Doublecortin domain-containing protein

Overview
NameDoublecortin domain-containing protein
Smed IDSMED30032202
Uniprot Best hitDoublecortin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=DCDC1 PE=1 SV=1 (E=2.41835e-78)
Length (bp)5554
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Doublecortin domain-containing protein (SMED30032202) t-SNE clustered cells

Violin plots show distribution of expression levels for Doublecortin domain-containing protein (SMED30032202) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Doublecortin domain-containing protein (SMED30032202) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Doublecortin domain-containing protein (SMED30032202) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032202

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30032202SMESG000017756.1 SmedASXL_016404SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30032202SMESG000017756.1 dd_Smed_v4_11770_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30032202SMESG000017756.1 dd_Smed_v4_11770_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30032202SMESG000017756.1 dd_Smed_v6_11770_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30032202SMESG000017756.1 dd_Smed_v4_11770_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30032202SMESG000017756.1 dd_Smed_v4_11770_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Doublecortin domain-containing protein vs. Ensembl Human
Match: DCDC1 (doublecortin domain containing 1 [Source:HGNC Symbol;Acc:HGNC:20625])

HSP 1 Score: 292.352 bits (747), Expect = 5.036e-79
Identity = 332/1362 (24.38%), Postives = 560/1362 (41.12%), Query Frame = 1
Query:  154 VLVKQNGKLYPLTRITGFSIDEILSNCTQIMKLTSAARKLYSKHGELIESLDKLKPND-----EVYVSLGEPFIDPLKIIKESILIREGSFWGLNGLYIPKSKRKAASACVTHTR----TERT-WRILTFSNGDYLINEAVEVISNLKDVEEVKSICGKKLNLNGQYKKLYNSDGFEITDLKFLDDEESYVWNPNSNIVILGPIWASKMEDLNQSGVYHYFHKTTKEIKNLIKSSKSTLNEIEAIENSEFDKYPASKMKSFSKPELKVTKEEIKKTLKKYENAFEKFNEKFKQLPKPSDQQVTESETCTEKGLYQCTK----------GLRLKVYQNGQNPNKKFTIFFNISQAKRGINDSTI----LFNRFLDCLSESVHLSKVNDFSKGLLARRVFMEDGTEIKDVSDLSYDQAICVSYGENWIDPAYTCVCAKFHFVDNKLESSLVDLEFSSTNLKNFKVVKRFDDKDIIYSLPV----------------------LEYQKRPNLFMLSSLHXXXXXXXXXXXXXXS-------------WSYTITGRLILKSLPSLCLTLITSSKDSLRFHKHSLKQLVTDEISYYAVQLNSIHAHDSTQMWKFHTSGQLYNKAFPEFFLTYIEN---KSNVDQDDF-----------VDAIRN---------SNILAVEQFPEDLQKY------------------------------QRWAFKQESFANLSQWKVCDLPNPEWHKCALTWPLKSNGDLNDDLKWPIEGLLIPCAPPLNRRTCE-SESRFPIKLRVLKNNDHNMKQSMLVNGPDLTKLIKKGKQPPYETHCTNERLLKLEFQMFLDSCTSILRLPSAARRLFTENGNEVYDLEGLQNYDLVFVSVGEIWCSPFKALTQIKLRSYANKLTVDIERLKYFNMLRRPNEDFVIGIRSDESGLLEIQILNEQSKLEIQK---IFNLENGNATPE-------PL---------IKSLVEDLEKNKSCHERSCEAANLKFKHKSFSDDSEVKIIEKS-------PKKVALSVSHIN-----RQQFLFESNRILTKNDPNMAIFAD----EIGKPVIIRKLVVNSDNQKCKWIIHDSGIIESMHFRGFVIDVYCPKMLPFQEKSSTNWSNC----LLVLEKPINTKYGRAHQKFKLDSRTGLFYPFATNDLDKDVTAAALASICTKYVCSNPLSQQGSYLEIN---QRQEASCNSCVSIMNGRYLI------TPFEIDNQTFSCD--LLGGFKVMNI-KPNLLQSRSEEVYQDFVHKLEIIRKKLTIKICKSRITESVSPNIQVLLHLNNNKTNSQSQQVTAKSISQLMGIATGVFNLQKPIRIFYTVKGEAI 3747
            V   +NG      R+T  +I  +L  CT+ + L  AAR+++     L +  + L+P D     +VYVS GEPF++P K IK+ +L+ +   W +NGL +P   ++  +  V   R    TERT  RIL F NG  +  +  E+    + +++V   C  ++NLN   +  Y+  G +I D+  +   E  +   NS   + G +W SK E  + SG   Y       +   +KS+K    ++  + N + +K     + S +  E    +EE+ + + + + A +        L K   Q   E E  +   +YQ  K          GL+LKV++NG+N  +   I   IS+   G +DS I    +  R L  + + +  S +N       + R+F E+G EIK+   L  +Q I VSYG  +  P    +   F  V       ++ + + +    N  ++    + ++    P+                      L+ +  PN+ + +S+ I +   +      +S             W  T TG ++ +++   CL +          H   +K      +  Y + L   H+ D +Q W F T G +Y+KA+P+F LTY+E    + +V Q ++            +  RN         ++ L ++Q PE    +                              QRWA K E  +   QWK   + NP W+K    WP+  +G LN++  WPI+GLL+P +PP+ +  C+ +E   P++LRVL+N + N  +S+ + GPD++        P  +T CT                  IL LPSAARRL+ E G E++ L+ LQ  +LV+VS GE+W +P  ++ Q K + +   L  DI +++ F    +  E  V+ ++SD         +   SKL + K   IF  E     PE       PL         + S V    + K+CH     A   +  H    DDS  K  EK         KK + S  H        QQF +   +I++   P + +         G  V++  +   SD    +WI  +         R F + V  P ++     + T    C    ++   KP N   G A+QK+           F +  LDK++T+A  A +CT  V       Q  Y  ++   +R+   C +C   M     +       PF   + T +    L G FKV+++ + +L   ++E+    +  +L  +R K   +        +       ++   N       + + A +   L+   T    L +     YT  G  I
Sbjct:  176 VTAYKNGSRTVFARVTVPTITLLLEECTEKLNLNMAARRVF-----LADGKEALEPEDIPHEADVYVSTGEPFLNPFKKIKDHLLLIKKVTWTMNGLMLPTDIKRRKTKPVLSIRMKKLTERTSVRILFFKNG--MGQDGHEITVGKETMKKVLDTCTIRMNLNLPARYFYDLYGRKIEDISKVPLLEKCL--QNSITPLRGLLWVSKGEGFSPSGAKMYIQGVLLALYQRLKSAKKYYKQLNLVMNEQKEKITEKVILSMTAKEHHKEQEEVSRLIDELQTAIK---SNIGHLCKLGPQLQAEQEQFSSY-VYQHIKSLPANTLVPGGLQLKVFENGKNTGE---ISVGISKKDLG-SDSPIQTDHMMERLLLKIHQRLQGSSINPPGLNYSSMRLFDENGQEIKNPLSLKNEQKIWVSYGRAYRSPLNLALGLTFDRVSAFARGDIM-VAYKTFLDPNAVLLPGCGNWEVCEGFPINFNCTSQQIPDQFEKVDLENHFLQNKVDPNIVLHASVSIGKWSFSGSEASSRSQIAPSILWPVASVWLITKTGMILSRAITQGCLAI---------GHPIRVKAAEGTSLEGYKLILQKRHSGDDSQKWVFGTDGCIYSKAYPQFVLTYLEELNAQVDVTQTEYHIHHGAWTTAHQEHGRNLAEEVLQESASNLGLKQLPEPSDTHLMPEGSLEETGELTVALVRKLEEKHPKASAQRWAIKHEGTSKPGQWKHSRVENPLWNKLTYMWPVLPSGQLNEEFDWPIQGLLVPSSPPMKKPICKTTEPYAPVRLRVLQNGEKNKNRSVTILGPDIS--------PGRKTQCTE-----------------ILNLPSAARRLYNEKGKEIFALKDLQRDELVYVSCGELWINPDLSIAQQKKQIFLRNLESDIAKIQIFCSTHK-IEALVLEVQSD---------IVSGSKLAVHKPVAIFGEEKQVTEPEEKQMQEDPLTTENASSEILDSHVRAHLRMKACHTLPRYAWQ-ETSHDFDEDDSLPKKTEKGLFENVEPQKKHSCSPKHSKLHKHCHQQFEYRDGQIISHAAPQLVLGVQGPNLRSGMEVVL--VEKKSDGSHQRWIHQEDS-------RTFHL-VSNPDLVLAVSMTKTRNEVCGYPVIVQKYKPYNN--GAANQKWHYMKNIKALVAFHSTALDKEITSANYAGVCTSSVIKEENIDQPGYCYLSPDGKRKTMLCLACGQSMRTEKGLKQLLPGVPFLCISGTKTQKPFLQGPFKVISVAEVDLSCDKAEKTLSYYQARLLSLRMKTCTQAASHSGMAATHQKAVKIIAYKNGDGYRNGKLIVAGTFPMLLTECTEQLGLARAASKVYTKDGTPI 1462          

HSP 2 Score: 102.834 bits (255), Expect = 5.040e-21
Identity = 62/233 (26.61%), Postives = 113/233 (48.50%), Query Frame = 1
Query: 4510 VELWASSGEPFYFXXXXXXXXXXXXXXXXXXXQLKLEIDKKKFLLRTMKGERFKKLDAGTLEPTPSVKNPIIIKGNWQFPTNEEIKLEQEIESLQAKLND-----AKPQVETDSSQQKMLSRDLYKQKHLKSCFVHINGKNENTSVSVWGESVWEILENSAQLLGMKKSPKFLFKKDGMQVTSINQISTGDILAASSHSVFISPKASGLQCEIKANWGRARRQYGEDSTDIKI 5193
            + +W S GEPF    +     KL+ ++     ++  ++D  +  +R +KG R       T+ PT S   P++++G W   T +EIKL + I   +A L++     +K      + +  +   +LYKQ + K  ++++NG         WG+++ E+L++ +  L M    + L+   G  + S + I    ++  S    F +PK      EI+AN+ R RRQ G  +TDI +
Sbjct: 1537 IAIWVSCGEPFLPPNALQKAEKLEKQNWLKKDRILADLDTMRHKMRQLKGRRVAACQPATMVPTKSPVQPVVVEGGWTEQTQQEIKLMELIRHTEAHLSEIQEMESKINFPIATKRIAVKPSNLYKQPNTKRVWIYLNGGRPEDGTYAWGKTISELLQDCSSRLKMTHPARALYTPSGEPIQSWDDIERDMVICVSMGHGFKTPKELKQLMEIRANYARIRRQQGPQATDIVV 1769          
BLAST of Doublecortin domain-containing protein vs. Ensembl Human
Match: DCDC1 (doublecortin domain containing 1 [Source:HGNC Symbol;Acc:HGNC:20625])

HSP 1 Score: 139.043 bits (349), Expect = 2.227e-32
Identity = 154/616 (25.00%), Postives = 253/616 (41.07%), Query Frame = 1
Query: 2056 WPLKSNGDLNDDLKWPIEGLLIPCAPPLNRRTCES-ESRFPIKLRVLKNNDHNMKQSMLVNGPDLTKLIKKGKQPPYETHCTNERLLKLEFQMFLDSCTSILRLPSAARRLFTENGNEVYDLEGLQNYDLVFVSVGEIWCSPFKALTQIKLRSYANKLTVDIERLKYFNMLRRPNEDFVIGIRSDESGLLEIQILNEQSKLEIQK---IFNLENGNATPE-------PL---------IKSLVEDLEKNKSCHERSCEAANLKFKHKSFSDDSEVKIIEKS-------PKKVALSVSHIN-----RQQFLFESNRILTKNDPNMAIFAD----EIGKPVIIRKLVVNSDNQKCKWIIHDSGIIESMHFRGFVIDVYCPKMLPFQEKSSTNWSNC----LLVLEKPINTKYGRAHQKFKLDSRTGLFYPFATNDLDKDVTAAALASICTKYVCSNPLSQQGSYLEIN---QRQEASCNSCVSIMNGRYLI------TPFEIDNQTFSCD--LLGGFKVMNI-KPNLLQSRSEEVYQDFVHKLEIIRKKLTIKICKSRITESVSPNIQVLLHLNNNKTNSQSQQVTAKSISQLMGIATGVFNLQKPIRIFYTVKGEAI 3747
            WP+  +G LN++  WPI+GLL+P +PP+ +  C++ E   P++LRVL+N + N  +S+ + GPD++        P  +T CT                  IL LPSAARRL+ E G E++ L+ LQ  +LV+VS GE+W +P  ++ Q K + +   L  DI +++ F    +  E  V+ ++SD         +   SKL + K   IF  E     PE       PL         + S V    + K+CH      A  +  H    DDS  K  EK         KK + S  H        QQF +   +I++   P + +         G  V++  +   SD    +WI  +     + H       V  P ++     + T    C    ++   KP N   G A+QK+           F +  LDK++T+A  A +CT  V       Q  Y  ++   +R+   C +C   M     +       PF   + T +    L G FKV+++ + +L   ++E+    +  +L  +R K   +        +       ++   N       + + A +   L+   T    L +     YT  G  I
Sbjct:    2 WPVLPSGQLNEEFDWPIQGLLVPSSPPMKKPICKTTEPYAPVRLRVLQNGEKNKNRSVTILGPDIS--------PGRKTQCTE-----------------ILNLPSAARRLYNEKGKEIFALKDLQRDELVYVSCGELWINPDLSIAQQKKQIFLRNLESDIAKIQIFCSTHK-IEALVLEVQSD---------IVSGSKLAVHKPVAIFGEEKQVTEPEEKQMQEDPLTTENASSEILDSHVRAHLRMKACHTLP-RYAWQETSHDFDEDDSLPKKTEKGLFENVEPQKKHSCSPKHSKLHKHCHQQFEYRDGQIISHAAPQLVLGVQGPNLRSGMEVVL--VEKKSDGSHQRWIHQEDS--RTFHL------VSNPDLVLAVSMTKTRNEVCGYPVIVQKYKPYNN--GAANQKWHYMKNIKALVAFHSTALDKEITSANYAGVCTSSVIKEENIDQPGYCYLSPDGKRKTMLCLACGQSMRTEKGLKQLLPGVPFLCISGTKTQKPFLQGPFKVISVAEVDLSCDKAEKTLSYYQARLLSLRMKTCTQAASHSGMAATHQKAVKIIAYKNGDGYRNGKLIVAGTFPMLLTECTEQLGLARAASKVYTKDGTPI 569          

HSP 2 Score: 102.834 bits (255), Expect = 3.244e-21
Identity = 62/233 (26.61%), Postives = 113/233 (48.50%), Query Frame = 1
Query: 4510 VELWASSGEPFYFXXXXXXXXXXXXXXXXXXXQLKLEIDKKKFLLRTMKGERFKKLDAGTLEPTPSVKNPIIIKGNWQFPTNEEIKLEQEIESLQAKLND-----AKPQVETDSSQQKMLSRDLYKQKHLKSCFVHINGKNENTSVSVWGESVWEILENSAQLLGMKKSPKFLFKKDGMQVTSINQISTGDILAASSHSVFISPKASGLQCEIKANWGRARRQYGEDSTDIKI 5193
            + +W S GEPF    +     KL+ ++     ++  ++D  +  +R +KG R       T+ PT S   P++++G W   T +EIKL + I   +A L++     +K      + +  +   +LYKQ + K  ++++NG         WG+++ E+L++ +  L M    + L+   G  + S + I    ++  S    F +PK      EI+AN+ R RRQ G  +TDI +
Sbjct:  644 IAIWVSCGEPFLPPNALQKAEKLEKQNWLKKDRILADLDTMRHKMRQLKGRRVAACQPATMVPTKSPVQPVVVEGGWTEQTQQEIKLMELIRHTEAHLSEIQEMESKINFPIATKRIAVKPSNLYKQPNTKRVWIYLNGGRPEDGTYAWGKTISELLQDCSSRLKMTHPARALYTPSGEPIQSWDDIERDMVICVSMGHGFKTPKELKQLMEIRANYARIRRQQGPQATDIVV 876          
BLAST of Doublecortin domain-containing protein vs. Ensembl Human
Match: DCDC1 (doublecortin domain containing 1 [Source:HGNC Symbol;Acc:HGNC:20625])

HSP 1 Score: 102.449 bits (254), Expect = 3.747e-21
Identity = 62/233 (26.61%), Postives = 113/233 (48.50%), Query Frame = 1
Query: 4510 VELWASSGEPFYFXXXXXXXXXXXXXXXXXXXQLKLEIDKKKFLLRTMKGERFKKLDAGTLEPTPSVKNPIIIKGNWQFPTNEEIKLEQEIESLQAKLND-----AKPQVETDSSQQKMLSRDLYKQKHLKSCFVHINGKNENTSVSVWGESVWEILENSAQLLGMKKSPKFLFKKDGMQVTSINQISTGDILAASSHSVFISPKASGLQCEIKANWGRARRQYGEDSTDIKI 5193
            + +W S GEPF    +     KL+ ++     ++  ++D  +  +R +KG R       T+ PT S   P++++G W   T +EIKL + I   +A L++     +K      + +  +   +LYKQ + K  ++++NG         WG+++ E+L++ +  L M    + L+   G  + S + I    ++  S    F +PK      EI+AN+ R RRQ G  +TDI +
Sbjct:  572 IAIWVSCGEPFLPPNALQKAEKLEKQNWLKKDRILADLDTMRHKMRQLKGRRVAACQPATMVPTKSPVQPVVVEGGWTEQTQQEIKLMELIRHTEAHLSEIQEMESKINFPIATKRIAVKPSNLYKQPNTKRVWIYLNGGRPEDGTYAWGKTISELLQDCSSRLKMTHPARALYTPSGEPIQSWDDIERDMVICVSMGHGFKTPKELKQLMEIRANYARIRRQQGPQATDIVV 804          

HSP 2 Score: 87.8113 bits (216), Expect = 1.197e-16
Identity = 126/519 (24.28%), Postives = 204/519 (39.31%), Query Frame = 1
Query: 2344 CTSILRLPSAARRLFTENGNEVYDLEGLQNYDLVFVSVGEIWCSPFKALTQIKLRSYANKLTVDIERLKYFNMLRRPNEDFVIGIRSDESGLLEIQILNEQSKLEIQK---IFNLENGNATPE-------PL---------IKSLVEDLEKNKSCHERSCEAANLKFKHKSFSDDSEVKIIEKS-------PKKVALSVSHIN-----RQQFLFESNRILTKNDPNMAIFAD----EIGKPVIIRKLVVNSDNQKCKWIIHDSGIIESMHFRGFVIDVYCPKMLPFQEKSSTNWSNC----LLVLEKPINTKYGRAHQKFKLDSRTGLFYPFATNDLDKDVTAAALASICTKYVCSNPLSQQGSYLEIN---QRQEASCNSCVSIMNGRYLI------TPFEIDNQTFSCD--LLGGFKVMNI-KPNLLQSRSEEVYQDFVHKLEIIRKKLTIKICKSRITESVSPNIQVLLHLNNNKTNSQSQQVTAKSISQLMGIATGVFNLQKPIRIFYTVKGEAI 3747
            CT IL LPSAARRL+ E G E++ L+ LQ  +LV+VS GE+W +P  ++ Q K + +   L  DI +++ F    +  E  V+ ++SD         +   SKL + K   IF  E     PE       PL         + S V    + K+CH      A  +  H    DDS  K  EK         KK + S  H        QQF +   +I++   P + +         G  V++  +   SD    +WI  +         R F + V  P ++     + T    C    ++   KP N   G A+QK+           F +  LDK++T+A  A +CT  V       Q  Y  ++   +R+   C +C   M     +       PF   + T +    L G FKV+++ + +L   ++E+    +  +L  +R K   +        +       ++   N       + + A +   L+   T    L +     YT  G  I
Sbjct:    2 CTEILNLPSAARRLYNEKGKEIFALKDLQRDELVYVSCGELWINPDLSIAQQKKQIFLRNLESDIAKIQIFCSTHK-IEALVLEVQSD---------IVSGSKLAVHKPVAIFGEEKQVTEPEEKQMQEDPLTTENASSEILDSHVRAHLRMKACHTLP-RYAWQETSHDFDEDDSLPKKTEKGLFENVEPQKKHSCSPKHSKLHKHCHQQFEYRDGQIISHAAPQLVLGVQGPNLRSGMEVVL--VEKKSDGSHQRWIHQEDS-------RTFHL-VSNPDLVLAVSMTKTRNEVCGYPVIVQKYKPYNN--GAANQKWHYMKNIKALVAFHSTALDKEITSANYAGVCTSSVIKEENIDQPGYCYLSPDGKRKTMLCLACGQSMRTEKGLKQLLPGVPFLCISGTKTQKPFLQGPFKVISVAEVDLSCDKAEKTLSYYQARLLSLRMKTCTQAASHSGMAATHQKAVKIIAYKNGDGYRNGKLIVAGTFPMLLTECTEQLGLARAASKVYTKDGTPI 497          
BLAST of Doublecortin domain-containing protein vs. Ensembl Human
Match: DCDC1 (doublecortin domain containing 1 [Source:HGNC Symbol;Acc:HGNC:20625])

HSP 1 Score: 82.0333 bits (201), Expect = 1.487e-15
Identity = 57/181 (31.49%), Postives = 94/181 (51.93%), Query Frame = 1
Query:  154 VLVKQNGKLYPLTRITGFSIDEILSNCTQIMKLTSAARKLYSKHGELIESLDKLKPND-----EVYVSLGEPFIDPLKIIKESILIREGSFWGLNGLYIPKSKRKAASACVTHTR----TERT-WRILTFSNGDYLINEAVEVISNLKDVEEVKSICGKKLNLNGQYKKLYNSDGFEITDL 666
            V   +NG      R+T  +I  +L  CT+ + L  AAR+++     L +  + L+P D     +VYVS GEPF++P K IK+ +L+ +   W +NGL +P   ++  +  V   R    TERT  RIL F NG  +  +  E+    + +++V   C  ++NLN   +  Y+  G +I D+
Sbjct:  176 VTAYKNGSRTVFARVTVPTITLLLEECTEKLNLNMAARRVF-----LADGKEALEPEDIPHEADVYVSTGEPFLNPFKKIKDHLLLIKKVTWTMNGLMLPTDIKRRKTKPVLSIRMKKLTERTSVRILFFKNG--MGQDGHEITVGKETMKKVLDTCTIRMNLNLPARYFYDLYGRKIEDI 349          
BLAST of Doublecortin domain-containing protein vs. Ensembl Human
Match: DCDC1 (doublecortin domain containing 1 [Source:HGNC Symbol;Acc:HGNC:20625])

HSP 1 Score: 66.6254 bits (161), Expect = 2.207e-10
Identity = 39/156 (25.00%), Postives = 76/156 (48.72%), Query Frame = 1
Query: 4510 VELWASSGEPFYFXXXXXXXXXXXXXXXXXXXQLKLEIDKKKFLLRTMKGERFKKLDAGTLEPTPSVKNPIIIKGNWQFPTNEEIKLEQEIESLQAKLN-----DAKPQVETDSSQQKMLSRDLYKQKHLKSCFVHINGKNENTSVSVWGESVWEI 4962
            + +W S GEPF    +     KL+ ++     ++  ++D  +  +R +KG R       T+ PT S   P++++G W   T +EIKL + I   +A L+     ++K      + +  +   +LYKQ + K  ++++NG         WG+++ E+
Sbjct:  228 IAIWVSCGEPFLPPNALQKAEKLEKQNWLKKDRILADLDTMRHKMRQLKGRRVAACQPATMVPTKSPVQPVVVEGGWTEQTQQEIKLMELIRHTEAHLSEIQEMESKINFPIATKRIAVKPSNLYKQPNTKRVWIYLNGGRPEDGTYAWGKTISEV 383          
BLAST of Doublecortin domain-containing protein vs. UniProt
Match: sp|M0R2J8|DCDC1_HUMAN (Doublecortin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=DCDC1 PE=1 SV=1)

HSP 1 Score: 292.352 bits (747), Expect = 2.418e-78
Identity = 332/1362 (24.38%), Postives = 560/1362 (41.12%), Query Frame = 1
Query:  154 VLVKQNGKLYPLTRITGFSIDEILSNCTQIMKLTSAARKLYSKHGELIESLDKLKPND-----EVYVSLGEPFIDPLKIIKESILIREGSFWGLNGLYIPKSKRKAASACVTHTR----TERT-WRILTFSNGDYLINEAVEVISNLKDVEEVKSICGKKLNLNGQYKKLYNSDGFEITDLKFLDDEESYVWNPNSNIVILGPIWASKMEDLNQSGVYHYFHKTTKEIKNLIKSSKSTLNEIEAIENSEFDKYPASKMKSFSKPELKVTKEEIKKTLKKYENAFEKFNEKFKQLPKPSDQQVTESETCTEKGLYQCTK----------GLRLKVYQNGQNPNKKFTIFFNISQAKRGINDSTI----LFNRFLDCLSESVHLSKVNDFSKGLLARRVFMEDGTEIKDVSDLSYDQAICVSYGENWIDPAYTCVCAKFHFVDNKLESSLVDLEFSSTNLKNFKVVKRFDDKDIIYSLPV----------------------LEYQKRPNLFMLSSLHXXXXXXXXXXXXXXS-------------WSYTITGRLILKSLPSLCLTLITSSKDSLRFHKHSLKQLVTDEISYYAVQLNSIHAHDSTQMWKFHTSGQLYNKAFPEFFLTYIEN---KSNVDQDDF-----------VDAIRN---------SNILAVEQFPEDLQKY------------------------------QRWAFKQESFANLSQWKVCDLPNPEWHKCALTWPLKSNGDLNDDLKWPIEGLLIPCAPPLNRRTCE-SESRFPIKLRVLKNNDHNMKQSMLVNGPDLTKLIKKGKQPPYETHCTNERLLKLEFQMFLDSCTSILRLPSAARRLFTENGNEVYDLEGLQNYDLVFVSVGEIWCSPFKALTQIKLRSYANKLTVDIERLKYFNMLRRPNEDFVIGIRSDESGLLEIQILNEQSKLEIQK---IFNLENGNATPE-------PL---------IKSLVEDLEKNKSCHERSCEAANLKFKHKSFSDDSEVKIIEKS-------PKKVALSVSHIN-----RQQFLFESNRILTKNDPNMAIFAD----EIGKPVIIRKLVVNSDNQKCKWIIHDSGIIESMHFRGFVIDVYCPKMLPFQEKSSTNWSNC----LLVLEKPINTKYGRAHQKFKLDSRTGLFYPFATNDLDKDVTAAALASICTKYVCSNPLSQQGSYLEIN---QRQEASCNSCVSIMNGRYLI------TPFEIDNQTFSCD--LLGGFKVMNI-KPNLLQSRSEEVYQDFVHKLEIIRKKLTIKICKSRITESVSPNIQVLLHLNNNKTNSQSQQVTAKSISQLMGIATGVFNLQKPIRIFYTVKGEAI 3747
            V   +NG      R+T  +I  +L  CT+ + L  AAR+++     L +  + L+P D     +VYVS GEPF++P K IK+ +L+ +   W +NGL +P   ++  +  V   R    TERT  RIL F NG  +  +  E+    + +++V   C  ++NLN   +  Y+  G +I D+  +   E  +   NS   + G +W SK E  + SG   Y       +   +KS+K    ++  + N + +K     + S +  E    +EE+ + + + + A +        L K   Q   E E  +   +YQ  K          GL+LKV++NG+N  +   I   IS+   G +DS I    +  R L  + + +  S +N       + R+F E+G EIK+   L  +Q I VSYG  +  P    +   F  V       ++ + + +    N  ++    + ++    P+                      L+ +  PN+ + +S+ I +   +      +S             W  T TG ++ +++   CL +          H   +K      +  Y + L   H+ D +Q W F T G +Y+KA+P+F LTY+E    + +V Q ++            +  RN         ++ L ++Q PE    +                              QRWA K E  +   QWK   + NP W+K    WP+  +G LN++  WPI+GLL+P +PP+ +  C+ +E   P++LRVL+N + N  +S+ + GPD++        P  +T CT                  IL LPSAARRL+ E G E++ L+ LQ  +LV+VS GE+W +P  ++ Q K + +   L  DI +++ F    +  E  V+ ++SD         +   SKL + K   IF  E     PE       PL         + S V    + K+CH     A   +  H    DDS  K  EK         KK + S  H        QQF +   +I++   P + +         G  V++  +   SD    +WI  +         R F + V  P ++     + T    C    ++   KP N   G A+QK+           F +  LDK++T+A  A +CT  V       Q  Y  ++   +R+   C +C   M     +       PF   + T +    L G FKV+++ + +L   ++E+    +  +L  +R K   +        +       ++   N       + + A +   L+   T    L +     YT  G  I
Sbjct:  176 VTAYKNGSRTVFARVTVPTITLLLEECTEKLNLNMAARRVF-----LADGKEALEPEDIPHEADVYVSTGEPFLNPFKKIKDHLLLIKKVTWTMNGLMLPTDIKRRKTKPVLSIRMKKLTERTSVRILFFKNG--MGQDGHEITVGKETMKKVLDTCTIRMNLNLPARYFYDLYGRKIEDISKVPLLEKCL--QNSITPLRGLLWVSKGEGFSPSGAKMYIQGVLLALYQRLKSAKKYYKQLNLVMNEQKEKITEKVILSMTAKEHHKEQEEVSRLIDELQTAIK---SNIGHLCKLGPQLQAEQEQFSSY-VYQHIKSLPANTLVPGGLQLKVFENGKNTGE---ISVGISKKDLG-SDSPIQTDHMMERLLLKIHQRLQGSSINPPGLNYSSMRLFDENGQEIKNPLSLKNEQKIWVSYGRAYRSPLNLALGLTFDRVSAFARGDIM-VAYKTFLDPNAVLLPGCGNWEVCEGFPINFNCTSQQIPDQFEKVDLENHFLQNKVDPNIVLHASVSIGKWSFSGSEASSRSQIAPSILWPVASVWLITKTGMILSRAITQGCLAI---------GHPIRVKAAEGTSLEGYKLILQKRHSGDDSQKWVFGTDGCIYSKAYPQFVLTYLEELNAQVDVTQTEYHIHHGAWTTAHQEHGRNLAEEVLQESASNLGLKQLPEPSDTHLMPEGSLEETGELTVALVRKLEEKHPKASAQRWAIKHEGTSKPGQWKHSRVENPLWNKLTYMWPVLPSGQLNEEFDWPIQGLLVPSSPPMKKPICKTTEPYAPVRLRVLQNGEKNKNRSVTILGPDIS--------PGRKTQCTE-----------------ILNLPSAARRLYNEKGKEIFALKDLQRDELVYVSCGELWINPDLSIAQQKKQIFLRNLESDIAKIQIFCSTHK-IEALVLEVQSD---------IVSGSKLAVHKPVAIFGEEKQVTEPEEKQMQEDPLTTENASSEILDSHVRAHLRMKACHTLPRYAWQ-ETSHDFDEDDSLPKKTEKGLFENVEPQKKHSCSPKHSKLHKHCHQQFEYRDGQIISHAAPQLVLGVQGPNLRSGMEVVL--VEKKSDGSHQRWIHQEDS-------RTFHL-VSNPDLVLAVSMTKTRNEVCGYPVIVQKYKPYNN--GAANQKWHYMKNIKALVAFHSTALDKEITSANYAGVCTSSVIKEENIDQPGYCYLSPDGKRKTMLCLACGQSMRTEKGLKQLLPGVPFLCISGTKTQKPFLQGPFKVISVAEVDLSCDKAEKTLSYYQARLLSLRMKTCTQAASHSGMAATHQKAVKIIAYKNGDGYRNGKLIVAGTFPMLLTECTEQLGLARAASKVYTKDGTPI 1462          

HSP 2 Score: 102.834 bits (255), Expect = 2.420e-20
Identity = 62/233 (26.61%), Postives = 113/233 (48.50%), Query Frame = 1
Query: 4510 VELWASSGEPFYFXXXXXXXXXXXXXXXXXXXQLKLEIDKKKFLLRTMKGERFKKLDAGTLEPTPSVKNPIIIKGNWQFPTNEEIKLEQEIESLQAKLND-----AKPQVETDSSQQKMLSRDLYKQKHLKSCFVHINGKNENTSVSVWGESVWEILENSAQLLGMKKSPKFLFKKDGMQVTSINQISTGDILAASSHSVFISPKASGLQCEIKANWGRARRQYGEDSTDIKI 5193
            + +W S GEPF    +     KL+ ++     ++  ++D  +  +R +KG R       T+ PT S   P++++G W   T +EIKL + I   +A L++     +K      + +  +   +LYKQ + K  ++++NG         WG+++ E+L++ +  L M    + L+   G  + S + I    ++  S    F +PK      EI+AN+ R RRQ G  +TDI +
Sbjct: 1537 IAIWVSCGEPFLPPNALQKAEKLEKQNWLKKDRILADLDTMRHKMRQLKGRRVAACQPATMVPTKSPVQPVVVEGGWTEQTQQEIKLMELIRHTEAHLSEIQEMESKINFPIATKRIAVKPSNLYKQPNTKRVWIYLNGGRPEDGTYAWGKTISELLQDCSSRLKMTHPARALYTPSGEPIQSWDDIERDMVICVSMGHGFKTPKELKQLMEIRANYARIRRQQGPQATDIVV 1769          
BLAST of Doublecortin domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|23516750 (tr|A0A210QPQ2|A0A210QPQ2_MIZYE Doublecortin domain-containing protein 5 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT18210 PE=4 SV=1)

HSP 1 Score: 397.897 bits (1021), Expect = 1.140e-108
Identity = 348/1367 (25.46%), Postives = 616/1367 (45.06%), Query Frame = 1
Query:  127 FLKTVPAMVVLVKQNGKLYPLTRITGFSIDEILSNCTQIMKLTSAARKLYSKHGELIESLDKLKPNDEVYVSLGEPFIDPLKIIKESILIREGSFWGLNGLYIP-----KSKRKAASACVTHTRTERTWRILTFSNGDYLINEAVEVISNLKDVEEVKSICGKKLNLNGQYKKLYNSDGFEITDLK---FLDDEESYVWNPNSNIVILGPIWASKMEDLNQSGVYHYFHKTTKEIKNLIKSSKSTLNEIEAIENSEFDKYPASKMKSFSKPELKVTKE-------EIKKTLKKYENAFEKFNE-KFKQLPKPSDQQVTESETCTEKGLYQCTKGLRLKVYQNG-QNPNKKFTIFFNISQAKRGI----NDSTILFNRFLDCLSESVHLSKVNDFSKGLLARRVFMEDGTEIKDVSDLSYDQAICVSYGENWIDPAYTCVCAKFHFVDNKLESSLVDLEFSS--TNLKNFKVVKRFDDKDIIYSLPVLEYQK----------RPNLFMLSSLHXXXXXXXXXX------------------------XXXXSWSYTITGRLILKSLPSLCLTLITSSKDSLRFHKHSLKQLVTDEISYYAVQLNSIHAHDSTQMWKFHTSGQLYNKAFPEFFLTYIENKSNVDQDDFVD------AIRNSNILAVEQFPEDLQKYQRWAFKQESFANLSQWKVCDLPNPEWHKCALTWPLKSNGDLNDDLKWPIEGLLIPCAPPLNRRTCES--ESRFPIKLRVLKNNDHNMKQSMLVNGPDLTKLIK------------KGKQP--PYETHCTNERLLKLEFQMFLDSCTSILRLPSAARRLFTENGNEVYDLEGLQNYDLVFVSVGEIWCSPFKALTQIKLRSYANKLTVDIERLKYFNMLRRPNEDFVIGIRSD-------------ESGL--------LEIQILNEQSKLEIQKIFNLENGNATPEPLIKSLVEDLEKNKS-----------CHERSCEAAN---------LKFKHKSFSDDSEV------KIIEKSPKKVALSVSHINRQQFLFESNRILTKNDPNMAIFADE----IGKPVIIRKLVVNSDNQKCKWIIHDSGIIESMHFRGFVIDVYCPKMLPF---QEKSSTNWSNCLLVLEKPINTKYGRAHQKFKLDSRTGLFYPFATNDLDKDVTAAALASICTKYVCS-NPLSQQGSYLEI-----NQRQEAS----CNSCVSIMNGRYLITPFEIDNQTFSCDL----------LGGFKVMNIKPNLLQSRSEEVYQDFVHKLEIIRKKLTIKICKSRITESVSP-NIQVLLHLNNNKTNSQSQQVTAKSISQLMGIATGVFNLQKPIRIFYTVKGEAI--VDDL 3759
            + K    + V   +NG      R+   ++   L  CT  + L  AAR+++ + G  +     +  + EV+VS GE + DP K IK +++I +G+ W L+G+ IP     ++K    S  +     +R  RI+ + NG  +  E VEV+++L  +++    C  KL+L    K +Y+ +G E+T L     LDD       P     ILGP+W S  E  + +   HY     + + + +K ++    EI      + +    + + S S+ EL  T +       ++K TL   ++      E K K+  + ++ +++  +  +        KGLRLKVY+NG     ++F  FFNI+ A +G     +       R LD LS +   S   +     +ARR+F   G EIKD+  L YDQ I VS+GE +I P + C+ A F   D      L D+   S   NL++    K   D +     P   Y+K          + +L  LS L         +                            + W  +  G +  K +P+LCL +   S   + F+  S K+  +   S + + +    + +  Q WKF+    + N A P+  +TY  +K   D++ +V        +R   +L  +        +QR+A KQE F NL QWK  +  N EW+K A +WP + +G LN+D  WP+EG +IP APPL++ + ++      P++L  LKN + ++++++ V GP+LT ++K            KG Q   P +   ++ +  +LE  MFLD CTS+L +P AARRLF ++GNE + L  L+  D+V+VS GE W  P     + + R   ++L+ D+ +++ +  LR P E++V+ +  +             +SG+         + +  + ++     K     +  A  E  + S V D E   S            HERS +  N         +  ++ +  +D E       ++ E+        +S    Q+F+FE   +  + + N+ +   E    I +  I+++     D+   +++I ++G I + H +  V+ V  P   PF   +E  +  +S C + +++     YG++HQ++  D+ TG  + F TN  DK++TAA  A +C+  +     + Q G   E+       RQ       C SC   M GRY +     +N  FSC +          +G F+V+N K +L +  +E   +++   L  +R++ +++     I+ + +P +++++ + N      Q + +   SI  ++G  T    +    +  +T  G  +  +DDL
Sbjct:  177 YKKQPTTIRVTAFKNGSRENFVRVAAPTVKIFLEMCTDKLGLPFAARRIFLEDGIEVTDHRDIPMDGEVFVSTGENYKDPYKNIKRNMIISQGAKWTLSGVLIPEEGHIRTKTSKMSKRMKALTEKRRIRIIVYRNG--MSTEPVEVVADLNKLDDFMVACTGKLDLRSHAKIVYDWEGNEVTHLTQTPVLDD----CLQPGGT-AILGPVWVSIGESFSATATLHYIRSIKQVLTDRLKDAQRYKTEINYAMQGQKETISITAILSMSEEELYTTHQLAEKEISQLKATLSSLKSKIATIEEVKIKEENEGANYRMSHIQEFSFDHKLVGRKGLRLKVYENGFYGEGQQF--FFNIADALKGTGSDKDGRKRQLQRLLDDLSTNRVFSNPVNPKLTPVARRMFDRYGNEIKDILKLEYDQEIWVSFGEPFITPFFYCLQATF---DRAKGYDLGDVNGISREANLESLDQFKSHHDFETHIGFPSDGYEKVKDPNVALHIKDDLMPLSELGQGGHYMQAKKDKSIVLYPEAAITQKVKKDKTLWPMEAQVWVISKRGYIYSKGMPTLCLAV---SDTRVEFNI-SEKEGTS---SGFVINMQKATSGNIYQQWKFNPDATISNLAHPDLVITYTGHKMG-DEEAYVPIEGVSPGVRVYLVLMDKLTSRKEAGFQRFALKQERFDNLGQWKFNEATNQEWNKQAYSWPAREDGSLNEDYDWPMEGYIIPNAPPLHKSSGKNNLSGMTPLRLMCLKNGEQDVRKAIPVVGPNLTNMVKDLRSEKGDKSQQKGSQEAQPEDEEVSHGK-EELELAMFLDHCTSLLDMPFAARRLFDQHGNEHFSLTRLKRDDVVYVSCGEAWSDPKMTKAEQQRRFLLSQLSQDVAKIRQYCALRNP-ENYVMEVEGNLVPGNRINVNQLWQSGMDDQDDDDKFDTRSRSSKASKAPSKASKAHSSKAGSE--VGSHVTDDELRSSGDFGGQTAHEIAHERSEQRLNQLKWPWERLVNVENGNLDNDPEANKYTDREMYERYKPAPNPKISRDTLQRFVFEDGYLACQANRNLVLGVQEQEGRISQVTIVKR---RPDDIYQRFVIKENGEIRAKHGQRTVLTVSLPANEPFSEDEEGRTLTYSGCAVTIQQRKTNMYGKSHQRWHYDAETGHIHAFKTNRYDKEITAANKADVCSYSIAQETEIDQPGYVAEVPMATPTDRQHIKEIRVCTSCARAMRGRYKLQKIR-ENTEFSCAMGQAKRLKLQQIGSFRVLNGKVDLSEHEAELTLENWEDTLTKLREETSVRTIAKEISVAKTPISMKIMAYKNGEGRLHQGKLICGSSIEGILGQCTYKLGMANAAQKIFTEDGTLVLEIDDL 1515          

HSP 2 Score: 137.117 bits (344), Expect = 2.804e-28
Identity = 80/273 (29.30%), Postives = 142/273 (52.01%), Query Frame = 1
Query: 4444 VEVPISDIGSVINEPVYKQFELVELWASSGEPFYFXXXXXXXXXXXXXXXXXXXQLKLEIDKKKFLLRTMKGERFKKLDAGTLEPTPSVKNPIIIKGNWQFPTNEEIKLEQEIESLQAKLNDAKPQVETDSSQQKMLSRDLYKQKHLKSCFVHINGKNENTSVSVWGESVWEILENSAQLLGMKKSPKFLFKKDGMQVTSINQISTGDILAASSHSVFISPKASGLQCEIKANWGRARRQYGEDSTDIKIQYRPNTLIDVDPFEPPDIMRNVK 5262
            V VP  D+  ++  P+       E+W SSG+ F   +    K + + K     S + LE+D +K +LR M+  R   +  G    T S ++P++I+G+WQ  T EE      +  L+  L + K   +  +     +   LY+Q + K   V  NG++   +  VWG+++ +IL+++   LGM +  K+L+  +G  +   + I+  ++L  S    F+  ++  +  EIKANW RAR++YG + TD  ++ +PN  + VDPF PP++   +K
Sbjct: 1782 VTVPSEDV--ILRYPI-------EVWVSSGKEFIPPEKVESKMESQVKKRAFRSTVSLELDIEKHILRNMRARRIDDMSPGKYRSTRSTQHPVVIEGHWQDVTVEEQMKHDTVHKLETHLAEVKNNQKEKAKSLVNIGGRLYRQPNTKRVLVFPNGESVERATYVWGDTLEQILDSAKLRLGMWQPAKYLYNMEGRLMLKFDDINRDELLCVSGGKSFVRSQSFTVGIEIKANWARARKEYGPEGTDFVVEAQPNPTVYVDPFGPPELAMPLK 2045          
BLAST of Doublecortin domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|20324039 (tr|A0A1S3J1J0|A0A1S3J1J0_LINUN uncharacterized protein LOC106169385 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106169385 PE=4 SV=1)

HSP 1 Score: 381.333 bits (978), Expect = 1.465e-103
Identity = 329/1388 (23.70%), Postives = 609/1388 (43.88%), Query Frame = 1
Query:  121 PLFLKTVPAMVVLVKQNGKLYPLTRITGFSIDEILSNCTQIMKLTSAARKLYSKHGELIESLDKLKPNDEVYVSLGEPFIDPLKIIKESILIREGSFWGLNGLYIPKSKRKAASACVTHTR-----TERTWRILTFSNGDYLINEAVEVISNLKDVEEVKSICGKKLNLNGQYKKLYNSDGFEITDL---KFLDDEESYVWNPNSNIVILGPIWASKMEDLNQSGVYHYFHKTTKEIKNLIKSSKSTLNEIEAIENSEFDKYPASKMKSFSKPELKVTKEEIKKTLKKYENAFEKFNEKFKQL-PKPSDQQVTESETCTEKGLYQC--------TKGLRLKVYQNGQNPNKKFTIFFNISQAKRGI-NDSTILFNRFLDCLSESVHLSKVNDFSKGLLARRVFMEDGTEIKDVSDLSYDQAICVSYGENWIDPAYTCVCAKFHFVDN--------------------------------------KLESSLVDLEFSSTNLKNFKVVKRFDDKDIIYSLPVLEYQKRPNLFMLSSLHXXXXXXXXXX----XXXXSWSYTITGRLILKSLPSLCLTLITSSKDSLRFHKHSLKQLVTDEISYYAVQLNSIHAHDSTQMWKFHTSGQLYNKAFPEFFLTYIE----NKSNVDQDDFVDAIRNSNILAVEQFPEDLQKYQRWAFKQESFANLSQWKVCDLPNPEWHKCALTWPLKSNGDLNDDLKWPIEGLLIPCAPPLNRRTCESESRFPIKLRVLKNNDHNMKQSMLVNGPDLTKLIK-------KGKQPPYE-----------------------THCTNE-RLLKLEFQMFLDSCTSILRLPSAARRLFTENGNEVYDLEGLQNYDLVFVSVGEIWCSPFKALTQIKLRSYANKLTVDIERLKYFNMLRRPNEDFVIGIRSDESGLLEIQILNEQSKLEIQKIFNLENG-NATPEPLI-----------KSLVEDLEKNKSCHERSCEAANLKFK-----------HKSF------SDDSE------VKIIEK---SPKKVALSVSHINRQQFLFESNRILTKNDPNMAIFADE----IGKPVIIRKLVVNSDNQKCKWIIHDSGIIESMHFRGFVIDVYCPKMLPF--QEKSSTNWSNCLLVLEKPINTKYGRAHQKFKLDSRTGLFYPFATNDLDKDVTAAALASICTKYVCSNPLSQQGSYL----EINQRQEA--SCNSCVSIMNGRYLITPFEIDNQTFSCDL----------LGGFKVMNIKPNLLQSRSEEVYQDFVHKLEIIRKKLTIKICKSRITES--VSPNIQVLLHLNNNKTNSQSQQVTAKSISQLMGIATGVFNLQKPIRIFYTVKGEAIVD-----DLSFRNIMGKVRDNL 3798
            P++ +    +V    +NG       +   +I E+L  CT  + LT+AAR+++   G  + S  ++  + E+Y+S GEPF +P   +K + ++++G+ W +NGL +P+  +   +      R      ++  RIL F NG    +   E+++++ +       C  KL+L    + LY+ +G E+TDL     +D        P     +LGP+W SK E  +  G + +        K  ++ +K    ++E +  S  D      + + ++ E+    + +++ +++   A +K   + +++ P   +++V  +E    K + +          +G++LKVY+NG   ++   +FFN+ +  +GI      +  R LD       L+     +   + R+++ + G  + D   L  D  + +S+GE +  P   C+ A F  V                                          E + VD + ++   ++   +++  + +I  +   L+++  P L +   L +  K+            ++W  + TG +  K +P L L +       ++    ++    T EI  Y V L         Q W F   G +Y  A+P+  LT++     + S V+  + V       +   ++      + QRWA KQE F NL QWK   + NPEW+K A +WP+  +G+ N+D  WP+EG LIP  PPL  +  +     P++L V+KN +  M +++ V GPDLT ++K        GK+P                           HC ++  LL+LEF +FL+ CT+++ LP AARRLF E G E   L+GL+   LV+VS GE W  P     + + R     L  DI +++ +  LR P +D V+ +  D + +   +++ +   L  ++  ++ +G  A  + LI           + + E L +N+S HER+   ++ +             H SF      +DDS+       ++ EK    PK    +V  +N Q+F FE+  I    +PN+ +   E    +   V+++K     D+   +W + D G + S H    V+ V  P +     ++ ++ ++  C + L+   NTKYG A+QK+  D   G  Y F T+  D ++TAA  A++CT  V       Q  Y+      N + E    C SC   M G+  +   +  N  F+C +           G F  +N K +L    +E    ++  + E +R++ ++++    I  +  + P +++ ++ N          +   SI  L+   T    +    R  YT  G  ++D     + +  + M K+++N+
Sbjct:  206 PVYKRQPFTIVATAFKNGSRETFVNVAAPTIKELLEQCTDKLGLTAAARRVFLDDGIEVFSPREIPRDAEIYISQGEPFKNPFLPLKRNNMMKQGATWTMNGLVLPQEAKPGPTKPNLSKRFRQQLGKKNRRILIFKNG-VGHDGGYEIVADMDNTPAFMQACTGKLDLGSHARVLYDWEGKEVTDLYETPLIDQCLQACATP-----VLGPLWVSKGEGFSPKGPFDFISGLLHHTKTKLREAKHYKEQLE-MAKSNPDNVEIRSILAMTENEVDEALQMVERDIEELTEAKQKLKAQLEKIEPDAKEEEVQGAEFRMAKTIRKLEASDRLVGVQGIKLKVYENGTYEDET-VVFFNLKETSKGIEGQKDKIMQRLLDQCGTLGRLAFPKTPAISSMPRKLYDQHGKVVTDPYALKDDMELWLSFGEGFRVPYVYCLQAMFDKVHGLNLYGEKNVGVREPLIAEEIPKDGEYSYSWEATVGFPLSYEFTQVDADMNAAEREH--ALEQVKNNEINVNWGFLQHKDNPRLVLFPELMVDMKKIFDSKDLWPQESQTWVISKTGYIYCKPMPQLTLAVT-----DMKLEGTTVNGAGT-EIQGYVVALQKKMVGSPYQQWGFTADGYIYCLAYPDLVLTHLGATGIDDSMVNNAEGVLPGHKFYVAVSDKINGKDARLQRWAIKQERFDNLGQWKHSKITNPEWNKRAYSWPVNEDGNWNEDFDWPMEGFLIPGVPPLKTKE-KPHGHVPLRLTVMKNGEKEMYKAVQVVGPDLTNMMKDVNKTAMNGKRPHTAHNHKHKRTRTADTDVDSVDGDPNVHCRDDLTLLQLEFMLFLERCTNLIDLPFAARRLFDEKGIEHTTLQGLKRDQLVYVSCGEAWNDPKLTKAEQQRRYLLATLGQDIAQIRQYVALRNP-QDLVLAV--DSALVPNAKLVVQTCCLTPEQRHSILSGEEARQKQLIEEQRKEQEEKKRQIEEMLHENRSAHERAHLKSDQRLDSLRWPWERVNLHGSFDDVINANDDSDEPGYTSPELYEKYKPKPKSSPRNVG-MNLQKFKFENGHISCVYNPNLVLGVVESETRVADVVLVKK---KPDDAYQRWTLTDDGFLRSKHSPSMVLTVNMPAVQRHEAEDAATPSYPGCGVTLQHKKNTKYGAANQKWGFDPELGFLYAFKTDATDMEITAANKANVCTYAVRQGESLDQPGYIVYMATSNSKSEEVIMCTSCSRAMRGQQKVRRLD-RNVDFACAMGSAREKGLKQAGSFHCLNGKVDLSTFEAENTLSEWEDQFERLREERSVRVIAREINAARFIKP-VKIYVYRNGEGRMKPGHVLVGSSIVGLLDQCTHALQMANAARRLYTSDGMLVLDVEDLINWAVDDYMTKIKENM 1567          

HSP 2 Score: 173.711 bits (439), Expect = 2.371e-39
Identity = 90/246 (36.59%), Postives = 151/246 (61.38%), Query Frame = 1
Query: 4510 VELWASSGEPFYFXXXXXXXXXXXXXXXXXXXQLKLEIDKKKFLLRTMKGERFKKLDAGTLEPTPSVKNPIIIKGNWQFPTNEEIKLEQEIESLQAKLNDAKP-QVETDSSQQKM-LSRDLYKQKHLKSCFVHINGKNENTSVSVWGESVWEILENSAQLLGMKKSPKFLFKKDGMQVTSINQISTGDILAASSHSVFISPKASGLQCEIKANWGRARRQYGEDSTDIKIQYRPNTLIDVDPFEPP 5241
            +E+WAS+GE F   +    K     ++ +  + +  E++K+K +LR M+G R ++L+ G  +PT S +NP++I+GNWQ PT +E +   ++  LQ+ L++ K  Q E   ++  + +SR+LY Q  +K   V  NG++   +  VWG S+ EIL+ S   L + K+ K+L+  DG Q++  ++I    ILA S+   F+ P+ S +  E+KANWGRAR+QYG  +T+I +++  +  I+VDPF PP
Sbjct: 1673 IEVWASAGEAFVKPEDAEEKYLQGIQNREERAAVTYELEKEKHVLRQMQGRRLEELNPGEYKPTRSTRNPVLIEGNWQEPTFDEQRKHDKVHQLQSHLSEVKAAQKEVTKTKPTVNISRNLYAQPVVKRILVFPNGEDLQHATYVWGGSIGEILDASVSRLNLMKAAKYLYTLDGKQISDFDEIKRDMILAVSTGKGFLKPRDSSVNVEVKANWGRARKQYGPKATEIMVKHTRDMNIEVDPFGPP 1918          
BLAST of Doublecortin domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|17245708 (tr|A0A3S0ZL12|A0A3S0ZL12_ELYCH Uncharacterized protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_022372 PE=4 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 1.025e-100
Identity = 349/1353 (25.79%), Postives = 594/1353 (43.90%), Query Frame = 1
Query:  220 ILSNCTQIMKLTSAARKLYSKHGELIESLDKLKPNDEVYVSLGEPFIDPLKIIKESILIREGSFWGLNGLYIPKSKRKAASACVTHTRTE-----RTWRILTFSNGDYLINEAVEVISNLKDVEEVKSICGKKLNLNGQYKKLYNSDGFEITDLK---FLDDEESYVWNPNSNIVILGPIWASKMEDLNQSGVYHYFHKTTKEIKNLIKSSKSTLNEIEAIENSEFDKYPASKMKSFSKPELKVTKEEIKKTLKKYENAFEKFNEKFKQLPKPSDQQVTES---------ETCTEKGLYQCTKGLRLKVYQNGQNPNKKFTIFFNISQAKRGI-----NDSTILFNRFLDCLSESVHLSKVNDFSKGLLARRVFMEDGTEIKDVSDLSYDQAICVSYGENWIDP-AYT---CVCAKFHFVDNKLESSLV--------DLEFSSTNLK------NFKVVKRFDDKDII-YSLP--------VLEYQKRPNLFMLS-----SLHXXXXXXXXXXXXXXSWSYTITGRLILKSLPSLCLTLITSSKDSLRFHKHSLKQLVTDE--ISYYAVQLNSIHAHDSTQMWKFHTSGQLYNKAFPEFFLTYIENKSNVDQD-----------------------DFVDAIRNSNILAVEQFPEDLQKYQRWAFKQESFANLSQWKVCDLPNPEWHKCALTWPLKSNGDLNDDLKWPIEGLLIPCAPPLNRRTCES---ESRFPIKLRVLKNNDHNMKQSMLVNGPDLTKLI------------KKGK----------QPPYETHCTNERLLKLEFQMFLDSCTSILRLPSAARRLFTENGNEVYDLEGLQNYDLVFVSVGEIWCSPFKALTQIKLRSYANKLTVDIERLKYFNMLRRPNEDFVIGIRSDESGLLEIQILNEQSKLEIQKIFN----------LENGNATPEPLIKSLVEDLEK----------------NKSCHERSCEAA-----NLKFKHKSF--------SDDSEVK------IIEK-SPKKVALSVSHINRQQFLFESNRILT----KNDPNMAIFADEI--GKPVIIRKLVVNSDNQKCKWIIHDSGIIESMHFRGFVIDVYCPKMLPFQEKSST---NWSNCLLVLEKPINTKYGRAHQKFKLDSRTGLFYPFATNDLDKDVTAAALASICTKYVCS-NPLSQQGSYLEI-----NQRQEASCNSCVSIMNGRYLI------TPFEI---DNQTFSCDLLGGFKVMNIKPNLLQSRSEEVYQDFVHKLEIIRKKLTIKICKSRITES-VSPNIQVLLHLNNNKTNSQSQQVTAKSISQLMGIATGVFNLQKPIRIFYTVKGEAIVD 3753
            +L   T+ + L  A R+++ + G  +     + P+ ++Y+S+GE F DP +  K S+++R  S W L G+ +P+  RK        +R       +  RI+ + NG     E  EV+++LK++E     C  KL L    +  Y+ +G EITDL     LDD  S V         LGP+W S  E  + SG   +       +K  +K++K    EI+   ++E +K  +  + S S  EL    E++++ + K ++A     +K + L + + Q+  E          E   E  L   TKG++LKV++NG   N+ F  FFN+ +A +G+     N + ++  R LD LS +   +  N   K   A ++F + G E+ DV+ L  +Q++ +S+GE +I P  Y    C+      VD   E  +V        DLE  S +         F  + + D+++++ Y  P        + E   R +  +L      +LH         ++  + + Y   G L  K+ P LCL +     ++         QL   E  +  + V +      + +Q+W+  +   +Y +A+P   LTY+ NK +  QD                       +F    ++  ++  +  P+     QR+AFKQE F NL QW+  D  N EW K A +WP++ NG LN D  WP+EG L+P APPL R++C+        P++LRV+KN + +   ++ V GP+LT ++            KKG+          +   E H  +  + ++EFQMFL   T +L LP AARRLF   G E++ ++GL+   LV  S GE W  P     + K R   ++L+ DI +++ +  LR P EDFV+ I    SG      +  QSKL + K FN           E G+  P    +S   D ++                + S H+RS   +      LK+  +          ++D E        + EK  P++V+   S    Q+F FE   I      +   ++ + A E   G  + +       D+   +W+I ++G I S   +   + V  P      +  +    ++ +C + L+    + +G+AHQ+++ D+ +GL + F  +  DK++TAA  A +CT  +     + Q G  +EI        ++  C SC   M GRY +      T F     D +      +G FK +N K +L    +      +   L  +RK+ ++      I  + V   ++V+ + N        + +   SI  ++G       +    R  Y   G  ++D
Sbjct:  204 LLEFATEKLGLPFAGRRVFLEDGVEVFHEKDIPPDGDIYISMGEKFKDPFRSTKRSMIVRNSSMWTLTGIILPEKGRKRRVRTRMSSRMRALCENKKVRIMVYKNG--CSTEPSEVVADLKNMECFLMCCTSKLGLRTHARIAYDWNGTEITDLSDTPILDD--SIVQQ--GKTPFLGPLWISMGEGFSPSGTQGFLLMVQGALKEKLKAAKKHKTEIDLALDNEKEKVTSPVILSMSADELYEASEKVEEEVDKLKDALSVVADKLEALKEGARQEEEEGMKYRMTHIQELSCEDRLV-GTKGIKLKVFENGHADNE-FLYFFNLREAYKGLKNVKDNINELVLKRLLDELSNTRFSAGANRNLK-TTATKLFNKFGGEVTDVTKLQQEQSVWISFGEPFICPFTYALQLCLEKATPVVDGNGEQRIVKESVLADPDLEKLSKDPSRWEASIGFPALYQPDEEELMQYGDPAKVELLLEISEVDSRSHFLLLKDKYNVALHPEIVVTEKAHSRSQLFVYNEAGYLYCKAAPQLCLAVSDGRVEA---------QLSCQESPVDGFVVCMQKRMVGNPSQIWRCTSDATMYCEAYPNLLLTYVGNKKDEVQDSEDSNNNFGGQEPNLGENNTATTEFKPKAKDIYLIVADPLPKKEMAAQRFAFKQEKFDNLGQWRYTDYSNSEWSKQAFSWPVRMNGQLNKDYDWPMEGYLLPNAPPL-RKSCKKSGLSGMTPVQLRVMKNGERSADAAVTVVGPNLTNIMNKSAKKEQANKHKKGRAKQALPVDEYEDELELHSLDMTVTEMEFQMFLAQVTGVLDLPFAARRLFDCQGKELFTIQGLERGSLVVASCGEEWSDPRLTRMEQKRRFLLSQLSSDIVKIRQYCALRNP-EDFVLEI----SG-----PVAPQSKLVVGKQFNKTGEEKGRDQSERGDHRPPSGKRSAEPDNDRLSEELDALDEEEVVPGDMSAHQRSHARSEQRMDTLKWPWERLVNVNNSLDAEDPEASKYTDRDMYEKFKPQRVSRQ-SRETFQRFEFEDGYITVSASGRGSSSLVLAASEAESGHKLDVVLAKRRPDDVLQRWLIRENGEIVSRANQRLALTVSMPSTSLAGDGDNAGELSFQDCPVTLQVRCESTFGKAHQRWRYDAESGLIHAFWADIHDKEITAANQADVCTYSIAQVADIDQPGYEVEIQNPKVGMTKQKVCTSCARAMRGRYKVQRLPPHTAFHCAMGDAKKLKIQEVGSFKKLNNKVDLSTFEAPLTLTFWQDTLLNLRKQTSVVTIAHEINAAKVVRTVKVMAYKNGEGRLRHGEIICGSSIEGILGQCAHRLGMTSAARRMYLEDGSLVLD 1526          
BLAST of Doublecortin domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|15749733 (tr|R7URV3|R7URV3_CAPTE Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_220130 PE=4 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 2.298e-100
Identity = 333/1355 (24.58%), Postives = 609/1355 (44.94%), Query Frame = 1
Query:  124 LFLKTVPAMVVLVKQNGKLYPLTRITGFSIDEILSNCTQIMKLTSAARKLYSKHGELIESLDKLKPNDEVYVSLGEPFIDPLKIIKESILIREGSFWGLNGLYIPKSKRKAASACVTHTR-----TERTWRILTFSNGDYLINEAVEVISNLKDVEEVKSICGKKLNLNGQYKKLYNSDGFEITDLKFLD--DEESYVWNPNSNIVILGPIWASKMEDLNQSGVYHYFHKTTKEIKNLIKSSKSTLNEIEAIENSEF-DKYPASKMKSFSKPELKVTKEEIKKTLKKYENAFEKFNEKFKQLPKPSDQQVTESETCTEKGLYQC--------TKGLRLKVYQNGQNPNKKFTIFFNISQAKRGI-NDSTILFNRFLD-CLSESVHLSKVNDFSKGLLARRVFMEDGTEIKDVSDLSYDQAICVSYGENWIDPAYTCVCA---KFHFVDNK---------LESSLVDLEFSSTNLKNFKVVKRFDDK----DIIYSLPVLEYQKRPNLFMLSSLHXXXXXXXXXX--------------------------XXXXSWSYTITGRLILKSLPSLCLTLITSSKDSLRFHKHSLKQLVTDEISYYAVQLNSIHAHDSTQMWKFHTSGQLYNKAFPEFFLTYI-------ENKSNVDQDDFVDAIRNSNILAVEQFPEDLQKYQRWAFKQESFANLSQWKVCDLPNPEWHKCALTWPLKSNGDLNDDLKWPIEGLLIPCAPPLNRRTCESES--RFPIKLRVLKNNDHNMKQSMLVNGPDLTKLI--------KKGKQPPYET-------HCTNE-RLLKLEFQMFLDSCTSILRLPSAARRLFTENGNEVYDLEGLQNYDLVFVSVGEIWCSPFKALTQIKLRSYANKLTVDIERLKYFNMLRRPNEDFV-----------IGIRSDESGLLEIQILNEQSK----LEIQKIFNLENGNATPEPLIKSLVED-LEKNKSCHERSCEAA---NLKFKHKSFSDDSEVKIIEKSPKKVALSVSHINRQQFLFESNRILTKNDPNMAI-FADEIGKPVIIRKLVVNSDNQKCKWIIHDS----------------GIIESMHFRGFVIDVYCPKMLPFQEKSSTNWSNCLLVLEKPINTKYGRAHQKFKLDSRTGLFYPFATNDLDKDVTAAALASICT-KYVCSNPLSQQGSYLEIN------------QRQEASCNSCVSIMNGRYLITPFEIDNQTFSCDL----------LGGFKVMNIKPNLLQSRSEEVYQDFVHKLEIIRKKLTIKICKSRITESVSP-NIQVLLHLNNNKTNSQSQQVTAKSISQLMGIATGVFNLQKPIRIFYTVKGEAIVD 3753
            L+ +    +VV   +NG    + ++   +I  +L NCT  + L+SAAR+++   G  + +  ++  + EV++S GE F DP K + +   + + + W  NG+   +  +K A+      R      +   R+L F NG    ++  E++++    E+    C  KL+L    + LY+ +G EI +L+     D+    W+      +LGP+W SK E  +  GV  +        K  +K ++    +++  ++ E  DK     + S S  E++ + + + K  + + NA  +  ++  ++ +   ++  E    T K + +         TKG+RL+VY+NG + + +  IFFN+ QA RGI +D  +L  R LD C S S+  +   + +   + ++++   G+ I DV DL YDQ I +S+GE W +P    V A   K   +D +          E  +V+         N++V++   D     D+   +  +E +    L   S +H                                       +SW  +  G +  K+ P L L        +   H H         +  +A+ +    A  + Q W F   G + N A P   LTY+       E++ + + +      +    L  +Q    L K QRWA KQE   NL QWK     NPEW K AL+WP+  +G LND+  WP+EG L+P APP+  +  + +S     I+L VLKN + ++ + + V GPDLT +         K  K P  E+       HC  +  +L+LE  MFL+ CTS+L LP AARRLF +NG E + L  L+   +++V+ GE W  P  +  + + R     L  D+++++ F +LR P+   +           + + S+ SG  E     ++ K     E+     L NG  +   +     E+ L + K   ER  +         + K+FS+    +  ++  ++  + +  +  Q+F+FE   I+ + D ++ +  +++ G+   +    +N DN   +WI+ D+                 II+S +    V+ V  P  +   E    ++  C + L++   +++GRA+Q++  D+ TG+   F T+ +DK++TAA  A++CT   + +  + Q G  +E+              ++   C+SC   M GR+ +   +  +  F+C +          +G F+ +N K +L    +E   +++  +L+ +R++L+++     I+ + +P  ++V+   N        + +   S++ ++  AT    LQ   R  YT  G  I+D
Sbjct:  160 LYKRQPRVIVVTAFKNGDREVVAKVAAPTIKILLENCTDKLGLSSAARRIFLDDGTEVFTSKEIPRDSEVFISCGESFKDPFKPVIKQDELSKSTTWTRNGVVWNQDCKKRATKPRLSKRFRNLLEQSKRRVLVFKNGHG--SQGNEIVADPDRFEDFLVACTAKLDLGIYARALYDWEGNEINNLQDAPVLDQCLQTWS----TPVLGPLWVSKGEGFSPKGVCEFLDGLINYTKGKLKEAEHYKRQLQFGQSDETKDKVEIVTILSMSAKEIEESLDIVNKDTEDFGNALNRLKQQKSKIKQNVAEEQGEGFEYTLKHIEKIEADHRMVGTKGIRLRVYENGTD-DSEVVIFFNLQQAVRGIGHDKEMLLARLLDQCGSCSLLANPKLNPAIRPIPKKIYDNMGSPITDVFDLEYDQEIWLSFGEPWKNPFTYVVSATFDKIRALDIQGANCVRTGIREQLMVEDVKGKEKSGNWEVIEGIPDGMYVTDVHPQMDPVEREHIQGLLETSEIHPQNTSFLSAKDNVNLLLYAEVVVDTKKKRGNKDLWPADAQSWVISKNGYIYSKAFPQLVLGASEYKVSTSLRHPHLGGS--DHHVEGFAINIQR-KASSAAQQWDFTPDGFIQNAAHPGLCLTYLGAQFSNEESQVHNEAEGTPSGFKCYLALCDKQEGRAL-KAQRWALKQERLDNLGQWKHTRADNPEWSKRALSWPVSEDGILNDNYDWPMEGYLLPYAPPIKVKGDQQKSSNSSSIRLMVLKNGERDLNKLVPVVGPDLTNMRKDHEGQKKKSKKDPDAESIDIDISLHCNKDMSILQLELVMFLERCTSMLDLPFAARRLFDQNGKEHFSLRSLERDQVMYVTCGEAWADPSLSKAEQQRRHLLANLNRDLDQIRQFVLLRNPSSLVLEVDGGLSPGSPLIVSSNASGPQEEVSSPKKGKSATFAEVDDDNELFNGKVSAHEIAHQRAEERLNRLKWPWERIEDGGFDNAEDGEEKNFSNKEMYRKFKQKVRRSNVDL-RMQAQKFVFEDGYIMCQKDRSLVLTVSEQEGRVAEVTVARLNPDNIFQRWILCDNNNKDVCQRCQSYTCKDSIIQSKNNANMVLTVGMPSSVADHE-DPLSYIGCAVTLQQRKTSQFGRANQRWHFDANTGIIEAFHTDTMDKEITAANKANVCTFSVMGATEIDQPGYVVEMQISGKTDHDGSKLTKKILVCSSCARAMRGRHKLERVKT-SVDFACSMGIAKQLGIRQIGSFQCLNGKVDLSTFEAEHTLEEWEGQLDKLREELSVRTIAREISAARTPYTVKVMSFRNGEGRLKPGEIIVGSSVAGILEQATARLGLQSAARRLYTHDGTVIMD 1500          

HSP 2 Score: 132.109 bits (331), Expect = 8.990e-27
Identity = 89/299 (29.77%), Postives = 146/299 (48.83%), Query Frame = 1
Query: 4423 ESTSTPNVEVPISDIGSVINEPVYKQFELVELWASSGEPFYFXXXXXXXXXXXXXXXXXXXQLKLEIDKKKFLLRTMKGERFKKLDAGTLEPTPSVKNPIIIKGNWQ-FPTNEEIK------LEQEIESLQA--KLNDAKPQVETDSSQQKMLSRDLYKQKHLKSCFVHINGKNENTSVSVWGESVWEILENSAQLLGMKKSPKFLFKKDGM------------------QVTSINQISTGDILAASSHSVFISPKASGLQCEIKANWGRARRQYGEDSTDIKIQYRPNTLIDVDPFEP 5238
            +S   P++++P  D+  V+  P+       E W S GE F    +     +   +  +  + +  E++K+K +LR M+G R +  + G    T + ++P+++ G+WQ  P  E +K      LE  +  ++A  K N  KP         K +SR LY Q  +K   V  NG+N   +V VWGES+ ++L+NS   L ++K  K++F  +G                   Q+   + I    +L       F+ P+ S    EIKANWGRAR+QYG  +TD+ +  + N+ +DVDPF P
Sbjct: 1759 KSRQGPHIDLPPVDM--VLKYPI-------EAWISCGEAFVKPSNVEKNFERSQEQREERAAVAYELEKEKHVLRQMQGRRLEGQNPGQYRSTRNPQHPVLVHGHWQEAPLGEMVKHDIVHQLETHLHEMKASQKPNGVKP------VNAKGISR-LYTQPSMKRVLVFPNGENLERAVYVWGESLDQLLDNSTTRLNLRKPAKYVFDLNGSVVKRSRDVSISVHLFLLSQLDDFSDIERDQLLCVGPSRTFLQPRESRQMVEIKANWGRARKQYGPQATDLVVSSQRNSHVDVDPFGP 2041          
BLAST of Doublecortin domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|20312355 (tr|A0A1S3J201|A0A1S3J201_LINUN uncharacterized protein LOC106169385 isoform X3 OS=Lingula unguis OX=7574 GN=LOC106169385 PE=4 SV=1)

HSP 1 Score: 370.163 bits (949), Expect = 5.821e-100
Identity = 329/1409 (23.35%), Postives = 611/1409 (43.36%), Query Frame = 1
Query:  121 PLFLKTVPAMVVLVKQNGKLYPLTRITGFSIDEILSNCTQIMKLTSAARKLYSKHGELIESLDKLKPNDEVYVSLGEPFIDPLKIIKESILIREGSFWGLNGLYIPKSKRKAASACVTHTR-----TERTWRILTFSNGDYLINEAVEVISNLKDVEEVKSICGKKLNLNGQYKKLYNSDGFEITDL---KFLDDEESYVWNPNSNIVILGPIWASKMEDLNQSGVYHYFHKTTKEIKNLIKSSKSTLNEIEAIENSEFDKYPASKMKSFSKPELKVTKEEIKKTLKKYENAFEKFNEKFKQL-PKPSDQQVTESETCTEKGLYQC--------TKGLRLKVYQNGQNPNKKFTIFFNISQAKRGI-NDSTILFNRFLDCLSESVHLSKVNDFSKGLLARRVFMEDGTEIKDVSDLSYDQAICVSYGENWIDPAYTCVCAKFHFVDN--------------------------------------KLESSLVDLEFSSTNLKNFKVVKRFDDKDIIYSLPVLEYQKRPNLFMLSSLHXXXXXXXXXX----XXXXSWSYTITGRLILKSLPSLCLTLITSSKDSLRFHKHSLKQLVTDEISYYAVQLNSIHAHDSTQMWKFHTSGQLYNKAFPEFFLTYIE----NKSNVDQDDFVDAIRNSNILAVEQFPEDLQKYQRWAFKQESFANLSQWKVCDLPNPEWHKCALTWPLKSNGDLNDDLKWPIEGLLIPCAPPLNRRTCESESRFPIKLRVLKNNDHNMKQSMLVNGPDLTKLIK-------KGKQPPYE-----------------------THCTNE-RLLKLEFQMFLDSCTSILRLPSAARRLFTENGNEVYDLEGLQNYDLVFVSVGEIWCSPFKALTQIKLRSYANKLTVDIERLKYFNMLRRPNEDFVIGIRSDESGLLEIQILNEQSKLEIQKIFNLENG-NATPEPLI-----------KSLVEDLEKNKSCHERSCEAANLKFK-----------HKSF------SDDSE------VKIIEK---SPKKVALSVSHINRQQFLFESNRILTKNDPNMAIFADE----IGKPVIIRKLVVNSDNQKCKWIIHDSGIIESMHFRGFVIDV------------YCPKML-----------PFQEKSSTNWSNCLLVLEKPINTKYGRAHQKFKLDSRTGLFYPFATNDLDKDVTAAALASICTKYVCSNPLSQQGSYL----EINQRQEA--SCNSCVSIMNGRYLITPFEIDNQTFSCDL----------LGGFKVMNIKPNLLQSRSEEVYQDFVHKLEIIRKKLTIKICKSRITES--VSPNIQVLLHLNNNKTNSQSQQVTAKSISQLMGIATGVFNLQKPIRIFYTVKGEAIVD-----DLSFRNIMGKVRDNL 3798
            P++ +    +V    +NG       +   +I E+L  CT  + LT+AAR+++   G  + S  ++  + E+Y+S GEPF +P   +K + ++++G+ W +NGL +P+  +   +      R      ++  RIL F NG    +   E+++++ +       C  KL+L    + LY+ +G E+TDL     +D        P     +LGP+W SK E  +  G + +        K  ++ +K    ++E +  S  D      + + ++ E+    + +++ +++   A +K   + +++ P   +++V  +E    K + +          +G++LKVY+NG   ++   +FFN+ +  +GI      +  R LD       L+     +   + R+++ + G  + D   L  D  + +S+GE +  P   C+ A F  V                                          E + VD + ++   ++   +++  + +I  +   L+++  P L +   L +  K+            ++W  + TG +  K +P L L +       ++    ++    T EI  Y V L         Q W F   G +Y  A+P+  LT++     + S V+  + V       +   ++      + QRWA KQE F NL QWK   + NPEW+K A +WP+  +G+ N+D  WP+EG LIP  PPL  +  +     P++L V+KN +  M +++ V GPDLT ++K        GK+P                           HC ++  LL+LEF +FL+ CT+++ LP AARRLF E G E   L+GL+   LV+VS GE W  P     + + R     L  DI +++ +  LR P +D V+ +  D + +   +++ +   L  ++  ++ +G  A  + LI           + + E L +N+S HER+   ++ +             H SF      +DDS+       ++ EK    PK    +V  +N Q+F FE+  I    +PN+ +   E    +   V+++K     D+   +W + D G I S +    V+ +            + P M+             ++ ++ ++  C + L+   NTKYG A+QK+  D   G  Y F T+  D ++TAA  A++CT  V       Q  Y+      N + E    C SC   M G+  +   +  N  F+C +           G F  +N K +L    +E    ++  + E +R++ ++++    I  +  + P +++ ++ N          +   SI  L+   T    +    R  YT  G  ++D     + +  + M K+++N+
Sbjct:  172 PVYKRQPFTIVATAFKNGSRETFVNVAAPTIKELLEQCTDKLGLTAAARRVFLDDGIEVFSPREIPRDAEIYISQGEPFKNPFLPLKRNNMMKQGATWTMNGLVLPQEAKPGPTKPNLSKRFRQQLGKKNRRILIFKNG-VGHDGGYEIVADMDNTPAFMQACTGKLDLGSHARVLYDWEGKEVTDLYETPLIDQCLQACATP-----VLGPLWVSKGEGFSPKGPFDFISGLLHHTKTKLREAKHYKEQLE-MAKSNPDNVEIRSILAMTENEVDEALQMVERDIEELTEAKQKLKAQLEKIEPDAKEEEVQGAEFRMAKTIRKLEASDRLVGVQGIKLKVYENGTYEDET-VVFFNLKETSKGIEGQKDKIMQRLLDQCGTLGRLAFPKTPAISSMPRKLYDQHGKVVTDPYALKDDMELWLSFGEGFRVPYVYCLQAMFDKVHGLNLYGEKNVGVREPLIAEEIPKDGEYSYSWEATVGFPLSYEFTQVDADMNAAEREH--ALEQVKNNEINVNWGFLQHKDNPRLVLFPELMVDMKKIFDSKDLWPQESQTWVISKTGYIYCKPMPQLTLAVT-----DMKLEGTTVNGAGT-EIQGYVVALQKKMVGSPYQQWGFTADGYIYCLAYPDLVLTHLGATGIDDSMVNNAEGVLPGHKFYVAVSDKINGKDARLQRWAIKQERFDNLGQWKHSKITNPEWNKRAYSWPVNEDGNWNEDFDWPMEGFLIPGVPPLKTKE-KPHGHVPLRLTVMKNGEKEMYKAVQVVGPDLTNMMKDVNKTAMNGKRPHTAHNHKHKRTRTADTDVDSVDGDPNVHCRDDLTLLQLEFMLFLERCTNLIDLPFAARRLFDEKGIEHTTLQGLKRDQLVYVSCGEAWNDPKLTKAEQQRRYLLATLGQDIAQIRQYVALRNP-QDLVLAV--DSALVPNAKLVVQTCCLTPEQRHSILSGEEARQKQLIEEQRKEQEEKKRQIEEMLHENRSAHERAHLKSDQRLDSLRWPWERVNLHGSFDDVINANDDSDEPGYTSPELYEKYKPKPKSSPRNVG-MNLQKFKFENGHISCVYNPNLVLGVVESETRVADVVLVKK---KPDDAYQRWTLTDDGHIVSKYHPQLVLTIDIDNDPRFLRSKHSPSMVLTVNMPAVQRHEAEDAATPSYPGCGVTLQHKKNTKYGAANQKWGFDPELGFLYAFKTDATDMEITAANKANVCTYAVRQGESLDQPGYIVYMATSNSKSEEVIMCTSCSRAMRGQQKVRRLD-RNVDFACAMGSAREKGLKQAGSFHCLNGKVDLSTFEAENTLSEWEDQFERLREERSVRVIAREINAARFIKP-VKIYVYRNGEGRMKPGHVLVGSSIVGLLDQCTHALQMANAARRLYTSDGMLVLDVEDLINWAVDDYMTKIKENM 1554          

HSP 2 Score: 173.326 bits (438), Expect = 2.441e-39
Identity = 90/246 (36.59%), Postives = 151/246 (61.38%), Query Frame = 1
Query: 4510 VELWASSGEPFYFXXXXXXXXXXXXXXXXXXXQLKLEIDKKKFLLRTMKGERFKKLDAGTLEPTPSVKNPIIIKGNWQFPTNEEIKLEQEIESLQAKLNDAKP-QVETDSSQQKM-LSRDLYKQKHLKSCFVHINGKNENTSVSVWGESVWEILENSAQLLGMKKSPKFLFKKDGMQVTSINQISTGDILAASSHSVFISPKASGLQCEIKANWGRARRQYGEDSTDIKIQYRPNTLIDVDPFEPP 5241
            +E+WAS+GE F   +    K     ++ +  + +  E++K+K +LR M+G R ++L+ G  +PT S +NP++I+GNWQ PT +E +   ++  LQ+ L++ K  Q E   ++  + +SR+LY Q  +K   V  NG++   +  VWG S+ EIL+ S   L + K+ K+L+  DG Q++  ++I    ILA S+   F+ P+ S +  E+KANWGRAR+QYG  +T+I +++  +  I+VDPF PP
Sbjct: 1660 IEVWASAGEAFVKPEDAEEKYLQGIQNREERAAVTYELEKEKHVLRQMQGRRLEELNPGEYKPTRSTRNPVLIEGNWQEPTFDEQRKHDKVHQLQSHLSEVKAAQKEVTKTKPTVNISRNLYAQPVVKRILVFPNGEDLQHATYVWGGSIGEILDASVSRLNLMKAAKYLYTLDGKQISDFDEIKRDMILAVSTGKGFLKPRDSSVNVEVKANWGRARKQYGPKATEIMVKHTRDMNIEVDPFGPP 1905          
BLAST of Doublecortin domain-containing protein vs. Ensembl Nematostella
Match: EDO37720 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEY8])

HSP 1 Score: 193.356 bits (490), Expect = 2.676e-49
Identity = 182/662 (27.49%), Postives = 302/662 (45.62%), Query Frame = 1
Query:  121 PLFLKTVPAMVVLVKQNGKLYPLTRITGFSIDEILSNCTQIMKLTSAARKLYSKHGELIESLDKLKPNDEVYVSLGEPFIDPLKIIKESILIREGSFWGLNGLYIP--KSKRKAASACVTHTRT---ERTWRILTFSNGDYLINEAVEVISNLKDVEEVKSICGKKLNLNGQYKKLYNSDGFEI---TDLKFLDDEESYVWNPNSNIVILGPIWASK-MEDLNQSGVYHYFHKTTKEIKNLIKSSKSTLNEIEAIENSEFDKYPASKMKSFSKPELKVTKEEIKKTLKKYENAFEKFNEKFKQLPKPSDQQVTESETCTEKGLYQ------------CTKGLRLKVYQNGQNPNKKFTIFFNISQAKRGI-NDSTILFNRFLDCLSESVHLSKVNDFSKG-LLARRVFMEDGTEIKDVSDLSYDQAICVSYGENWIDPAYTCVCAKFHFVDNKL--ESSLVDLEFSST----NLKNFKVVKRFDDKDIIYSLPVLEYQK---RPNLFMLSSLHXXXXXXXXXXXXXXSWSYTITGRLILKSLP-----SLCLTLITSSKDSLRFHKHSLKQLVTDEISYYAVQLNSIHAHDS-------TQMWKFHTSGQLYNKAFPEFFLTYIENKSNVDQDDFVDAIRNSNILAVEQFPEDLQKYQRWAF 1974
            PL+ K    + V   QNG      R+T   + ++L NCT  + L SAARKL+   GE + S  ++K + ++YVS GEPF DP    ++   +R    W L G+ +P  KS+ +   +     RT    +  RIL F NGD   +E VE+++   D  E    C  KLNL+   ++L++ +G E+    D+  LD     +  P+ N V+LGP+W +K  E  +  G Y++        +  IK SK+   E+E  +  + +   + ++ S SK E+    +E+   + +  +      ++ K+L      +    ET TE   +Q              +GLRLKVY+NG   + +  I FN+ +A++GI  DS+ L +RFLD  + S  L        G  +A+RVF++DG E+KD+ +L YDQ I +SYGE            +F  + +KL  +S+L    +  T     L     +  +D+K+I+   P++E +K   +P ++ +                +KS+      +L+   +P     S    L  S  D   +   S ++   + + Y  V L       S        QMW    SG +Y+KA P+  LT  E     +  D  D +    +   ++ P +    Q+W F
Sbjct:  167 PLYKKKPRTLCVQAFQNGNRDNYARVTAPDLQQLLDNCTAKLGLVSAARKLFLGDGEQVISPRQIKKDADIYVSCGEPFKDPYAAFQKREELRRSVSWALTGIVLPEDKSRGRTKPSLSKRMRTLVESQKRRILCFRNGDS--SEGVEIVAGRFD--EFLDDCTAKLNLDAGARRLFDWEGSEVKSFADVPVLDG----ILQPSGN-VVLGPVWVTKGGERFSPKGPYNFALTLLMNTRERIKYSKAYKEELET-QLGDQNMSSSKEIMSMSKNEVNSEIKEVDDHICELASVVPGLKQQIKKL-----SESVHDETGTESYKFQHISEIDANSRLLGKQGLRLKVYENGHT-DGEAIIHFNLREAEKGIQGDSSQLMHRFLDACTSSQRLGDGAGGPAGRRIAKRVFLKDGKEVKDIHELEYDQEIWLSYGE------------EFKQLSSKLVQDSTLPHGSYKKTEYLLTLDRVSCMSLWDEKEIVQREPLMEDEKGQDKPTVWKV----------------VKSFPPGTKRQLVALDMPGPQRLSYAQGLQGSRVDEGGYFLQSRER--KNLVLYPEVSLEVKKKKGSKEVWPSDAQMWVITQSGLIYSKAMPQLALTRSERPLQAEYGD--DKLIGCAVQLAKRAPGNPN--QQWGF 778          

HSP 2 Score: 166.777 bits (421), Expect = 2.977e-41
Identity = 112/335 (33.43%), Postives = 167/335 (49.85%), Query Frame = 1
Query: 1924 AVEQFPEDLQKY-----QRWAFKQESFANLSQWKVCDLPNPEWHKCALTWPLKSNGDLNDDLKWPIEGLLIPCAPPLNRRTCESESRFP---IKLRVLKNNDHNMKQSMLVNGPDLTKLI---------KKGKQPPYETH-------------CTNERLLKLEFQMFLDSCTSILRLPSAARRLFTENGNEVYDLEGLQNYDLVFVSVGEIWCSPFKALTQIKLRSYANKLTVDIERLKYFNMLRRPNEDFVIGIR---SDESGLLEIQILNEQSKLEIQKIFN--------LENGNATPEPLIKSLVEDLEKNKSCHERSCEAANLKFKHKSFS 2805
            A+  FP+   K+     QRWA KQE  + + QWK   + NPEW+K AL+WP+ ++G  N +  WP+EG L+P APP+ +R+ E +S  P    +LRVL+N + +  ++++V GPDLT +          KK K      H             C    L +LE ++F+D CT  L LP AARRLF E G +V  +  L    LVF S GE W  P  + +  + R+    L  DI R++ +  LR P+ D V+G+    +  +GL+    +  Q+  E  K+ N          NGN    P +     +L  + S HERS + A  + K   +S
Sbjct:  880 AIALFPKLSGKHPCSGTQRWAIKQEDLSTIGQWKHTTVSNPEWNKRALSWPVTNDGTWNTEFTWPMEGFLLPFAPPV-KRSSEKKSSAPGSTTRLRVLRNGEADTSKAVIVVGPDLTNMWRDVNDASPKKKNKAKRSGCHSSTDVSGVYDADSCHPLDLKRLELELFMDQCTEALSLPFAARRLFDEEGRDVMCISDLSRDQLVFASCGESWTDPKLSYSDQQRRALLMNLASDIARIRQYIALRDPH-DLVLGVEGPVAPGAGLIVNTCMLTQADRE--KLMNKPSDEEDEQTNGNENNSPGV-----ELSYSISAHERSHQRAEERLKSMRWS 1205          
BLAST of Doublecortin domain-containing protein vs. Ensembl Nematostella
Match: EDO37721 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEY9])

HSP 1 Score: 70.4774 bits (171), Expect = 3.981e-12
Identity = 51/175 (29.14%), Postives = 79/175 (45.14%), Query Frame = 1
Query: 4657 GERFKKLDAGTLEPTPSVKNPIIIKGNWQFPTNEEIKLEQEIESLQAKLNDAKPQVETD----SSQQKMLSRDLYKQKHLKSCFVHINGKNENTSVSVWGESVWEILENSAQLLGMKKSPKFLFKKDGMQVTSINQISTGDILAASSHSVFISPKASGLQCEIKANWGRARRQYG 5169
            GE F  L+   +      ++P      W  PT +E K E+ I  L+  L D K + + D    S      ++ LY         V+ N +    +V+V+G S+ EIL+NS   L +  + + LFK+ G +V SI  I   ++L  S    F+  +    Q E+KA W R  R  G
Sbjct:  269 GEPFVPLEGRRITGISPPESPRGAAKAWYEPTRKEEKKEETIMELKKHLKDVKSRQKHDEVTLSKSAIETTQRLYSTPKTVRVKVYPNSETTERAVTVFGASIREILDNSTTRLDLSSAARRLFKQSGQEVESIQDIRRDEMLCVSCGEGFVQARDRRHQMELKATWSRMTRYGG 443          
BLAST of Doublecortin domain-containing protein vs. Planmine SMEST
Match: SMESG000017756.1 (SMESG000017756.1)

HSP 1 Score: 3565.01 bits (9243), Expect = 0.000e+0
Identity = 1814/1832 (99.02%), Postives = 1824/1832 (99.56%), Query Frame = 1
Query:   25 MSKTSSTREIXXXXXXXXXXXXXXXXXXXXXTPLFLKTVPAMVVLVKQNGKLYPLTRITGFSIDEILSNCTQIMKLTSAARKLYSKHGELIESLDKLKPNDEVYVSLGEPFIDPLKIIKESILIREGSFWGLNGLYIPKSKRKAASACVTHTRTERTWRILTFSNGDYLINEAVEVISNLKDVEEVKSICGKKLNLNGQYKKLYNSDGFEITDLKFLDDEESYVWNPNSNIVILGPIWASKMEDLNQSGVYHYFHKTTKEIKNLIKSSKSTLNEIEAIENSEFDKYPASKMKSFSKPELKVTKEEIKKTLKKYENAFEKFNEKFKQLPKPSDQQVTESETCTEKGLYQCTKGLRLKVYQNGQNPNKKFTIFFNISQAKRGINDSTILFNRFLDCLSESVHLSKVNDFSKGLLARRVFMEDGTEIKDVSDLSYDQAICVSYGENWIDPAY--TCVCAKFHFVDNKLESSLVDLEFSSTNLKNFKVVKRFDDKDIIYSLPVLEYQKRPNLFMLSSLHXXXXXXXXXXXXXXSWSYTITGRLILKSLPSLCLTLITSSKDSLRFHKHSLKQLVTDEISYYAVQLNSIHAHDSTQMWKFHTSGQLYNKAFPEFFLTYIENKSNVDQDDFVDAIRNSNILAVEQFPEDLQKYQRWAFKQESFANLSQWKVCDLPNPEWHKCALTWPLKSNGDLNDDLKWPIEGLLIPCAPPLNRRTCESESRFPIKLRVLKNNDHNMKQSMLVNGPDLTKLIKKGKQPPYETHCTNERLLKLEFQMFLDSCTSILRLPSAARRLFTENGNEVYDLEGLQNYDLVFVSVGEIWCSPFKALTQIKLRSYANKLTVDIERLKYFNMLRRPNEDFVIGIRSDESGLLEIQILNEQSKLEIQKIFNLENGNATPEPLIKSLVEDLEKNKSCHERSCEAANLKFKHKSFSDDSEVKIIEKSPKKVALSVSHINRQQFLFESNRILTKNDPNMAIFADEIGKPVIIRKLVVNSDNQKCKWIIHDSGIIESMHFRGFVIDVYCPKMLPFQEKSSTNWSNCLLVLEKPINTKYGRAHQKFKLDSRTGLFYPFATNDLDKDVTAAALASICTKYVCSNPLSQQGSYLEINQRQEASCNSCVSIMNGRYLITPFEIDNQTFSCDLLGGFKVMNIKPNLLQSRSEEVYQDFVHKLEIIRKKLTIKICKSRITESVSPNIQVLLHLNNNKTNSQSQQVTAKSISQLMGIATGVFNLQKPIRIFYTVKGEAIVDDLSFRNIMGKVRDNLIQSPEEDLMETKPAQTXXXXXXXXXXXXXXXXXXDQCFFIIEFANKEPTNLYCLQINISGVNGIELFSKSHTRHDSAFLFNYEIFNNQINTELFVCDSDFEGEQTELSIKSSPKALHHLFTNVMKTLRLQLISARVNANNDGDNDGYQVDIESIDAIADFSFENLSENLKNEDFERFATASIIPLMSTDNFKKTPATLNFEIILNRVSESTSTPNVEVPISDIGSVINEPVYKQFELVELWASSGEPFYFXXXXXXXXXXXXXXXXXXXQLKLEIDKKKFLLRTMKGERFKKLDAGTLEPTPSVKNPIIIKGNWQFPTNEEIKLEQEIESLQAKLNDAKPQVETDSSQQKMLSRDLYKQKHLKSCFVHINGKNENTSVSVWGESVWEILENSAQLLGMKKSPKFLFKKDGMQVTSINQISTGDILAASSHSVFISPKASGLQCEIKANWGRARRQYGEDSTDIKIQYRPNTLIDVDPFEPPDIMRNVKDLPSKEAKTIKVFENGQRISGAKEIIGYSLGELLKNAETILSLNLRVKCFYTLDGRRITSFKEILIDDVLAASVSGRGLLIIDG 5514
            MSKTSSTREIHHHRLKSHKSSSKRLEKRKSRTPLFLKTVPAMVVLVK NGKLYPLTRITGFSIDEILSNCTQIMKLTSAARKLYSKHGELIESLDKLKPNDEVYVSLGEPFIDPLKIIKESILIREGSFWGLNGLYIPKSKRKAASACVTHTRTERTWRILTFSNGDYLINEAVEVISNLKDVEEVKSICGKKLNLNGQYKKLYNSDGFEITDLKFLDDEESYVWNPNSNIVILGPIWASKMEDLNQSGVYHYFHKTTKEIKNLIKSSKSTLNEIEAIENSEFDKYPASKMKSFSKPELKVTKEEIKK+LKKYENAFEKFNEKFKQLPKPSDQQVTESETCTEKGLYQCTKGLRLKVYQNGQNPNKKFTIFFN+SQAKRGINDSTILFNRFLDCLSESVHLSKVNDFSKGLLARRVFMEDGTEIKDVSDLSYDQAICVSYGENWIDPA+  TCVCAKFHFVDNKLESSLVDLEFSSTNLKNFKVVKRFDDKDIIYSLPVLEYQKRPNLFMLSSLHIMEKENNMENNIIKSWSYTITGRLILKSLPSLCLTLITSSKDSLRFHKHSLKQLVTDEISYYAVQLNSIHAHDSTQMWKFHTSGQLYNKAFPEFFLTYIENKSNVDQDDFVDAIRNSNILAVEQFPEDLQKYQRWAFKQESFANLSQWKVCDLPNPEWHKCALTWPLKSNGDLNDDLKWPIEGLLIPCAPPLNRRTCESESRFPIKLRVLKNNDHNMKQSMLVNGPDLTKLIKKGKQPPYETHCTNERLLKLEFQMFLDSCTSILRLPSAARRLFTENGNEVYDLEGLQNYDLVFVSVGEIWCSPFKALTQIKLRSYANKLTVDIERLKYFNMLRRPNEDFVIGIR DESGLLEIQILNEQSKLEIQKIFNLENGNATPEPLI+S+VEDLEKNKSCHERSCEAANLKFKHKSFSDDSEVKIIEKSPKKVALSVSHINRQQFLF+SNRILTKNDPNMAIFADEIGKPVIIRKL VNSDNQKCKWIIHDSGIIESMHFRGFVIDVYCPKMLPFQEKSSTNWSNCLLVLEKPINTKYGRAHQKFKLDSRTGLFYPFATNDLDKDVTAAALASICTKYVCSNPLSQQGSYLEINQRQEASCNSCVSIMNGRYLITPFEIDNQTFSCDLLGGFKVMNIKPNLLQSRSEEVYQDFVHKLEIIRKKLTIKICKSRITESVSPNIQVLLHLNNNKTNSQSQQVTAKSISQLMGIATGVFNLQKPIRIFYTVKGEAIVDDLSFRNIMGKVRDNLIQSPEEDLMETKPAQTNEIIEENNNSNFNVSLSEDQCFFIIEFANKEPTNLYCLQINISGVNGIELFSKSHTRHDSAFLFNYEIFNNQINTELFVCDSDFEGEQTELSIKSSPKALHH FTNVMKTLRLQLISARVNANNDGDNDGYQVDIESIDAIADFSFENLSENLKNEDFERFATASIIPLMSTDNFKKTPATLN EIILNRVSESTSTPNVEVPISDIGSVINEPVYKQFELVELWASSGEPFYFSKSNSVKSKLKDKSSDTVSQLKLEIDKKKFLLRTMKGERFKKLDAGTLEPTPSVKNPIIIKGNWQFPT+EEIKLEQEIESLQAKLNDAKPQVETDSS+QKMLSRDLYKQKHLKSCFVHINGKNENTSVSVWGESVWEILENSAQLLGMKKSPKFLFKK+GMQVTSINQISTGDILAASSHSVFISPKASGLQCEIKANWGRARRQYGEDSTDIKIQYRPNTLIDVDPFEPPDIMRNVKDLPSKEAKTIKVFENGQRISGAKEIIGYSLGELLKNAETILSLNLRVKCFYTLDGRRITSFKEILIDDVLAASVSGRGLLII+ 
Sbjct:    1 MSKTSSTREIHHHRLKSHKSSSKRLEKRKSRTPLFLKTVPAMVVLVKHNGKLYPLTRITGFSIDEILSNCTQIMKLTSAARKLYSKHGELIESLDKLKPNDEVYVSLGEPFIDPLKIIKESILIREGSFWGLNGLYIPKSKRKAASACVTHTRTERTWRILTFSNGDYLINEAVEVISNLKDVEEVKSICGKKLNLNGQYKKLYNSDGFEITDLKFLDDEESYVWNPNSNIVILGPIWASKMEDLNQSGVYHYFHKTTKEIKNLIKSSKSTLNEIEAIENSEFDKYPASKMKSFSKPELKVTKEEIKKSLKKYENAFEKFNEKFKQLPKPSDQQVTESETCTEKGLYQCTKGLRLKVYQNGQNPNKKFTIFFNLSQAKRGINDSTILFNRFLDCLSESVHLSKVNDFSKGLLARRVFMEDGTEIKDVSDLSYDQAICVSYGENWIDPAFSDTCVCAKFHFVDNKLESSLVDLEFSSTNLKNFKVVKRFDDKDIIYSLPVLEYQKRPNLFMLSSLHIMEKENNMENNIIKSWSYTITGRLILKSLPSLCLTLITSSKDSLRFHKHSLKQLVTDEISYYAVQLNSIHAHDSTQMWKFHTSGQLYNKAFPEFFLTYIENKSNVDQDDFVDAIRNSNILAVEQFPEDLQKYQRWAFKQESFANLSQWKVCDLPNPEWHKCALTWPLKSNGDLNDDLKWPIEGLLIPCAPPLNRRTCESESRFPIKLRVLKNNDHNMKQSMLVNGPDLTKLIKKGKQPPYETHCTNERLLKLEFQMFLDSCTSILRLPSAARRLFTENGNEVYDLEGLQNYDLVFVSVGEIWCSPFKALTQIKLRSYANKLTVDIERLKYFNMLRRPNEDFVIGIRCDESGLLEIQILNEQSKLEIQKIFNLENGNATPEPLIESVVEDLEKNKSCHERSCEAANLKFKHKSFSDDSEVKIIEKSPKKVALSVSHINRQQFLFKSNRILTKNDPNMAIFADEIGKPVIIRKLEVNSDNQKCKWIIHDSGIIESMHFRGFVIDVYCPKMLPFQEKSSTNWSNCLLVLEKPINTKYGRAHQKFKLDSRTGLFYPFATNDLDKDVTAAALASICTKYVCSNPLSQQGSYLEINQRQEASCNSCVSIMNGRYLITPFEIDNQTFSCDLLGGFKVMNIKPNLLQSRSEEVYQDFVHKLEIIRKKLTIKICKSRITESVSPNIQVLLHLNNNKTNSQSQQVTAKSISQLMGIATGVFNLQKPIRIFYTVKGEAIVDDLSFRNIMGKVRDNLIQSPEEDLMETKPAQTNEIIEENNNSNFNVSLSEDQCFFIIEFANKEPTNLYCLQINISGVNGIELFSKSHTRHDSAFLFNYEIFNNQINTELFVCDSDFEGEQTELSIKSSPKALHHFFTNVMKTLRLQLISARVNANNDGDNDGYQVDIESIDAIADFSFENLSENLKNEDFERFATASIIPLMSTDNFKKTPATLNLEIILNRVSESTSTPNVEVPISDIGSVINEPVYKQFELVELWASSGEPFYFSKSNSVKSKLKDKSSDTVSQLKLEIDKKKFLLRTMKGERFKKLDAGTLEPTPSVKNPIIIKGNWQFPTSEEIKLEQEIESLQAKLNDAKPQVETDSSRQKMLSRDLYKQKHLKSCFVHINGKNENTSVSVWGESVWEILENSAQLLGMKKSPKFLFKKNGMQVTSINQISTGDILAASSHSVFISPKASGLQCEIKANWGRARRQYGEDSTDIKIQYRPNTLIDVDPFEPPDIMRNVKDLPSKEAKTIKVFENGQRISGAKEIIGYSLGELLKNAETILSLNLRVKCFYTLDGRRITSFKEILIDDVLAASVSGRGLLIIEA 1832          
BLAST of Doublecortin domain-containing protein vs. Planmine SMEST
Match: SMESG000017756.1 (SMESG000017756.1)

HSP 1 Score: 3469.86 bits (8996), Expect = 0.000e+0
Identity = 1780/1832 (97.16%), Postives = 1792/1832 (97.82%), Query Frame = 1
Query:   25 MSKTSSTREIXXXXXXXXXXXXXXXXXXXXXTPLFLKTVPAMVVLVKQNGKLYPLTRITGFSIDEILSNCTQIMKLTSAARKLYSKHGELIESLDKLKPNDEVYVSLGEPFIDPLKIIKESILIREGSFWGLNGLYIPKSKRKAASACVTHTRTERTWRILTFSNGDYLINEAVEVISNLKDVEEVKSICGKKLNLNGQYKKLYNSDGFEITDLKFLDDEESYVWNPNSNIVILGPIWASKMEDLNQSGVYHYFHKTTKEIKNLIKSSKSTLNEIEAIENSEFDKYPASKMKSFSKPELKVTKEEIKKTLKKYENAFEKFNEKFKQLPKPSDQQVTESETCTEKGLYQCTKGLRLKVYQNGQNPNKKFTIFFNISQAKRGINDSTILFNRFLDCLSESVHLSKVNDFSKGLLARRVFMEDGTEIKDVSDLSYDQAICVSYGENWIDPAY--TCVCAKFHFVDNKLESSLVDLEFSSTNLKNFKVVKRFDDKDIIYSLPVLEYQKRPNLFMLSSLHXXXXXXXXXXXXXXSWSYTITGRLILKSLPSLCLTLITSSKDSLRFHKHSLKQLVTDEISYYAVQLNSIHAHDSTQMWKFHTSGQLYNKAFPEFFLTYIENKSNVDQDDFVDAIRNSNILAVEQFPEDLQKYQRWAFKQESFANLSQWKVCDLPNPEWHKCALTWPLKSNGDLNDDLKWPIEGLLIPCAPPLNRRTCESESRFPIKLRVLKNNDHNMKQSMLVNGPDLTKLIKKGKQPPYETHCTNERLLKLEFQMFLDSCTSILRLPSAARRLFTENGNEVYDLEGLQNYDLVFVSVGEIWCSPFKALTQIKLRSYANKLTVDIERLKYFNMLRRPNEDFVIGIRSDESGLLEIQILNEQSKLEIQKIFNLENGNATPEPLIKSLVEDLEKNKSCHERSCEAANLKFKHKSFSDDSEVKIIEKSPKKVALSVSHINRQQFLFESNRILTKNDPNMAIFADEIGKPVIIRKLVVNSDNQKCKWIIHDSGIIESMHFRGFVIDVYCPKMLPFQEKSSTNWSNCLLVLEKPINTKYGRAHQKFKLDSRTGLFYPFATNDLDKDVTAAALASICTKYVCSNPLSQQGSYLEINQRQEASCNSCVSIMNGRYLITPFEIDNQTFSCDLLGGFKVMNIKPNLLQSRSEEVYQDFVHKLEIIRKKLTIKICKSRITESVSPNIQVLLHLNNNKTNSQSQQVTAKSISQLMGIATGVFNLQKPIRIFYTVKGEAIVDDLSFRNIMGKVRDNLIQSPEEDLMETKPAQTXXXXXXXXXXXXXXXXXXDQCFFIIEFANKEPTNLYCLQINISGVNGIELFSKSHTRHDSAFLFNYEIFNNQINTELFVCDSDFEGEQTELSIKSSPKALHHLFTNVMKTLRLQLISARVNANNDGDNDGYQVDIESIDAIADFSFENLSENLKNEDFERFATASIIPLMSTDNFKKTPATLNFEIILNRVSESTSTPNVEVPISDIGSVINEPVYKQFELVELWASSGEPFYFXXXXXXXXXXXXXXXXXXXQLKLEIDKKKFLLRTMKGERFKKLDAGTLEPTPSVKNPIIIKGNWQFPTNEEIKLEQEIESLQAKLNDAKPQVETDSSQQKMLSRDLYKQKHLKSCFVHINGKNENTSVSVWGESVWEILENSAQLLGMKKSPKFLFKKDGMQVTSINQISTGDILAASSHSVFISPKASGLQCEIKANWGRARRQYGEDSTDIKIQYRPNTLIDVDPFEPPDIMRNVKDLPSKEAKTIKVFENGQRISGAKEIIGYSLGELLKNAETILSLNLRVKCFYTLDGRRITSFKEILIDDVLAASVSGRGLLIIDG 5514
            MSKTSSTREIHHHRLKSHKSSSKRLEKRKSRTPLFLKTVPAMVVLVK NGKLYPLTRITGFSIDEILSNCTQIMKLTSAARKLYSKHGELIESLDKLKPNDEVYVSLGEPFIDPLKIIKESILIREGSFWGLNGLYIPKSKRKAASACVTHTRTERTWRILTFSNGDYLINEAVEVISNLKDVEEVKSICGKKLNLNGQYKKLYNSDGFEITDLKFLDDEESYVWNPNSNIVILGPIWASKMEDLNQSGVYHYFHKTTKEIKNLIKSSKSTLNEIEAIENSEFDKYPASKMKSFSKPELKVTKEEIKK+LKKYENAFEKFNEKFKQLPKPSDQQVTESETCTEKGLYQCTKGLRLKVYQNGQNPNKKFTIFFN+SQAKRGINDSTILFNRFLDCLSESVHLSKVNDFSKGLLARRVFMEDGTEIKDVSDLSYDQAICVSYGENWIDPA+  TCVCAKFHFVDNKLESSLVDLEFSSTNLKNFKVVKRFDDKDIIYSLPVLEYQKRPNLFMLSSLHIMEKENNMENNIIKSWSYTITGRLILKSLPSLCLTLITSSKDSLRFHKHSLKQLVTDEISYYAVQLNSIHAHDSTQMWKFHTSGQLYNKAFPEFFLTYIENKSNVDQDDFVDAIRNSNILAVEQFPEDLQKYQRWAFKQESFANLSQWKVCDLPNPEWHKCALTWPLKSNGDLNDDLKWPIEGLLIPCAPPLNRRTCESESRFPIKLRVLKNNDHNMKQSMLVNGPDLTKLIKKGKQPPYETHCTNERLLKLEFQMFLDSCTSILRLPSAARRLFTENGNEVYDLEGLQNYDLVFVSVGEIWCSPFKALTQIKLRSYANKLTVDIERLKYFNMLRRPNEDFVIGIR DESGLLEIQILNEQSKLEIQKIFNLENGNATPEPLI+S+VEDLEKNKSCHERSCEAANLKFKHKSFSDDSEVKIIEKSPKKVALSVSHINRQQFLF+SNRILTKNDPNMAIFADEIGKPVIIRKL VNSDNQKCKWIIHDSGIIESMHFRGFVIDVYCPKMLPFQEKSSTNWSNCLLVLEKPINTKYGRAHQKFKLDSRTGLFYPFATNDLDKDVTAAALASICTKYVCSNPLSQQGSYLEINQRQEASCNSCVSIMNGRYLITPFEIDNQTFSCDLLGGFKVMNIKPNLLQSRSEEVYQDFVHKLEIIRKKLTIKICKSRITESVSPNIQVLLHLNNNKTNSQSQQVTAKSISQLMGIATGVFNLQKPIRIFYTVKGEAIVDDLSFRNIMGKVRDNLIQSPEEDLMETKPAQTNEIIEENNNSNFNVSLSEDQCFFIIEFANKEPTNLYCLQINISGVNGIELFSKSHTRHDSAFLFNYEIFNNQINTELFVCDSDFEGEQTELSIKSSPKALHH FTNVMKTLRLQLISARVNANNDGDNDGYQVDIESIDAIADFSFENLSENLKNEDFERFATASIIPLMSTDNFKKTPATLN EIILNRVSESTSTPNVEVPISDIGSVINEPVYKQFELVELWASSGEPFYFSKSNSVKSKLKDKSSDTVSQLKLEIDKKKFLLRTMKGERFKKLDAGTLEPTPSVKNPIIIKGNWQFPT+EEIKLEQEIESLQAKLNDAKPQVETDSS+QKMLSRDLYKQKHLKSCFVHINGKNENTSVSVWGESVWEILENSAQLLGMKKSPKFLFKK+GMQVTSINQISTGDILAASSHSVFISPKASGLQCEIKANWGRARRQYGEDSTDIKIQYRPNTLIDVDPFEPPDIMRNVKDLPSKEA           +  AK   GY         E   SL +   CFYTLDGRRITSFKEILIDDVLAASVSGRGLLII+ 
Sbjct:    1 MSKTSSTREIHHHRLKSHKSSSKRLEKRKSRTPLFLKTVPAMVVLVKHNGKLYPLTRITGFSIDEILSNCTQIMKLTSAARKLYSKHGELIESLDKLKPNDEVYVSLGEPFIDPLKIIKESILIREGSFWGLNGLYIPKSKRKAASACVTHTRTERTWRILTFSNGDYLINEAVEVISNLKDVEEVKSICGKKLNLNGQYKKLYNSDGFEITDLKFLDDEESYVWNPNSNIVILGPIWASKMEDLNQSGVYHYFHKTTKEIKNLIKSSKSTLNEIEAIENSEFDKYPASKMKSFSKPELKVTKEEIKKSLKKYENAFEKFNEKFKQLPKPSDQQVTESETCTEKGLYQCTKGLRLKVYQNGQNPNKKFTIFFNLSQAKRGINDSTILFNRFLDCLSESVHLSKVNDFSKGLLARRVFMEDGTEIKDVSDLSYDQAICVSYGENWIDPAFSDTCVCAKFHFVDNKLESSLVDLEFSSTNLKNFKVVKRFDDKDIIYSLPVLEYQKRPNLFMLSSLHIMEKENNMENNIIKSWSYTITGRLILKSLPSLCLTLITSSKDSLRFHKHSLKQLVTDEISYYAVQLNSIHAHDSTQMWKFHTSGQLYNKAFPEFFLTYIENKSNVDQDDFVDAIRNSNILAVEQFPEDLQKYQRWAFKQESFANLSQWKVCDLPNPEWHKCALTWPLKSNGDLNDDLKWPIEGLLIPCAPPLNRRTCESESRFPIKLRVLKNNDHNMKQSMLVNGPDLTKLIKKGKQPPYETHCTNERLLKLEFQMFLDSCTSILRLPSAARRLFTENGNEVYDLEGLQNYDLVFVSVGEIWCSPFKALTQIKLRSYANKLTVDIERLKYFNMLRRPNEDFVIGIRCDESGLLEIQILNEQSKLEIQKIFNLENGNATPEPLIESVVEDLEKNKSCHERSCEAANLKFKHKSFSDDSEVKIIEKSPKKVALSVSHINRQQFLFKSNRILTKNDPNMAIFADEIGKPVIIRKLEVNSDNQKCKWIIHDSGIIESMHFRGFVIDVYCPKMLPFQEKSSTNWSNCLLVLEKPINTKYGRAHQKFKLDSRTGLFYPFATNDLDKDVTAAALASICTKYVCSNPLSQQGSYLEINQRQEASCNSCVSIMNGRYLITPFEIDNQTFSCDLLGGFKVMNIKPNLLQSRSEEVYQDFVHKLEIIRKKLTIKICKSRITESVSPNIQVLLHLNNNKTNSQSQQVTAKSISQLMGIATGVFNLQKPIRIFYTVKGEAIVDDLSFRNIMGKVRDNLIQSPEEDLMETKPAQTNEIIEENNNSNFNVSLSEDQCFFIIEFANKEPTNLYCLQINISGVNGIELFSKSHTRHDSAFLFNYEIFNNQINTELFVCDSDFEGEQTELSIKSSPKALHHFFTNVMKTLRLQLISARVNANNDGDNDGYQVDIESIDAIADFSFENLSENLKNEDFERFATASIIPLMSTDNFKKTPATLNLEIILNRVSESTSTPNVEVPISDIGSVINEPVYKQFELVELWASSGEPFYFSKSNSVKSKLKDKSSDTVSQLKLEIDKKKFLLRTMKGERFKKLDAGTLEPTPSVKNPIIIKGNWQFPTSEEIKLEQEIESLQAKLNDAKPQVETDSSRQKMLSRDLYKQKHLKSCFVHINGKNENTSVSVWGESVWEILENSAQLLGMKKSPKFLFKKNGMQVTSINQISTGDILAASSHSVFISPKASGLQCEIKANWGRARRQYGEDSTDIKIQYRPNTLIDVDPFEPPDIMRNVKDLPSKEA----------YLKMAK---GYQ--------ERRKSLVIHW-CFYTLDGRRITSFKEILIDDVLAASVSGRGLLIIEA 1810          
The following BLAST results are available for this feature:
BLAST of Doublecortin domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DCDC15.036e-7924.38doublecortin domain containing 1 [Source:HGNC Symb... [more]
DCDC12.227e-3225.00doublecortin domain containing 1 [Source:HGNC Symb... [more]
DCDC13.747e-2126.61doublecortin domain containing 1 [Source:HGNC Symb... [more]
DCDC11.487e-1531.49doublecortin domain containing 1 [Source:HGNC Symb... [more]
DCDC12.207e-1025.00doublecortin domain containing 1 [Source:HGNC Symb... [more]
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Doublecortin domain-containing protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|M0R2J8|DCDC1_HUMAN2.418e-7824.38Doublecortin domain-containing protein 1 OS=Homo s... [more]
back to top
BLAST of Doublecortin domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|235167501.140e-10825.46tr|A0A210QPQ2|A0A210QPQ2_MIZYE Doublecortin domain... [more]
gnl|BL_ORD_ID|203240391.465e-10323.70tr|A0A1S3J1J0|A0A1S3J1J0_LINUN uncharacterized pro... [more]
gnl|BL_ORD_ID|172457081.025e-10025.79tr|A0A3S0ZL12|A0A3S0ZL12_ELYCH Uncharacterized pro... [more]
gnl|BL_ORD_ID|157497332.298e-10024.58tr|R7URV3|R7URV3_CAPTE Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|203123555.821e-10023.35tr|A0A1S3J201|A0A1S3J201_LINUN uncharacterized pro... [more]
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO377202.676e-4927.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377213.981e-1229.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Doublecortin domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000017756.10.000e+099.02SMESG000017756.1[more]
SMESG000017756.10.000e+097.16SMESG000017756.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032202 ID=SMED30032202|Name=Doublecortin domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=5554bp
TATATAAATCTTATATGATATAAAATGTCTAAAACAAGCTCAACGAGAGA
AATACATCATCATAGGTTGAAAAGCCATAAATCTTCATCCAAAAGACTAG
AAAAGCGAAAATCCAGAACTCCATTATTTCTAAAAACCGTCCCAGCAATG
GTGGTGTTGGTGAAACAGAACGGAAAATTGTATCCACTAACAAGAATTAC
AGGATTCTCAATTGACGAGATTCTGTCTAATTGCACTCAAATTATGAAGT
TAACCTCAGCAGCAAGAAAATTATATTCCAAACATGGAGAATTGATAGAA
TCACTTGATAAGCTCAAACCAAATGATGAAGTTTATGTTTCTCTAGGAGA
ACCTTTTATTGACCCGTTGAAAATTATAAAAGAATCTATTTTAATTAGGG
AAGGCAGTTTTTGGGGTCTTAATGGCCTTTATATTCCCAAATCAAAACGT
AAGGCCGCATCGGCTTGTGTAACGCATACAAGAACCGAAAGAACATGGAG
AATATTAACATTTTCAAATGGAGATTATTTGATAAATGAAGCTGTGGAAG
TTATTTCCAACTTAAAGGATGTTGAGGAAGTAAAATCTATTTGTGGGAAA
AAGCTTAACCTAAATGGCCAATACAAGAAGTTGTATAATTCAGACGGCTT
TGAGATTACAGATTTGAAATTTTTGGACGATGAAGAATCTTATGTTTGGA
ATCCGAATTCTAATATCGTAATTCTTGGTCCTATTTGGGCGTCGAAAATG
GAAGATCTCAATCAATCCGGAGTATACCACTATTTTCATAAAACTACTAA
GGAAATCAAAAACCTAATCAAAAGTTCTAAATCTACTTTAAATGAGATTG
AAGCCATCGAAAATAGTGAATTTGATAAATATCCAGCAAGTAAAATGAAA
TCATTTTCCAAACCGGAATTGAAAGTTACCAAAGAAGAAATAAAGAAAAC
TTTGAAAAAATATGAAAATGCCTTTGAAAAATTCAATGAAAAATTCAAAC
AATTACCAAAACCATCTGATCAACAAGTAACTGAAAGTGAAACATGTACA
GAAAAGGGTTTATATCAATGTACTAAAGGATTGCGGTTGAAAGTTTATCA
AAATGGACAAAACCCTAATAAAAAATTCACTATTTTTTTCAACATATCAC
AAGCAAAGCGTGGAATCAATGATTCGACAATTTTGTTTAATCGATTTCTT
GACTGTTTATCAGAGAGTGTCCATCTTTCCAAAGTCAATGACTTTTCAAA
AGGATTGCTTGCGAGACGCGTTTTCATGGAGGACGGGACGGAAATCAAGG
ATGTGTCAGATTTATCATATGATCAAGCTATTTGTGTATCATATGGAGAA
AACTGGATTGATCCTGCTTACACATGTGTTTGTGCAAAATTTCATTTTGT
CGACAATAAATTGGAATCTTCTCTAGTGGATTTGGAGTTCTCTAGCACCA
ATTTAAAAAATTTCAAAGTTGTCAAAAGGTTTGATGATAAAGACATAATT
TATTCTCTTCCAGTGCTCGAATATCAAAAAAGACCAAATTTGTTCATGCT
GTCATCCTTACACATTATGGAAAAGGAGAATAATATGGAGAATAATATCA
TCAAGTCTTGGAGTTATACAATTACTGGAAGATTAATTTTGAAAAGTCTT
CCATCACTTTGTTTAACTTTAATCACAAGTTCCAAGGATTCTTTAAGGTT
TCATAAACATTCTCTGAAGCAATTAGTCACGGATGAAATTTCATATTATG
CAGTTCAGCTGAATTCCATTCATGCCCATGACTCAACTCAAATGTGGAAG
TTCCACACATCTGGGCAATTATACAACAAGGCATTTCCTGAATTTTTTTT
GACTTACATAGAAAATAAATCAAATGTTGATCAGGATGATTTTGTTGATG
CTATTCGAAATTCAAATATTTTAGCAGTAGAGCAATTTCCAGAGGATTTA
CAGAAATATCAAAGATGGGCATTTAAACAAGAATCTTTCGCCAATCTCAG
TCAATGGAAAGTTTGTGATTTACCGAATCCTGAATGGCATAAATGTGCTT
TAACGTGGCCTTTAAAGTCTAATGGAGATTTGAATGATGATTTAAAATGG
CCAATCGAAGGACTTTTAATACCATGTGCCCCGCCGTTGAATAGGAGGAC
GTGTGAGTCTGAATCAAGATTTCCAATAAAATTGAGAGTGCTGAAGAACA
ATGATCATAACATGAAACAATCTATGTTGGTCAATGGGCCGGATCTAACA
AAGCTTATTAAAAAAGGGAAACAGCCTCCTTATGAGACCCATTGTACAAA
TGAAAGGTTGCTGAAATTAGAGTTTCAAATGTTTTTAGATTCATGCACTA
GTATCTTAAGGCTTCCATCAGCAGCTAGAAGGTTGTTCACAGAAAATGGC
AACGAAGTATACGATTTAGAAGGTCTTCAAAACTATGATCTAGTCTTTGT
AAGTGTTGGTGAGATATGGTGTAGCCCTTTCAAGGCTTTGACACAGATCA
AGCTACGTTCTTATGCTAACAAACTGACTGTTGATATAGAACGGTTGAAG
TATTTTAATATGTTGCGTCGTCCTAATGAAGATTTTGTCATTGGCATCAG
AAGTGATGAATCAGGCTTGTTGGAAATACAAATACTAAATGAGCAATCAA
AATTAGAAATTCAAAAAATTTTCAACCTTGAGAATGGAAACGCTACACCA
GAACCGCTCATAAAGTCTCTCGTAGAAGATCTGGAGAAAAATAAATCATG
CCATGAAAGATCTTGTGAAGCAGCAAATTTGAAATTCAAACATAAAAGCT
TTTCTGACGATTCTGAAGTCAAAATTATTGAAAAATCTCCGAAAAAAGTT
GCCTTGTCGGTATCCCACATAAATAGGCAGCAATTTTTATTTGAATCTAA
CAGAATTCTAACGAAAAATGATCCAAATATGGCCATTTTTGCAGATGAAA
TCGGAAAACCTGTCATTATTAGGAAATTAGTAGTCAACTCTGATAATCAA
AAATGCAAATGGATAATTCATGATTCTGGCATCATCGAATCTATGCATTT
CCGAGGATTCGTTATAGATGTTTATTGTCCTAAAATGTTACCCTTTCAAG
AGAAATCTTCAACTAATTGGTCAAATTGTTTGCTTGTCTTAGAAAAGCCC
ATAAACACGAAATATGGAAGAGCCCATCAGAAATTTAAATTAGATTCTCG
AACAGGCTTATTTTATCCTTTCGCAACAAATGACCTTGATAAAGATGTTA
CAGCTGCAGCTTTGGCGAGCATTTGCACAAAATATGTTTGTTCAAACCCC
TTAAGCCAACAGGGTAGTTATCTGGAGATAAACCAAAGACAGGAAGCTTC
TTGTAATTCCTGCGTTAGTATAATGAATGGACGATATTTGATCACACCTT
TTGAAATAGATAATCAAACGTTTTCATGTGACCTATTAGGAGGTTTCAAG
GTGATGAACATAAAACCAAATTTATTACAATCAAGATCTGAAGAAGTGTA
TCAAGATTTTGTACATAAACTTGAAATTATCCGAAAAAAGCTAACCATAA
AAATTTGCAAATCGCGGATTACTGAATCGGTTTCACCGAATATTCAAGTT
CTTCTTCATCTGAATAACAATAAAACAAATAGTCAATCTCAACAGGTTAC
AGCTAAATCTATTTCGCAGTTAATGGGGATAGCCACTGGTGTATTCAATT
TACAAAAGCCAATTCGAATTTTTTATACAGTCAAAGGAGAAGCTATTGTA
GATGATTTGTCTTTTAGAAACATTATGGGTAAAGTACGTGACAATTTGAT
TCAGTCGCCCGAGGAAGATCTAATGGAAACCAAACCAGCTCAGACTAATG
AAATAATAGAAGAAAATAATAATTCAAATTTTAATGTTTCACTGTCTGAA
GATCAATGCTTTTTCATAATTGAGTTTGCCAATAAGGAGCCCACCAATTT
ATATTGTTTGCAAATAAATATTTCCGGTGTTAACGGAATCGAGTTGTTCT
CCAAGAGCCATACGCGTCACGATTCAGCCTTTTTGTTCAATTATGAAATT
TTCAATAATCAAATAAATACCGAATTATTTGTCTGTGATTCGGACTTCGA
AGGAGAACAAACAGAATTATCAATCAAGTCTTCACCGAAAGCTTTGCACC
ATCTTTTTACAAATGTTATGAAGACATTACGTTTGCAACTCATTTCGGCA
AGAGTTAACGCAAATAATGACGGAGACAACGATGGCTATCAAGTTGACAT
TGAATCGATTGACGCAATTGCGGATTTTTCTTTTGAAAACCTCTCTGAAA
ACTTGAAAAATGAGGACTTTGAACGTTTTGCTACGGCTTCAATAATTCCA
TTAATGTCGACTGACAATTTCAAAAAGACCCCTGCGACTTTGAATTTTGA
AATAATATTAAATCGAGTTTCAGAAAGTACATCAACTCCAAATGTTGAAG
TGCCAATAAGTGACATTGGATCAGTAATTAATGAGCCAGTTTATAAGCAA
TTCGAGCTTGTTGAACTATGGGCTTCCTCTGGAGAGCCTTTTTACTTTTC
TAAATCAAATTCTGTCAAATCGAAATTAAAAGATAAGTCTAGTGACACAG
TTTCTCAGTTGAAATTAGAAATAGACAAGAAAAAATTTTTACTTCGTACA
ATGAAAGGAGAAAGATTTAAGAAATTGGATGCCGGAACTTTAGAACCAAC
TCCTAGTGTAAAGAACCCAATCATTATAAAAGGTAATTGGCAGTTTCCTA
CTAACGAAGAGATTAAACTGGAGCAAGAAATTGAAAGTTTGCAAGCTAAA
TTAAATGACGCAAAACCTCAAGTAGAAACCGATTCTTCACAACAGAAAAT
GTTATCTAGAGATTTATACAAACAAAAACATTTGAAAAGTTGTTTTGTTC
ATATCAACGGAAAGAATGAAAACACTTCTGTTTCGGTTTGGGGAGAAAGT
GTTTGGGAAATCCTGGAAAACTCTGCACAATTGCTTGGAATGAAAAAATC
TCCTAAATTTTTATTTAAAAAAGATGGAATGCAAGTAACATCAATTAATC
AGATTTCAACTGGAGATATTTTAGCAGCATCTTCTCATTCAGTATTTATT
TCACCAAAAGCTTCAGGACTTCAGTGTGAAATTAAAGCAAATTGGGGACG
TGCTCGTCGTCAATATGGTGAAGACAGTACTGATATAAAGATCCAATATC
GCCCGAATACACTTATTGACGTAGATCCTTTCGAACCACCAGACATCATG
AGAAATGTCAAAGATTTACCGTCGAAGGAAGCAAAAACCATAAAAGTATT
TGAAAATGGCCAAAGGATATCAGGAGCGAAGGAAATCATTGGTTATTCAT
TGGGTGAACTTCTTAAAAATGCAGAAACCATTTTAAGTTTGAATCTTCGA
GTAAAGTGCTTTTATACTTTAGATGGCAGAAGGATTACAAGCTTTAAAGA
AATTCTTATTGATGATGTACTAGCTGCTTCAGTCAGTGGAAGGGGCCTTC
TAATTATTGACGGTTAAGACTGTATATCTATATATTTCTGTCACACAAAT
TGTG
back to top

protein sequence of SMED30032202-orf-1

>SMED30032202-orf-1 ID=SMED30032202-orf-1|Name=SMED30032202-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1831bp
MSKTSSTREIHHHRLKSHKSSSKRLEKRKSRTPLFLKTVPAMVVLVKQNG
KLYPLTRITGFSIDEILSNCTQIMKLTSAARKLYSKHGELIESLDKLKPN
DEVYVSLGEPFIDPLKIIKESILIREGSFWGLNGLYIPKSKRKAASACVT
HTRTERTWRILTFSNGDYLINEAVEVISNLKDVEEVKSICGKKLNLNGQY
KKLYNSDGFEITDLKFLDDEESYVWNPNSNIVILGPIWASKMEDLNQSGV
YHYFHKTTKEIKNLIKSSKSTLNEIEAIENSEFDKYPASKMKSFSKPELK
VTKEEIKKTLKKYENAFEKFNEKFKQLPKPSDQQVTESETCTEKGLYQCT
KGLRLKVYQNGQNPNKKFTIFFNISQAKRGINDSTILFNRFLDCLSESVH
LSKVNDFSKGLLARRVFMEDGTEIKDVSDLSYDQAICVSYGENWIDPAYT
CVCAKFHFVDNKLESSLVDLEFSSTNLKNFKVVKRFDDKDIIYSLPVLEY
QKRPNLFMLSSLHIMEKENNMENNIIKSWSYTITGRLILKSLPSLCLTLI
TSSKDSLRFHKHSLKQLVTDEISYYAVQLNSIHAHDSTQMWKFHTSGQLY
NKAFPEFFLTYIENKSNVDQDDFVDAIRNSNILAVEQFPEDLQKYQRWAF
KQESFANLSQWKVCDLPNPEWHKCALTWPLKSNGDLNDDLKWPIEGLLIP
CAPPLNRRTCESESRFPIKLRVLKNNDHNMKQSMLVNGPDLTKLIKKGKQ
PPYETHCTNERLLKLEFQMFLDSCTSILRLPSAARRLFTENGNEVYDLEG
LQNYDLVFVSVGEIWCSPFKALTQIKLRSYANKLTVDIERLKYFNMLRRP
NEDFVIGIRSDESGLLEIQILNEQSKLEIQKIFNLENGNATPEPLIKSLV
EDLEKNKSCHERSCEAANLKFKHKSFSDDSEVKIIEKSPKKVALSVSHIN
RQQFLFESNRILTKNDPNMAIFADEIGKPVIIRKLVVNSDNQKCKWIIHD
SGIIESMHFRGFVIDVYCPKMLPFQEKSSTNWSNCLLVLEKPINTKYGRA
HQKFKLDSRTGLFYPFATNDLDKDVTAAALASICTKYVCSNPLSQQGSYL
EINQRQEASCNSCVSIMNGRYLITPFEIDNQTFSCDLLGGFKVMNIKPNL
LQSRSEEVYQDFVHKLEIIRKKLTIKICKSRITESVSPNIQVLLHLNNNK
TNSQSQQVTAKSISQLMGIATGVFNLQKPIRIFYTVKGEAIVDDLSFRNI
MGKVRDNLIQSPEEDLMETKPAQTNEIIEENNNSNFNVSLSEDQCFFIIE
FANKEPTNLYCLQINISGVNGIELFSKSHTRHDSAFLFNYEIFNNQINTE
LFVCDSDFEGEQTELSIKSSPKALHHLFTNVMKTLRLQLISARVNANNDG
DNDGYQVDIESIDAIADFSFENLSENLKNEDFERFATASIIPLMSTDNFK
KTPATLNFEIILNRVSESTSTPNVEVPISDIGSVINEPVYKQFELVELWA
SSGEPFYFSKSNSVKSKLKDKSSDTVSQLKLEIDKKKFLLRTMKGERFKK
LDAGTLEPTPSVKNPIIIKGNWQFPTNEEIKLEQEIESLQAKLNDAKPQV
ETDSSQQKMLSRDLYKQKHLKSCFVHINGKNENTSVSVWGESVWEILENS
AQLLGMKKSPKFLFKKDGMQVTSINQISTGDILAASSHSVFISPKASGLQ
CEIKANWGRARRQYGEDSTDIKIQYRPNTLIDVDPFEPPDIMRNVKDLPS
KEAKTIKVFENGQRISGAKEIIGYSLGELLKNAETILSLNLRVKCFYTLD
GRRITSFKEILIDDVLAASVSGRGLLIIDG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
Vocabulary: biological process
TermDefinition
GO:1902412regulation of mitotic cytokinesis
GO:0035556intracellular signal transduction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR003533Doublecortin_dom
IPR000772Ricin_B_lectin
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular