y+     L  ++ + S Y  + N+   +   MS      K+P++LR  + K+++ D+  R  N  L    ++F DP++  L  L ++  +  +++   L  L  +  + P  +L K     L+  +   C +     + +   L  I++I S      F       L+   N        T   ID+L   + L +K+K  D L NIL P     L +++ DI V     +  LSQ      +LD       LL +   +F    + +V+ + + C   +I++  +D+    + +LP    ++  +P +L   L L + +
Sbjct:   47 IFMFDKKQFENYLLHYGIIKSKSGSRDKVLIQEAYEILRNQANNLAKLKHPNILTLIEPLEEHSKNFMFVTEFVTSSLETVFRETDDEEQNFLQGHVKDNIV---VQRGILQLVNALDFVHNRASFVHLNIQPRAIFINENSDWKISGLGYLVKIPPGTNTSEYFLP-QYDPRVPPFMHLQLNYTAPEIVFENTLTFKNDYFSLGLLIYFLYTG--KDLFRSENSTSEYKLEYNKFESKISTMSWDNIFSKVPQKLRHCIPKLINRDIYSRYDNITLILDSEFFQDPLVKTLNFLDDLPTKNNEEKYVFLEGLVNLLPEFPPALLQKKFLPILLELLSQFCAEKVVSDKCVGKSLDLIIKIGSTLSQLSFQEKVYPVLLSDANFPVLLKKATICLIDNL---DTLKQKVKRSDFLENILKPLFNYVLHDSESDITVVCQEKL--LSQIPLALEVLDFPTVKQFLLPLLSNLFTKTTSLTVKNTCVTCFQIMIEHKSIDSYTCSETVLPLFKSMKTRDPRILSKLLKLFETV 566          
BLAST of SCY1-like protein 2 vs. Ensembl Nematostella
Match: EDO42744 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0J5])

HSP 1 Score: 229.18 bits (583), Expect = 7.278e-65
Identity = 158/591 (26.73%), Postives = 291/591 (49.24%), Query Frame = 2
Query:  113 LITNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLN-FSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKC--PHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEFRPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQEKIDS----LQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKEY 1864
            L+ NP+ K + +     S+G  L W++FE       +E S+  FEK+L + + K R R++V E ++K    L+ + H +LL + H +EE+ D +AFATE I  SLSN+LG H  M      E A  ++ +    +G+YQ++E L +L+   +    N SP  I+IT    WK+AG+ F    +  +  + +S   W  +L  +AQP+L+Y APE  L      +SDM+SLG +I +VY+K   P+   N  T     +E+V  +      +   +P  L+  V  +LS     RP+    + + +F +   L L+ L ++  +    + +   SL  +  ++P+ ++ + V   L  ++ N +   F     +L  I+ I+      E     ++  +K +   QE +      LQ +++L  K   DS+R+ ++P VF  LE +   IQ     ++ K +   +   + + ++     +    ++ SV+ + L C   ++++LD   + + ILPFL +I       L+A L + KQ +  +   +   ++A + +  L P  V P L + +F   M+ L  M+++++ E+
Sbjct:   11 LVGNPLTKDYEVGKHVASFGPNLAWKVFEGKAKTTGQEASLVVFEKRLLDTVDK-RDRDVVLELMKKGAVQLTRLRHPRLLLIQHAMEESRDCLAFATEPIFASLSNVLGRHDNMPSPPPPEFANFEMYDVERVYGLYQLVEGLMFLHNDAKILQGNLSPENIVITKNGQWKIAGLFFSSTPTIVEGQSTYSGCEWEPRLYPLAQPDLNYAAPEFILSRTCDTSSDMYSLGALIHAVYNKGAPPYQCDNNMTAFKRNVEQVCLMSKSHASLG-SVPGSLKSQVHSLLSMTPSLRPDCHQMAKIPFFENVAALTLQYLDSLMQRDDVAKTQFFKSLYKVMPKLPRRVVMQRVLPQLCLQLSNLQVIPF-----VLPNILLITE-DCTAEEYTKLILPELKPVFKVQEPVQVTIIFLQKLDLLLSKTPKDSVRDDVLPMVFRALEASSIQIQEMVLNVIPKFASMVDYPSMKNAVIPRIKTLCLQTSSLSVRVNCLVCFGKILEHLDKYLVIEDILPFLAQIPSREAPTLMAILGIFKQTMVHKKLGMDKDYLAMRAIPYLFPLAVEPSLNLKQFSQYMKLLGDMIKRVEVEH 593          
BLAST of SCY1-like protein 2 vs. Ensembl Nematostella
Match: EDO37567 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFE6])

HSP 1 Score: 53.1434 bits (126), Expect = 2.290e-7
Identity = 35/136 (25.74%), Postives = 68/136 (50.00%), Query Frame = 2
Query:  431 NILGNHVRMDLSSIQELAV-IDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCP 835
            N++  HV  DL++  E      + E+ +K   YQI+  + +L+T  +  H +  P  IL+T     K+A  G  + Y ++  L    V+            L Y APE+ L+S+Y+ + D++S+  ++  ++++ P
Sbjct:   88 NLVFEHVDQDLAAYLEYCPQPGLGEWKIKDLTYQILNGVDFLHTH-RIVHRDIKPQNILVTKDGQVKIADFGLARVYKDAMALTSVVVT------------LWYRAPEVLLQSSYATSVDIWSVACILAELFNRRP 210          
BLAST of SCY1-like protein 2 vs. Ensembl Nematostella
Match: OBSCURIN (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGL2])

HSP 1 Score: 50.447 bits (119), Expect = 1.808e-6
Identity = 55/244 (22.54%), Postives = 109/244 (44.67%), Query Frame = 2
Query:  104 NVQLITNPIKKYFTLRSQ--TGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQEL--AVID---INEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSW--KLAGMGFIQKYSNSQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLV 808
            +V L ++ I KY+T++ +   G +GV     + +    K  ++F+  +       K  KP+ RE V      +++ ++ I H +LL++    E  +                       M+L +  EL   V++   I+E ++ H + QI+E L +++   +  H +  P  I+I  Q+S   KL   G  +KY+  +NL            K+     +++APE+      +  +DM+S+G++
Sbjct:    9 DVVLKSDAITKYYTIKDELGKGRFGV-----VCKCVNKKTGKQFAAKFI------KCSKPQDREDVIH----EMEIMNTIRHKRLLRLADAFETPSQQEMILV----------------MELVTGGELFEKVVEEEFISENDVTHYMKQILEGLEHMHKQ-EVLHLDLKPENIMIVKQDSRQIKLIDFGLARKYNPKENL------------KVMFGTPEFVAPEVLTYDRITPATDMWSIGVI 208          
BLAST of SCY1-like protein 2 vs. Ensembl Medaka
Match: si:ch211-244b2.1 (SCY1 like pseudokinase 2 [Source:NCBI gene;Acc:101171295])

HSP 1 Score: 203.756 bits (517), Expect = 7.234e-54
Identity = 148/622 (23.79%), Postives = 296/622 (47.59%), Query Frame = 2
Query:   53 SLTTKISDSSINIKQSFNVQLITNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNL--NFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKC-PHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEF-RPIIDLLA------EIVRISSIXXXXXXXXXXXXXXIKSINDTQEKIDS--------LQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKEY 1864
            S+  K+  +   +       ++ NP+ + F +     S G  L WRI+  T+    +E +VF F+KK+ +K  K  + +I+ + L+K +Q L+ + H +LL V HPLEE+ D +AF TE +  SLSN+LG    +     +++    + +   K+G+ QI E L +L++ ++  H N  P  I++    +WK+ G  F    +N  +    ++   W   LP +  PN +Y+APE  L  +    SDM+SLG+V+ +V+++  P   +N       +  ++++L      +  K+PEE+R+  + +LS     RP+    + + +F+D   + L+   ++  +   ++ +    L  +  ++P+ ++   +  AL +   N +   F  P + L+A      E VR+             +M  +  +   QE + +        LQ +++L  K   + ++N ++P V+  +E     IQ     ++   +   +   + + L+          ++ +V+ + L CL  +++ LD   +  +ILPFL +I    P VL+  L + K     +   I  + +A + +  LV  +++  L + +F S M  +  ML +++ E+
Sbjct:    3 SMLNKLKSTVTKVTADVTSAVMGNPVTREFEVGKHIASGGPGLCWRIYNGTKKSTKQEVAVFVFDKKMIDKYQKFDKDQII-DSLKKGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLSNVLGQWDNLPSPVPKDIKEYKLYDVETKYGLLQISEGLSFLHSGVKMVHGNLCPENIILNKSGAWKIMGFDFSISSTNPSDAEPKYTCKEWEPNLPPLCLPNPEYLAPEYILSVSCDSASDMYSLGVVMHAVFNEGKPVFQVNKHDIFKSFSRQLDQLSSMSPTVLGKIPEEVREHAKMLLSVTPNVRPDADQITKIPFFDDVGAVTLQYFDSLFQRDNLQKSQFYKGLPKVLPKLPKRVVVYRILPALTSEFVNPDMVPFVLPNVLLIAEECTKEEYVRL-------------IMPDLSPVFKLQEPVQASNMILLIFLQKMDLLLTKTPPEDIKNSVLPMVYRAVEAPSIQIQELCLNIIPSFANLIDYPSMKNSLIPRIKSACLQTSSLAVRVNSLVCLGKILEYLDKWFVIDEILPFLQQIPSREPAVLMGILGIYKCTFSHKKLGIPKEHLATKSLPHLVSLSIDNNLNLNQFNSFMVVIREMLNRMEAEH 610          
BLAST of SCY1-like protein 2 vs. Ensembl Medaka
Match: si:ch211-244b2.1 (SCY1 like pseudokinase 2 [Source:NCBI gene;Acc:101171295])

HSP 1 Score: 203.371 bits (516), Expect = 1.045e-53
Identity = 148/618 (23.95%), Postives = 295/618 (47.73%), Query Frame = 2
Query:   53 SLTTKISDSSINIKQSFNVQLITNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNL--NFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKC-PHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEF-RPIIDLLA------EIVRISSIXXXXXXXXXXXXXXIKSINDTQEKID----SLQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKEY 1864
            S+  K+  +   +       ++ NP+ + F +     S G  L WRI+  T+    +E +VF F+KK+ +K  K  + +I+ + L+K +Q L+ + H +LL V HPLEE+ D +AF TE +  SLSN+LG    +     +++    + +   K+G+ QI E L +L++ ++  H N  P  I++    +WK+ G  F    +N  +    ++   W   LP +  PN +Y+APE  L  +    SDM+SLG+V+ +V+++  P   +N       +  ++++L      +  K+PEE+R+  + +LS     RP+    + + +F+D   + L+   ++  +   ++ +    L  +  ++P+ ++   +  AL +   N +   F  P + L+A      E VR+             +M  +  +   QE +      LQ +++L  K   + ++N ++P V+  +E     IQ     ++   +   +   + + L+          ++ +V+ + L CL  +++ LD   +  +ILPFL +I    P VL+  L + K     +   I  + +A + +  LV  +++  L + +F S M  +  ML +++ E+
Sbjct:    3 SMLNKLKSTVTKVTADVTSAVMGNPVTREFEVGKHIASGGPGLCWRIYNGTKKSTKQEVAVFVFDKKMIDKYQKFDKDQII-DSLKKGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLSNVLGQWDNLPSPVPKDIKEYKLYDVETKYGLLQISEGLSFLHSGVKMVHGNLCPENIILNKSGAWKIMGFDFSISSTNPSDAEPKYTCKEWEPNLPPLCLPNPEYLAPEYILSVSCDSASDMYSLGVVMHAVFNEGKPVFQVNKHDIFKSFSRQLDQLSSMSPTVLGKIPEEVREHAKMLLSVTPNVRPDADQITKIPFFDDVGAVTLQYFDSLFQRDNLQKSQFYKGLPKVLPKLPKRVVVYRILPALTSEFVNPDMVPFVLPNVLLIAEECTKEEYVRL-------------IMPDLSPVFKLQEPVQILLIFLQKMDLLLTKTPPEDIKNSVLPMVYRAVEAPSIQIQELCLNIIPSFANLIDYPSMKNSLIPRIKSACLQTSSLAVRVNSLVCLGKILEYLDKWFVIDEILPFLQQIPSREPAVLMGILGIYKCTFSHKKLGIPKEHLATKSLPHLVSLSIDNNLNLNQFNSFMVVIREMLNRMEAEH 606          
BLAST of SCY1-like protein 2 vs. Ensembl Medaka
Match: SCYL1 (SCY1 like pseudokinase 1 [Source:NCBI gene;Acc:101173232])

HSP 1 Score: 54.6842 bits (130), Expect = 4.592e-7
Identity = 67/329 (20.36%), Postives = 120/329 (36.47%), Query Frame = 2
Query:  182 IWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPVSWSSKLPKMAQPNLD-YIAPEIQLESNYSETSDMFSLGLVICSVY-------------SKCPHSLI-----------NAKTNQSIYIEKVNRLGI----EFKEMSLKLPE-ELRKPVEKMLSFD-------------VKYRPNPQLFSLLKYFNDPVIL 1039
            IW +    R    E  SVF +E          +  E   +  +   + +  + H  +L  V  LE  + S+   TE++       L  H++             + E  +  G++QI++AL +L       HNN   + I +     WKL  +  +            P   S   PK   P+++ Y  PE+   S      +++ LG +I  V+              K P SL+            A+ N + +++     G      F E +L L E ++++P EK   F               K++  PQL +  ++ N   ++
Sbjct:   27 IWSLHRGKRKTSGEPVSVFVYEVS--------QGTEQQTQLAKAAFKRMKTLRHPNILAYVDGLE-TDKSLYLVTEQV-----TPLAVHLKAQTEKS------GVGELEVSWGLHQIVKALSFLVNDCHLLHNNMGIWAIFVDRAGEWKLGALDHVAPEQG------DPSGISLPEPKSVYPDMEKYDPPEMSNNSGEKWAGEVWRLGCLIWEVFNGPLPRTSSLRSLGKIPKSLVPHYCELVGANPRARPNPARFLQNCRAPGGFLSNSFVESNLFLEEIQIKEPAEKQQFFQELSDNLDSFPEDFCKHKVLPQLLTAFEFGNAGAVI 329          
BLAST of SCY1-like protein 2 vs. Ensembl Medaka
Match: cdk6 (cyclin dependent kinase 6 [Source:NCBI gene;Acc:101168879])

HSP 1 Score: 53.5286 bits (127), Expect = 4.880e-7
Identity = 37/141 (26.24%), Postives = 70/141 (49.65%), Query Frame = 2
Query:  446 HVRMDLSS-IQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQ 865
            HV  DL++ ++++    +    +K  +YQ+++ L +L+ S +  H +  P  IL+T+    KLA  G  + YS    L    V+            L Y APE+ L+S+Y+   D++S+G +   ++ + P    N+  +Q
Sbjct:   97 HVDQDLTTYLEKVPDPGVPPETIKDMMYQLLQGLDFLH-SHRVVHRDLKPQNILVTSGGQIKLADFGLARIYSFQMALTSVVVT------------LWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRRPLFRGNSDVDQ 224          
BLAST of SCY1-like protein 2 vs. Ensembl Medaka
Match: ENSORLT00000006131.2 (tyrosine-protein kinase CSK [Source:NCBI gene;Acc:101158271])

HSP 1 Score: 53.5286 bits (127), Expect = 6.945e-7
Identity = 46/193 (23.83%), Postives = 87/193 (45.08%), Query Frame = 2
Query:  278 RRREIVCECLRKDIQN---------LSNIYHNKLLKVVHPLEENNDSMAFATEKI-HCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYS 826
            R  ++  +C++ D            ++ + HN L++++  + E N S+   TE +    L + L +  R  L            E  LK  I  + EA+ YL T+  + H + +   +L++  N  K++  G  ++ S++Q+    PV W+              APE   E N+S  SD++S G+++  +YS
Sbjct:  215 RGTKVAVKCIKNDATAQAFIAEASVMTQMRHNNLVQLLGVIVEENGSLYIVTEYMAKGCLVDYLRSRGRTVLGG----------EALLKFAI-DVCEAMAYLETN-NFVHRDLAARNVLVSDDNIAKVSDFGLTKEASSTQDTAKLPVKWT--------------APEALREKNFSTKSDVWSYGILLWEIYS 381          
BLAST of SCY1-like protein 2 vs. Planmine SMEST
Match: SMESG000015308.1 (SMESG000015308.1)

HSP 1 Score: 834.713 bits (2155), Expect = 0.000e+0
Identity = 426/426 (100.00%), Postives = 426/426 (100.00%), Query Frame = 2
Query:   41 MKTSSLTTKISDSSINIKQSFNVQLITNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEFRPIIDLLAEIVRISSIXXXXXXXXXXXXXXIKSINDTQ 1318
            MKTSSLTTKISDSSINIKQSFNVQLITNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEFRPIIDLLAEIVRISSIFLFDEFLFMDLMDLIKSINDTQ
Sbjct:    1 MKTSSLTTKISDSSINIKQSFNVQLITNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEFRPIIDLLAEIVRISSIFLFDEFLFMDLMDLIKSINDTQ 426          
BLAST of SCY1-like protein 2 vs. Planmine SMEST
Match: SMESG000015319.1 (SMESG000015319.1)

HSP 1 Score: 734.176 bits (1894), Expect = 0.000e+0
Identity = 390/390 (100.00%), Postives = 390/390 (100.00%), Query Frame = 2
Query: 1364 MKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKEYWRNHSSPNKNSQTNDDSTPHQVPRIETPDLANRSKSSGLLNLQNREEPSQISYGIYRNSEISFILAXXXXXXXXXXXXXXXLIQPPVNPNTKSSPSSPLLCHKQELSSECKLMSSTTGCLENYTSLNVPLNSGRRHSFGSSTILQSSENMITASVCEGPFFGSNNQQTSFYSGSRRPSNAMVPLLPNQXXXXXXXXXXXTVIPISRRSSFNALSDTVMNLFHS 2533
            MKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKEYWRNHSSPNKNSQTNDDSTPHQVPRIETPDLANRSKSSGLLNLQNREEPSQISYGIYRNSEISFILANTNNPNSNSCTTQNNLIQPPVNPNTKSSPSSPLLCHKQELSSECKLMSSTTGCLENYTSLNVPLNSGRRHSFGSSTILQSSENMITASVCEGPFFGSNNQQTSFYSGSRRPSNAMVPLLPNQSLSRRESSERLTVIPISRRSSFNALSDTVMNLFHS
Sbjct:    1 MKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKEYWRNHSSPNKNSQTNDDSTPHQVPRIETPDLANRSKSSGLLNLQNREEPSQISYGIYRNSEISFILANTNNPNSNSCTTQNNLIQPPVNPNTKSSPSSPLLCHKQELSSECKLMSSTTGCLENYTSLNVPLNSGRRHSFGSSTILQSSENMITASVCEGPFFGSNNQQTSFYSGSRRPSNAMVPLLPNQSLSRRESSERLTVIPISRRSSFNALSDTVMNLFHS 390          
BLAST of SCY1-like protein 2 vs. Planmine SMEST
Match: SMESG000078112.1 (SMESG000078112.1)

HSP 1 Score: 388.267 bits (996), Expect = 1.800e-120
Identity = 228/621 (36.71%), Postives = 378/621 (60.87%), Query Frame = 2
Query:   77 SSINIKQSFNVQLITNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEFRPI-IDLLAEIVRISSIXXXXXXXXXXXXXXI--KSINDTQEKIDSLQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNK---SVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKEYWRN-HSSPNKNSQTNDDST 1918
            +S+NI QS+N     NP+ + F+++ QTGS GVE+ W+I++A R  D  + S+F FEK++AEKLHKPRR+E++C+ LRK++  L +  H+K+LKV+HP+EENN+++AFATE+I  SL+N+LGN +R+  S+ Q +    + +  +KHGIYQ+ + LRYL+TS Q  H+N +P T+LIT    WK+ G GF+   +N      + + WS+K PKM QP+LDYIAPE+QL    + + DMFSLGL+IC+ Y     SLINA    S Y++K+  L  EF  ++  LP+ L +PVEKML+ +++YRPN QLFSLLKYF+D V+L ++ ++N  ++  ++++  L SL  I  + P+E+L   +F    +  H  E  +   I  +LL   ++ S++  F + +   + D++    +N   E    LQ V  L  KM ++ ++  ++P +   + +   + Q+A    +       + E + +   +I PKI F +N +    V+ S L  +S LI  L+N+ I  +++PFL +I+ ++  +L+  +   K+++ K+ +    Q I  Q++  L+    NPLLK    +  ++ LH++LEK+D E   +  S+  + S+TN+ S+
Sbjct:   11 TSLNIGQSWN-----NPLSRSFSVKKQTGSCGVEMPWKIYDAVRLVDGMDCSLFIFEKRIAEKLHKPRRKEVICDFLRKEVFQLQSFNHSKILKVLHPMEENNETLAFATERIIGSLANLLGNDLRLSQSAAQAIKKHKLTDLEIKHGIYQLTDCLRYLHTSQQVIHSNVNPSTVLITESGHWKMFGTGFVTSNTNCTEEQITDMQWSAKKPKMTQPDLDYIAPELQLGGPITASIDMFSLGLLICTAYCG-GKSLINANKTLSNYLKKIEELHKEFSSIASILPQALVEPVEKMLNKEIRYRPNSQLFSLLKYFDDMVLLSIDGIVNFEEKSSEEKMSFLQSLPEIIPEYPKELLSSRIFPFFFH--HLMESRDLYEICFELLMATIQASTLDQFLDHMKPGITDILTRAKVNSIHESTIILQFVEPLFYKMTNEDMQLKVMPILVQCINSEIVEAQIAALDSLRLFKCCIDDETLNN---IILPKIKFILNRRKLLKVRCSALTAMSALITILENSVIIDEVIPFLNEIKTNDVEILMCVIQNYKEMINKKIKITKEQII--QIIHSLLNHLKNPLLKRPHIRCTVDILHLLLEKVDVEQMDSFESNSEQKSETNEMSS 618          

HSP 2 Score: 56.6102 bits (135), Expect = 7.690e-8
Identity = 38/91 (41.76%), Postives = 53/91 (58.24%), Query Frame = 2
Query: 2261 GRRHSFGSSTILQSSENMITASVCEGPFF--GSNNQQTSFYSGSRRPSNAMVPLLPNQXXXXXXXXXXXTVIPISRRSSFNALSDTVMNLF 2527
            GRRHSF  S+I  S  ++ITASVCEGPF    SN  ++     + R  +++V  L  Q+ +  E S      P++R+SSF  LSD V+N F
Sbjct:  791 GRRHSFAFSSIPDSPVDLITASVCEGPFQHPASNKLESRRSQPAHR--DSVVGRLTRQNSNPSEKS------PVTRQSSFTVLSDAVLNFF 873          
BLAST of SCY1-like protein 2 vs. Planmine SMEST
Match: SMESG000078112.1 (SMESG000078112.1)

HSP 1 Score: 387.882 bits (995), Expect = 2.461e-120
Identity = 228/621 (36.71%), Postives = 378/621 (60.87%), Query Frame = 2
Query:   77 SSINIKQSFNVQLITNPIKKYFTLRSQTGSYGVELIWRIFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEFRPI-IDLLAEIVRISSIXXXXXXXXXXXXXXI--KSINDTQEKIDSLQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNK---SVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKEYWRN-HSSPNKNSQTNDDST 1918
            +S+NI QS+N     NP+ + F+++ QTGS GVE+ W+I++A R  D  + S+F FEK++AEKLHKPRR+E++C+ LRK++  L +  H+K+LKV+HP+EENN+++AFATE+I  SL+N+LGN +R+  S+ Q +    + +  +KHGIYQ+ + LRYL+TS Q  H+N +P T+LIT    WK+ G GF+   +N      + + WS+K PKM QP+LDYIAPE+QL    + + DMFSLGL+IC+ Y     SLINA    S Y++K+  L  EF  ++  LP+ L +PVEKML+ +++YRPN QLFSLLKYF+D V+L ++ ++N  ++  ++++  L SL  I  + P+E+L   +F    +  H  E  +   I  +LL   ++ S++  F + +   + D++    +N   E    LQ V  L  KM ++ ++  ++P +   + +   + Q+A    +       + E + +   +I PKI F +N +    V+ S L  +S LI  L+N+ I  +++PFL +I+ ++  +L+  +   K+++ K+ +    Q I  Q++  L+    NPLLK    +  ++ LH++LEK+D E   +  S+  + S+TN+ S+
Sbjct:   11 TSLNIGQSWN-----NPLSRSFSVKKQTGSCGVEMPWKIYDAVRLVDGMDCSLFIFEKRIAEKLHKPRRKEVICDFLRKEVFQLQSFNHSKILKVLHPMEENNETLAFATERIIGSLANLLGNDLRLSQSAAQAIKKHKLTDLEIKHGIYQLTDCLRYLHTSQQVIHSNVNPSTVLITESGHWKMFGTGFVTSNTNCTEEQITDMQWSAKKPKMTQPDLDYIAPELQLGGPITASIDMFSLGLLICTAYCG-GKSLINANKTLSNYLKKIEELHKEFSSIASILPQALVEPVEKMLNKEIRYRPNSQLFSLLKYFDDMVLLSIDGIVNFEEKSSEEKMSFLQSLPEIIPEYPKELLSSRIFPFFFH--HLMESRDLYEICFELLMATIQASTLDQFLDHMKPGITDILTRAKVNSIHESTIILQFVEPLFYKMTNEDMQLKVMPILVQCINSEIVEAQIAALDSLRLFKCCIDDETLNN---IILPKIKFILNRRKLLKVRCSALTAMSALITILENSVIIDEVIPFLNEIKTNDVEILMCVIQNYKEMINKKIKITKEQII--QIIHSLLNHLKNPLLKRPHIRCTVDILHLLLEKVDVEQMDSFESNSEQKSETNEMSS 618          

HSP 2 Score: 56.9954 bits (136), Expect = 6.120e-8
Identity = 36/91 (39.56%), Postives = 52/91 (57.14%), Query Frame = 2
Query: 2261 GRRHSFGSSTILQSSENMITASVCEGPFF--GSNNQQTSFYSGSRRPSNAMVPLLPNQXXXXXXXXXXXTVIPISRRSSFNALSDTVMNLF 2527
            GRRHSF  S+I  S  ++ITASVCEGPF    SN  ++     + R  +++V  L  Q+     +    +  P++R+SSF  LSD V+N F
Sbjct:  791 GRRHSFAFSSIPDSPVDLITASVCEGPFQHPASNKLESRRSQPAHR--DSVVGRLTRQNSVLNLNPSEKS--PVTRQSSFTVLSDAVLNFF 877          
BLAST of SCY1-like protein 2 vs. Planmine SMEST
Match: SMESG000078112.1 (SMESG000078112.1)

HSP 1 Score: 345.895 bits (886), Expect = 4.212e-105
Identity = 207/573 (36.13%), Postives = 346/573 (60.38%), Query Frame = 2
Query:  221 EEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIYHNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVIDINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGMGFIQKYSNSQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDMFSLGLVICSVYSKCPHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEELRKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRVEILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEFRPI-IDLLAEIVRISSIXXXXXXXXXXXXXXI--KSINDTQEKIDSLQLVNMLSEKMKDDSLRNILIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFSVNNK---SVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLDLLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIMLEKIDKEYWRN-HSSPNKNSQTNDDST 1918
            ++ S+F FEK++AEKLHKPRR+E++C+ LRK++  L +  H+K+LKV+HP+EENN+++AFATE+I  SL+N+LGN +R+  S+ Q +    + +  +KHGIYQ+ + LRYL+TS Q  H+N +P T+LIT    WK+ G GF+   +N      + + WS+K PKM QP+LDYIAPE+QL    + + DMFSLGL+IC+ Y     SLINA    S Y++K+  L  EF  ++  LP+ L +PVEKML+ +++YRPN QLFSLLKYF+D V+L ++ ++N  ++  ++++  L SL  I  + P+E+L   +F    +  H  E  +   I  +LL   ++ S++  F + +   + D++    +N   E    LQ V  L  KM ++ ++  ++P +   + +   + Q+A    +       + E + +   +I PKI F +N +    V+ S L  +S LI  L+N+ I  +++PFL +I+ ++  +L+  +   K+++ K+ +    Q I  Q++  L+    NPLLK    +  ++ LH++LEK+D E   +  S+  + S+TN+ S+
Sbjct:    9 QDCSLFIFEKRIAEKLHKPRRKEVICDFLRKEVFQLQSFNHSKILKVLHPMEENNETLAFATERIIGSLANLLGNDLRLSQSAAQAIKKHKLTDLEIKHGIYQLTDCLRYLHTSQQVIHSNVNPSTVLITESGHWKMFGTGFVTSNTNCTEEQITDMQWSAKKPKMTQPDLDYIAPELQLGGPITASIDMFSLGLLICTAYCGG-KSLINANKTLSNYLKKIEELHKEFSSIASILPQALVEPVEKMLNKEIRYRPNSQLFSLLKYFDDMVLLSIDGIVNFEEKSSEEKMSFLQSLPEIIPEYPKELLSSRIFPFFFH--HLMESRDLYEICFELLMATIQASTLDQFLDHMKPGITDILTRAKVNSIHESTIILQFVEPLFYKMTNEDMQLKVMPILVQCINSEIVEAQIAALDSLRLFKCCIDDETLNN---IILPKIKFILNRRKLLKVRCSALTAMSALITILENSVIIDEVIPFLNEIKTNDVEILMCVIQNYKEMINKKIKITKEQII--QIIHSLLNHLKNPLLKRPHIRCTVDILHLLLEKVDVEQMDSFESNSEQKSETNEMSS 573          

HSP 2 Score: 56.9954 bits (136), Expect = 7.173e-8
Identity = 38/91 (41.76%), Postives = 53/91 (58.24%), Query Frame = 2
Query: 2261 GRRHSFGSSTILQSSENMITASVCEGPFF--GSNNQQTSFYSGSRRPSNAMVPLLPNQXXXXXXXXXXXTVIPISRRSSFNALSDTVMNLF 2527
            GRRHSF  S+I  S  ++ITASVCEGPF    SN  ++     + R  +++V  L  Q+ +  E S      P++R+SSF  LSD V+N F
Sbjct:  746 GRRHSFAFSSIPDSPVDLITASVCEGPFQHPASNKLESRRSQPAHR--DSVVGRLTRQNSNPSEKS------PVTRQSSFTVLSDAVLNFF 828          
The following BLAST results are available for this feature:
BLAST of SCY1-like protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SCYL24.894e-5724.96SCY1 like pseudokinase 2 [Source:HGNC Symbol;Acc:H... [more]
SCYL21.359e-5624.80SCY1 like pseudokinase 2 [Source:HGNC Symbol;Acc:H... [more]
SCYL21.664e-5624.96SCY1 like pseudokinase 2 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of SCY1-like protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZC581.91.149e-3832.33pep chromosome:WBcel235:I:6665077:6673840:-1 gene:... [more]
ZC581.91.150e-3832.33pep chromosome:WBcel235:I:6665077:6673602:-1 gene:... [more]
ZC581.91.908e-3832.33pep chromosome:WBcel235:I:6665077:6670409:-1 gene:... [more]
ZC581.92.015e-3832.33pep chromosome:WBcel235:I:6665077:6673807:-1 gene:... [more]
cdk-46.455e-827.38Cyclin-dependent kinase 4 homolog [Source:UniProt... [more]
back to top
BLAST of SCY1-like protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bma2.896e-8529.84gene:FBgn0085385 transcript:FBtr0331577[more]
bma2.896e-8529.84gene:FBgn0085385 transcript:FBtr0331578[more]
bma3.808e-8529.84gene:FBgn0085385 transcript:FBtr0331579[more]
CG19511.020e-5225.86gene:FBgn0039623 transcript:FBtr0085342[more]
yata1.919e-823.83gene:FBgn0260990 transcript:FBtr0333822[more]
back to top
BLAST of SCY1-like protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCYL21.466e-5222.95si:ch211-244b2.1 [Source:ZFIN;Acc:ZDB-GENE-041210-... [more]
SCYL21.466e-5222.95si:ch211-244b2.1 [Source:ZFIN;Acc:ZDB-GENE-041210-... [more]
scyl17.347e-921.82SCY1-like, kinase-like 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
cdk66.026e-726.51cyclin-dependent kinase 6 [Source:ZFIN;Acc:ZDB-GEN... [more]
cdk67.412e-726.51cyclin-dependent kinase 6 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of SCY1-like protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gatad2b7.363e-5925.28GATA zinc finger domain containing 2B [Source:Xenb... [more]
gatad2b4.525e-5725.04GATA zinc finger domain containing 2B [Source:Xenb... [more]
gatad2b5.409e-5725.04GATA zinc finger domain containing 2B [Source:Xenb... [more]
gatad2b7.765e-5725.21GATA zinc finger domain containing 2B [Source:Xenb... [more]
gatad2b1.211e-5625.04GATA zinc finger domain containing 2B [Source:Xenb... [more]
back to top
BLAST of SCY1-like protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Scyl23.274e-5725.08SCY1-like 2 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Scyl23.360e-5725.08SCY1-like 2 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Cdk69.042e-625.95cyclin-dependent kinase 6 [Source:MGI Symbol;Acc:M... [more]
Cdk69.042e-625.95cyclin-dependent kinase 6 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of SCY1-like protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8CFE4|SCYL2_MOUSE2.350e-5625.08SCY1-like protein 2 OS=Mus musculus OX=10090 GN=Sc... [more]
sp|Q6P3W7|SCYL2_HUMAN7.991e-5624.96SCY1-like protein 2 OS=Homo sapiens OX=9606 GN=SCY... [more]
sp|Q9P7X5|PPK32_SCHPO5.523e-3925.26Protein kinase domain-containing protein ppk32 OS=... [more]
sp|Q55BQ3|SCY2_DICDI3.594e-3224.29Probable inactive serine/threonine-protein kinase ... [more]
sp|P53009|SCY1_YEAST2.507e-2124.67Protein kinase-like protein SCY1 OS=Saccharomyces ... [more]
back to top
BLAST of SCY1-like protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S1BIN63.833e-11936.86Protein kinase domain-containing protein (Fragment... [more]
A0A210PE941.207e-11636.87SCY1-like protein 2 OS=Mizuhopecten yessoensis OX=... [more]
V4BF471.008e-11535.71Protein kinase domain-containing protein OS=Lottia... [more]
A0A2T7NRI71.450e-11337.80Protein kinase domain-containing protein OS=Pomace... [more]
A0A267ELE31.981e-10635.28Protein kinase domain-containing protein OS=Macros... [more]
back to top
BLAST of SCY1-like protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-244b2.13.183e-5323.86SCY1 like pseudokinase 2 [Source:NCBI gene;Acc:103... [more]
si:ch211-244b2.13.352e-5323.70SCY1 like pseudokinase 2 [Source:NCBI gene;Acc:103... [more]
si:ch211-244b2.14.995e-5123.86SCY1 like pseudokinase 2 [Source:NCBI gene;Acc:103... [more]
cdk64.352e-727.46cyclin dependent kinase 6 [Source:NCBI gene;Acc:10... [more]
scyl11.005e-621.09SCY1 like pseudokinase 1 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of SCY1-like protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000003368.13.917e-5925.24pep scaffold:Pmarinus_7.0:GL479057:9948:36045:-1 g... [more]
cdk41.076e-727.27cyclin-dependent kinase 4 [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSPMAT00000006430.13.748e-623.65pep scaffold:Pmarinus_7.0:GL483757:727:12608:1 gen... [more]
back to top
BLAST of SCY1-like protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SCY13.610e-2324.67Putative kinase; suppressor of GTPase mutant; simi... [more]
back to top
BLAST of SCY1-like protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO427447.278e-6526.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375672.290e-725.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
OBSCURIN1.808e-622.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SCY1-like protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-244b2.17.234e-5423.79SCY1 like pseudokinase 2 [Source:NCBI gene;Acc:101... [more]
si:ch211-244b2.11.045e-5323.95SCY1 like pseudokinase 2 [Source:NCBI gene;Acc:101... [more]
SCYL14.592e-720.36SCY1 like pseudokinase 1 [Source:NCBI gene;Acc:101... [more]
cdk64.880e-726.24cyclin dependent kinase 6 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000006131.26.945e-723.83tyrosine-protein kinase CSK [Source:NCBI gene;Acc:... [more]
back to top
BLAST of SCY1-like protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015308.10.000e+0100.00SMESG000015308.1[more]
SMESG000015319.10.000e+0100.00SMESG000015319.1[more]
SMESG000078112.11.800e-12036.71SMESG000078112.1[more]
SMESG000078112.12.461e-12036.71SMESG000078112.1[more]
SMESG000078112.14.212e-10536.13SMESG000078112.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032216 ID=SMED30032216|Name=SCY1-like protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2774bp
AATATATTATTTGACTCTATATGGATATTAACTCCAAAACATGAAAACTT
CATCATTGACCACAAAAATATCAGATTCTTCTATTAATATCAAACAATCG
TTTAATGTTCAGTTAATTACAAACCCAATTAAGAAATATTTCACTTTAAG
ATCACAAACTGGTAGTTATGGAGTTGAATTAATTTGGAGGATTTTTGAAG
CTACCAGATCCAAAGATAATGAGGAGTTTTCAGTCTTTTATTTTGAGAAA
AAATTAGCAGAAAAACTTCACAAACCTAGAAGGCGAGAAATAGTTTGTGA
ATGTTTGAGAAAGGATATTCAAAACTTATCCAACATCTATCATAATAAAT
TATTGAAAGTTGTTCATCCTCTGGAAGAAAATAATGATAGTATGGCGTTT
GCAACAGAAAAGATACACTGTAGCTTATCAAACATTCTGGGAAATCATGT
TCGAATGGATCTTTCAAGTATTCAAGAATTGGCGGTTATAGATATAAATG
AATTCAATCTCAAACATGGCATTTATCAAATAATTGAAGCGCTCAGATAT
TTGAACACGAGTTTACAATACAATCACAATAACTGTTCGCCATATACTAT
TCTTATTACTACACAAAATAGTTGGAAACTTGCCGGAATGGGATTTATAC
AAAAATATTCCAATAGCCAGAATCTCAACTTTTCCCCAGTGTCATGGAGC
TCTAAGCTTCCTAAAATGGCTCAACCAAACCTTGATTACATAGCTCCTGA
GATTCAATTGGAATCAAACTATAGTGAAACATCAGATATGTTTTCTTTGG
GCTTGGTTATTTGTTCTGTTTATTCAAAATGCCCCCATTCACTTATCAAT
GCTAAAACCAATCAGTCCATTTACATTGAAAAAGTTAACAGATTAGGAAT
AGAATTCAAAGAAATGTCTTTGAAATTACCTGAAGAATTAAGGAAACCGG
TAGAGAAAATGTTAAGTTTTGATGTAAAATACCGACCAAATCCGCAATTA
TTTTCTTTATTAAAATACTTCAATGATCCAGTGATTCTTGGATTAGAAAG
TCTACTTAATATCAATGATCAAGGATTAGATAAACGCGTTGAAATTTTAT
CTAGTCTCAGAGCAATTTTCATTCAAATGCCACAAGAAATTTTGTTTAAA
GTGGTATTCAAAGCACTAATCAATCGTATTCACAATTGTGAGAAAGGCGA
ATTTCGCCCAATTATCGATTTACTCGCCGAAATAGTGAGAATATCCTCCA
TATTTTTATTTGATGAGTTTCTCTTTATGGACCTGATGGATCTGATAAAA
TCAATAAATGACACCCAGGAGAAGATAGACAGTTTGCAATTAGTAAATAT
GTTATCAGAAAAGATGAAAGATGATTCGTTGAGAAATATTTTAATACCTT
TTGTATTCGGGGATTTAGAAAATGCCGATTGTGATATACAAGTTGCTACA
TTTACAATGATGGGCAAATTGTCACAATTCACTAACAAAGAATTCATCCT
TGACCACCTGTTAATGATTTTTCCCAAGATATTTTTTAGTGTGAATAACA
AAAGCGTACAGGAATCCATTTTAGAATGTCTTTCGTGCCTAATTGATAAT
TTAGATAACAACAAAATTGAAAAGAAAATTTTACCATTTCTTATTAAAAT
ACAATACGATAATCCAAATGTTTTAGTGGCTTCTTTAGATCTTTTAAAGC
AGATTCTATTTAAAAGACCCGAAACAATTACCTGTCAATTTATAGCATGC
CAATTGATGCAAATATTAGTTCCGGAAACCGTAAATCCACTATTGAAAAT
TACTGAATTTAAATCGCTAATGGAAACTTTGCATATAATGCTTGAGAAAA
TTGATAAAGAGTACTGGCGTAATCATTCATCCCCAAACAAAAACTCCCAA
ACCAATGACGACTCTACACCTCACCAAGTACCGAGAATCGAAACTCCCGA
TTTAGCAAATCGTTCAAAATCAAGTGGACTTTTGAATCTTCAAAATCGTG
AAGAACCCTCCCAGATATCTTATGGAATCTACCGAAACTCAGAAATATCT
TTTATCCTTGCGAATACAAATAACCCTAACAGTAATAGTTGTACAACCCA
AAACAATTTAATTCAGCCTCCAGTTAATCCGAATACAAAATCATCACCTT
CATCGCCATTATTATGTCACAAACAAGAATTATCTTCCGAATGCAAATTA
ATGTCTTCCACTACCGGATGTTTAGAGAATTATACGTCCTTAAATGTTCC
TTTAAACTCGGGTCGGAGACATAGCTTTGGGTCAAGCACAATTCTACAAA
GTTCTGAAAACATGATCACGGCCTCTGTGTGCGAGGGTCCGTTTTTCGGA
TCAAATAATCAACAAACAAGTTTTTATTCTGGTTCCCGTCGTCCATCAAA
TGCCATGGTGCCTCTATTACCAAATCAAAGTTTATCAAGAAGAGAAAGCT
CTGAAAGATTAACAGTGATTCCAATATCACGACGCTCCAGTTTCAATGCA
TTAAGTGACACTGTTATGAACTTGTTTCATTCGTGAAATTCGGCTGGCAT
TTGCTCAATCTACCAGTCGAATGAATACAACTCTTGAACATGTAAATTCA
CTCAGAAAAAAAAACGACATTTTAAAAAAAAGTTGCAAAGTTTCGGATCT
TCATGTTAAAACTTGTTAGATTTGATTTTGATCTGTTCATTAAAAATGGT
TTTTAATTGTTGTAGCTTAGAGTTATATTCGAAAAGATTATTGAAATTCT
TTATTTAAATTAAAATATACTGAG
back to top

protein sequence of SMED30032216-orf-1

>SMED30032216-orf-1 ID=SMED30032216-orf-1|Name=SMED30032216-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=832bp
MKTSSLTTKISDSSINIKQSFNVQLITNPIKKYFTLRSQTGSYGVELIWR
IFEATRSKDNEEFSVFYFEKKLAEKLHKPRRREIVCECLRKDIQNLSNIY
HNKLLKVVHPLEENNDSMAFATEKIHCSLSNILGNHVRMDLSSIQELAVI
DINEFNLKHGIYQIIEALRYLNTSLQYNHNNCSPYTILITTQNSWKLAGM
GFIQKYSNSQNLNFSPVSWSSKLPKMAQPNLDYIAPEIQLESNYSETSDM
FSLGLVICSVYSKCPHSLINAKTNQSIYIEKVNRLGIEFKEMSLKLPEEL
RKPVEKMLSFDVKYRPNPQLFSLLKYFNDPVILGLESLLNINDQGLDKRV
EILSSLRAIFIQMPQEILFKVVFKALINRIHNCEKGEFRPIIDLLAEIVR
ISSIFLFDEFLFMDLMDLIKSINDTQEKIDSLQLVNMLSEKMKDDSLRNI
LIPFVFGDLENADCDIQVATFTMMGKLSQFTNKEFILDHLLMIFPKIFFS
VNNKSVQESILECLSCLIDNLDNNKIEKKILPFLIKIQYDNPNVLVASLD
LLKQILFKRPETITCQFIACQLMQILVPETVNPLLKITEFKSLMETLHIM
LEKIDKEYWRNHSSPNKNSQTNDDSTPHQVPRIETPDLANRSKSSGLLNL
QNREEPSQISYGIYRNSEISFILANTNNPNSNSCTTQNNLIQPPVNPNTK
SSPSSPLLCHKQELSSECKLMSSTTGCLENYTSLNVPLNSGRRHSFGSST
ILQSSENMITASVCEGPFFGSNNQQTSFYSGSRRPSNAMVPLLPNQSLSR
RESSERLTVIPISRRSSFNALSDTVMNLFHS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR011989ARM-like
IPR011009Kinase-like_dom_sf
IPR016024ARM-type_fold
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0005488binding