ATP-dependent RNA helicase DDX24

Overview
NameATP-dependent RNA helicase DDX24
Smed IDSMED30032193
Length (bp)1984
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-dependent RNA helicase DDX24 (SMED30032193) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-dependent RNA helicase DDX24 (SMED30032193) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP-dependent RNA helicase DDX24 (SMED30032193) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP-dependent RNA helicase DDX24 (SMED30032193) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032193

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30032193h1SMcG0011826 dd_Smed_v4_7310_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30032193h1SMcG0011826 dd_Smed_v4_7310_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30032193h1SMcG0011826 dd_Smed_v4_7310_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Human
Match: DDX24 (DEAD-box helicase 24 [Source:HGNC Symbol;Acc:HGNC:13266])

HSP 1 Score: 307.76 bits (787), Expect = 7.233e-97
Identity = 175/428 (40.89%), Postives = 273/428 (63.79%), Query Frame = 1
Query:  472 CKPY--QHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKP-RQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTID---VAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSES-DVKDIQIKNIEYYEEVVKLAREIESQSHVTKTVVNNRNWFEKMAEKADIKLDDEIVEKKNAPSKKKTQEFEKKSEALDLKIKYL 1734
            CK Y  + + GLVLTPTRELA QV  H+    +FT ++   + GGMS ++Q+R+L RRPEIVV TPGR W  I+++  H  +  +L  LV+DEADR++EKGHFAE+   +           +N     P RQTLVFSATLT VH A A +   KK T K+ K +KL   ++K+GM+  P +ID T +   V  L++ KI C T E KD  LY+FL  + GR++VFANS + ++RL+ +L+ L + P +L+A M QK RL+ LE F++ E+ +L+A+DVAARGLDIP++  VIH+ V  T+E ++HRSGRTARA N G S++++ P ++  F K+  +L+K E   +  +Q K ++  +E ++LAR+IE   +       + +W E+ A   +I+L++++ +   A  +++ +  +K+ + L  ++++L
Sbjct:    6 CKAYPKRPLLGLVLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRMLNRRPEIVVATPGRLWELIKEKHYHLRNLRQLRCLVVDEADRMVEKGHFAELSQLLE---------MLNDSQYNPKRQTLVFSATLTLVHQAPA-RILHKKHTKKMDKTAKLDLLMQKIGMRGKPKVIDLTRNEATVETLTETKIHCETDE-KDFYLYYFLMQYPGRSLVFANSISCIKRLSGLLKVLDIMPLTLHACMHQKQRLRNLEQFARLEDCVLLATDVAARGLDIPKVQHVIHYQVPRTSEIYVHRSGRTARATNEGLSLMLIGPEDVINFKKIYKTLKKDEDIPLFPVQTKYMDVVKERIRLARQIEKSEYRNFQACLHNSWIEQAAAALEIELEEDMYKGGKA-DQQEERRRQKQMKVLKKELRHL 421          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Human
Match: DDX24 (DEAD-box helicase 24 [Source:HGNC Symbol;Acc:HGNC:13266])

HSP 1 Score: 307.76 bits (787), Expect = 7.233e-97
Identity = 175/428 (40.89%), Postives = 273/428 (63.79%), Query Frame = 1
Query:  472 CKPY--QHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKP-RQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTID---VAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSES-DVKDIQIKNIEYYEEVVKLAREIESQSHVTKTVVNNRNWFEKMAEKADIKLDDEIVEKKNAPSKKKTQEFEKKSEALDLKIKYL 1734
            CK Y  + + GLVLTPTRELA QV  H+    +FT ++   + GGMS ++Q+R+L RRPEIVV TPGR W  I+++  H  +  +L  LV+DEADR++EKGHFAE+   +           +N     P RQTLVFSATLT VH A A +   KK T K+ K +KL   ++K+GM+  P +ID T +   V  L++ KI C T E KD  LY+FL  + GR++VFANS + ++RL+ +L+ L + P +L+A M QK RL+ LE F++ E+ +L+A+DVAARGLDIP++  VIH+ V  T+E ++HRSGRTARA N G S++++ P ++  F K+  +L+K E   +  +Q K ++  +E ++LAR+IE   +       + +W E+ A   +I+L++++ +   A  +++ +  +K+ + L  ++++L
Sbjct:    6 CKAYPKRPLLGLVLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRMLNRRPEIVVATPGRLWELIKEKHYHLRNLRQLRCLVVDEADRMVEKGHFAELSQLLE---------MLNDSQYNPKRQTLVFSATLTLVHQAPA-RILHKKHTKKMDKTAKLDLLMQKIGMRGKPKVIDLTRNEATVETLTETKIHCETDE-KDFYLYYFLMQYPGRSLVFANSISCIKRLSGLLKVLDIMPLTLHACMHQKQRLRNLEQFARLEDCVLLATDVAARGLDIPKVQHVIHYQVPRTSEIYVHRSGRTARATNEGLSLMLIGPEDVINFKKIYKTLKKDEDIPLFPVQTKYMDVVKERIRLARQIEKSEYRNFQACLHNSWIEQAAAALEIELEEDMYKGGKA-DQQEERRRQKQMKVLKKELRHL 421          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Human
Match: DDX24 (DEAD-box helicase 24 [Source:HGNC Symbol;Acc:HGNC:13266])

HSP 1 Score: 308.916 bits (790), Expect = 3.230e-96
Identity = 176/432 (40.74%), Postives = 274/432 (63.43%), Query Frame = 1
Query:  460 KEDNCKPY--QHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKP-RQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTID---VAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSES-DVKDIQIKNIEYYEEVVKLAREIESQSHVTKTVVNNRNWFEKMAEKADIKLDDEIVEKKNAPSKKKTQEFEKKSEALDLKIKYL 1734
            K   CK Y  + + GLVLTPTRELA QV  H+    +FT ++   + GGMS ++Q+R+L RRPEIVV TPGR W  I+++  H  +  +L  LV+DEADR++EKGHFAE+   +           +N     P RQTLVFSATLT VH A A +   KK T K+ K +KL   ++K+GM+  P +ID T +   V  L++ KI C T E KD  LY+FL  + GR++VFANS + ++RL+ +L+ L + P +L+A M QK RL+ LE F++ E+ +L+A+DVAARGLDIP++  VIH+ V  T+E ++HRSGRTARA N G S++++ P ++  F K+  +L+K E   +  +Q K ++  +E ++LAR+IE   +       + +W E+ A   +I+L++++ +   A  +++ +  +K+ + L  ++++L
Sbjct:  126 KSATCKAYPKRPLLGLVLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRMLNRRPEIVVATPGRLWELIKEKHYHLRNLRQLRCLVVDEADRMVEKGHFAELSQLLE---------MLNDSQYNPKRQTLVFSATLTLVHQAPA-RILHKKHTKKMDKTAKLDLLMQKIGMRGKPKVIDLTRNEATVETLTETKIHCETDE-KDFYLYYFLMQYPGRSLVFANSISCIKRLSGLLKVLDIMPLTLHACMHQKQRLRNLEQFARLEDCVLLATDVAARGLDIPKVQHVIHYQVPRTSEIYVHRSGRTARATNEGLSLMLIGPEDVINFKKIYKTLKKDEDIPLFPVQTKYMDVVKERIRLARQIEKSEYRNFQACLHNSWIEQAAAALEIELEEDMYKGGKA-DQQEERRRQKQMKVLKKELRHL 545          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Human
Match: DDX24 (DEAD-box helicase 24 [Source:HGNC Symbol;Acc:HGNC:13266])

HSP 1 Score: 308.916 bits (790), Expect = 3.230e-96
Identity = 176/432 (40.74%), Postives = 274/432 (63.43%), Query Frame = 1
Query:  460 KEDNCKPY--QHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKP-RQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTID---VAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSES-DVKDIQIKNIEYYEEVVKLAREIESQSHVTKTVVNNRNWFEKMAEKADIKLDDEIVEKKNAPSKKKTQEFEKKSEALDLKIKYL 1734
            K   CK Y  + + GLVLTPTRELA QV  H+    +FT ++   + GGMS ++Q+R+L RRPEIVV TPGR W  I+++  H  +  +L  LV+DEADR++EKGHFAE+   +           +N     P RQTLVFSATLT VH A A +   KK T K+ K +KL   ++K+GM+  P +ID T +   V  L++ KI C T E KD  LY+FL  + GR++VFANS + ++RL+ +L+ L + P +L+A M QK RL+ LE F++ E+ +L+A+DVAARGLDIP++  VIH+ V  T+E ++HRSGRTARA N G S++++ P ++  F K+  +L+K E   +  +Q K ++  +E ++LAR+IE   +       + +W E+ A   +I+L++++ +   A  +++ +  +K+ + L  ++++L
Sbjct:  126 KSATCKAYPKRPLLGLVLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRMLNRRPEIVVATPGRLWELIKEKHYHLRNLRQLRCLVVDEADRMVEKGHFAELSQLLE---------MLNDSQYNPKRQTLVFSATLTLVHQAPA-RILHKKHTKKMDKTAKLDLLMQKIGMRGKPKVIDLTRNEATVETLTETKIHCETDE-KDFYLYYFLMQYPGRSLVFANSISCIKRLSGLLKVLDIMPLTLHACMHQKQRLRNLEQFARLEDCVLLATDVAARGLDIPKVQHVIHYQVPRTSEIYVHRSGRTARATNEGLSLMLIGPEDVINFKKIYKTLKKDEDIPLFPVQTKYMDVVKERIRLARQIEKSEYRNFQACLHNSWIEQAAAALEIELEEDMYKGGKA-DQQEERRRQKQMKVLKKELRHL 545          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Human
Match: DDX24 (DEAD-box helicase 24 [Source:HGNC Symbol;Acc:HGNC:13266])

HSP 1 Score: 309.301 bits (791), Expect = 6.536e-96
Identity = 176/432 (40.74%), Postives = 274/432 (63.43%), Query Frame = 1
Query:  460 KEDNCKPY--QHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKP-RQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTID---VAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSES-DVKDIQIKNIEYYEEVVKLAREIESQSHVTKTVVNNRNWFEKMAEKADIKLDDEIVEKKNAPSKKKTQEFEKKSEALDLKIKYL 1734
            K   CK Y  + + GLVLTPTRELA QV  H+    +FT ++   + GGMS ++Q+R+L RRPEIVV TPGR W  I+++  H  +  +L  LV+DEADR++EKGHFAE+   +           +N     P RQTLVFSATLT VH A A +   KK T K+ K +KL   ++K+GM+  P +ID T +   V  L++ KI C T E KD  LY+FL  + GR++VFANS + ++RL+ +L+ L + P +L+A M QK RL+ LE F++ E+ +L+A+DVAARGLDIP++  VIH+ V  T+E ++HRSGRTARA N G S++++ P ++  F K+  +L+K E   +  +Q K ++  +E ++LAR+IE   +       + +W E+ A   +I+L++++ +   A  +++ +  +K+ + L  ++++L
Sbjct:  126 KSATCKAYPKRPLLGLVLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRMLNRRPEIVVATPGRLWELIKEKHYHLRNLRQLRCLVVDEADRMVEKGHFAELSQLLE---------MLNDSQYNPKRQTLVFSATLTLVHQAPA-RILHKKHTKKMDKTAKLDLLMQKIGMRGKPKVIDLTRNEATVETLTETKIHCETDE-KDFYLYYFLMQYPGRSLVFANSISCIKRLSGLLKVLDIMPLTLHACMHQKQRLRNLEQFARLEDCVLLATDVAARGLDIPKVQHVIHYQVPRTSEIYVHRSGRTARATNEGLSLMLIGPEDVINFKKIYKTLKKDEDIPLFPVQTKYMDVVKERIRLARQIEKSEYRNFQACLHNSWIEQAAAALEIELEEDMYKGGKA-DQQEERRRQKQMKVLKKELRHL 545          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Celegans
Match: F55F8.2 (pep chromosome:WBcel235:I:5646369:5649656:-1 gene:WBGene00018890.1 transcript:F55F8.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F55F8.2)

HSP 1 Score: 242.276 bits (617), Expect = 4.879e-70
Identity = 149/395 (37.72%), Postives = 233/395 (58.99%), Query Frame = 1
Query:  496 GLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLL-KRRPEIVVVTPGRFWAFIQDQDPHALSAS--KLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPM-IIDTTIDVAQ---LSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSESDVKDIQIKNIEY------YEEVVKLAREIESQSHVTKTVVNNRNWFEKMAEKADIKLDD 1641
             L++ PTREL  Q+  H+      T L   +I GG++  +QER++ ++RP+IVV TPGR WA +Q+ +     A    L  LV+DE DR++E+G+FAE+ + +N +   +    +        QTLVFSATLTF  + D V ++ KK   +L+   K+   ++  G++E    +ID T  +     L + +I C    +KDT L + L  + GRTIVF NS ++ RRL SVL+++ + P  L+A M QK RLK LE FS+++N++L+A+DVAARGLDI  ID VIH+ V    E ++HRSGRTARA + G +++++ P     + KL   L +    ++D+ +  I++       ++ V+LA EI+S     K +  + +WFEK A  AD+  D+
Sbjct:  238 ALIVAPTRELVIQIMKHINALISTTQLIATSIVGGLAQVKQERIISQQRPDIVVATPGRLWAMMQEAETGEFLAEWKDLKCLVVDETDRMVEEGYFAELTHILNKIHEESEKEKL--------QTLVFSATLTFAKAQD-VAEEEKKKAKELSSQQKIQRLIKLTGLRENKHKVIDLTRQMGTAGCLVEARINCGNLLEKDTSLVYLLTRYPGRTIVFVNSIDAARRLYSVLKSVNIDPMILHAKMIQKQRLKNLEKFSESKNAVLLATDVAARGLDIQGIDHVIHYQVPKKVEIYIHRSGRTARASHRGLTVVLVDPPSRQFYMKLCKGLNR----MQDLNVFPIDFEPLMNAIKKRVRLASEIDSLGFRCKKIKMSESWFEKAARAADLDYDE 619          

HSP 2 Score: 73.9442 bits (180), Expect = 2.048e-13
Identity = 40/67 (59.70%), Postives = 55/67 (82.09%), Query Frame = 1
Query:   70 LNNWKNLY-IPEPVLKAIEKEGFLKPTQIQTLVLPCAIRDRMDILXXXXXXXXXXLAFGIPMISRIL 267
            ++ WK  Y +P  VL+AIE+ GF +PT+IQ+ VLP A+RDR D+LGAA TG+GKTLAFGIP+++R+L
Sbjct:  153 ISAWKQFYFLPNEVLEAIEQMGFSEPTEIQSAVLPAAVRDRQDVLGAAETGSGKTLAFGIPLVARLL 219          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Celegans
Match: T26G10.1 (Putative ATP-dependent RNA helicase T26G10.1 [Source:UniProtKB/Swiss-Prot;Acc:P34580])

HSP 1 Score: 148.673 bits (374), Expect = 3.004e-38
Identity = 106/343 (30.90%), Postives = 167/343 (48.69%), Query Frame = 1
Query:  484 QHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTI---DVAQLSQWKILCPTQEDKDTRLYWFLKNHQGRT-IVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSESDVKDIQ 1500
            Q  + LVLTPTRELA Q+    +       L    I GG+    Q   L RRP I+V TPGR    +++     L A  L  L++DEADRIL      E+            D+ +  +P + R+T +FSAT+T       V K                  +E+  +++ P  +  +     V  L Q  I  P +  K+T L + L  H G + IVF  +  +  ++  +L+ LG+    L+  M Q+ RL  L  F      +L+ +DVAARGLDIP +D VI++D+   ++ ++HR GRTARA  SG +I +++  ++  + K+  +L K   + K ++
Sbjct:  111 QAFFCLVLTPTRELAFQIGQQFEALGSGIGLIAAVIVGGVDMAAQAMALARRPHIIVATPGRLVDHLENTKGFNLKA--LKFLIMDEADRILNMDFEVEL------------DKILKVIP-RERRTYLFSATMT-----KKVSK------------------LERASLRD-PARVSVSSRYKTVDNLKQHYIFVPNKY-KETYLVYLLNEHAGNSAIVFCATCATTMQIAVMLRQLGMQAVPLHGQMSQEKRLGSLNKFKSKAREILVCTDVAARGLDIPHVDMVINYDMPSQSKDYVHRVGRTARAGRSGIAITVVTQYDVEAYQKIEANLGKKLDEYKCVE 413          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Celegans
Match: H20J04.4 (pep chromosome:WBcel235:II:4329023:4334091:1 gene:WBGene00019219.1 transcript:H20J04.4b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H20J04.4)

HSP 1 Score: 146.362 bits (368), Expect = 4.199e-37
Identity = 102/322 (31.68%), Postives = 156/322 (48.45%), Query Frame = 1
Query:  478 PYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQ-DQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLT----FVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTIDVAQLSQWKILCPTQEDKDTRLYWFLKNH-----QGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSI 1413
            PY  IY L+LTPTRELA Q+ +      +   L+   I GG S   Q R L  RP +VV TPGR    I+ D D  A    K+   V+DEADR+LE  +  +++     +              + RQTL+ SAT+T     +H     K                  F E  G  +     ++T+D  +L Q  ++CP    KD  L + +KN+     +   ++FA +    + L  + + LG    SL++ + QK RL  L +F      ++I +DVA+RGLDIP +D V++ +V    +T++HR GR+ARA   G ++
Sbjct:  155 PY-GIYALILTPTRELAFQIAEQFTALGKPITLKCSVIVGGRSLIHQARELSERPHVVVATPGRLADLIESDPDTIAKVFKKIQFFVLDEADRMLEGQYNDQLKPIFESIS-------------EKRQTLLLSATITNNINMLHRVSTRKP----------------YFFEDKGKDD-----ESTVD--RLEQKYVVCPVAV-KDAYLVYVVKNYSEKNPKSSVMIFAQTCRECQALAYMFEGLGFRVGSLHSQIPQKQRLAALSAFRSKTLQVIICTDVASRGLDIPHVDLVVNHNVPQCPKTYIHRVGRSARAGRFGSAL 438          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Celegans
Match: H20J04.4 (pep chromosome:WBcel235:II:4329023:4334484:1 gene:WBGene00019219.1 transcript:H20J04.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H20J04.4)

HSP 1 Score: 146.362 bits (368), Expect = 4.199e-37
Identity = 102/322 (31.68%), Postives = 156/322 (48.45%), Query Frame = 1
Query:  478 PYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQ-DQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLT----FVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTIDVAQLSQWKILCPTQEDKDTRLYWFLKNH-----QGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSI 1413
            PY  IY L+LTPTRELA Q+ +      +   L+   I GG S   Q R L  RP +VV TPGR    I+ D D  A    K+   V+DEADR+LE  +  +++     +              + RQTL+ SAT+T     +H     K                  F E  G  +     ++T+D  +L Q  ++CP    KD  L + +KN+     +   ++FA +    + L  + + LG    SL++ + QK RL  L +F      ++I +DVA+RGLDIP +D V++ +V    +T++HR GR+ARA   G ++
Sbjct:  155 PY-GIYALILTPTRELAFQIAEQFTALGKPITLKCSVIVGGRSLIHQARELSERPHVVVATPGRLADLIESDPDTIAKVFKKIQFFVLDEADRMLEGQYNDQLKPIFESIS-------------EKRQTLLLSATITNNINMLHRVSTRKP----------------YFFEDKGKDD-----ESTVD--RLEQKYVVCPVAV-KDAYLVYVVKNYSEKNPKSSVMIFAQTCRECQALAYMFEGLGFRVGSLHSQIPQKQRLAALSAFRSKTLQVIICTDVASRGLDIPHVDLVVNHNVPQCPKTYIHRVGRSARAGRFGSAL 438          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Celegans
Match: H20J04.4 (pep chromosome:WBcel235:II:4329023:4332507:1 gene:WBGene00019219.1 transcript:H20J04.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H20J04.4)

HSP 1 Score: 145.206 bits (365), Expect = 4.254e-37
Identity = 102/322 (31.68%), Postives = 156/322 (48.45%), Query Frame = 1
Query:  478 PYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQ-DQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLT----FVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTIDVAQLSQWKILCPTQEDKDTRLYWFLKNH-----QGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSI 1413
            PY  IY L+LTPTRELA Q+ +      +   L+   I GG S   Q R L  RP +VV TPGR    I+ D D  A    K+   V+DEADR+LE  +  +++     +              + RQTL+ SAT+T     +H     K                  F E  G  +     ++T+D  +L Q  ++CP    KD  L + +KN+     +   ++FA +    + L  + + LG    SL++ + QK RL  L +F      ++I +DVA+RGLDIP +D V++ +V    +T++HR GR+ARA   G ++
Sbjct:  155 PY-GIYALILTPTRELAFQIAEQFTALGKPITLKCSVIVGGRSLIHQARELSERPHVVVATPGRLADLIESDPDTIAKVFKKIQFFVLDEADRMLEGQYNDQLKPIFESIS-------------EKRQTLLLSATITNNINMLHRVSTRKP----------------YFFEDKGKDD-----ESTVD--RLEQKYVVCPVAV-KDAYLVYVVKNYSEKNPKSSVMIFAQTCRECQALAYMFEGLGFRVGSLHSQIPQKQRLAALSAFRSKTLQVIICTDVASRGLDIPHVDLVVNHNVPQCPKTYIHRVGRSARAGRFGSAL 438          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Fly
Match: CG9143 (gene:FBgn0034496 transcript:FBtr0086304)

HSP 1 Score: 335.495 bits (859), Expect = 4.837e-104
Identity = 210/533 (39.40%), Postives = 316/533 (59.29%), Query Frame = 1
Query:   70 LNNWKNLYIPEPVLKAIEKEGFLKPTQIQTLVLPCAIRDRMDILXXXXXXXXXXLAFGIPMISRILMDKQKEIDIYKDXXXXXXXXXXXXXXXXXXDQCDLSPSESELEF--AWNDDEIKPELFTGVEMCRIKEDNCKPYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHS-ADAVKKQMXXXX---XXXXXXXXXXXFVEKLGMKECPMIIDTTID--VAQ-LSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSES-DVKDIQIKNIEYYEEVVKLAREIESQSHVTKTVVNNRNWFEKMAEKADIKLD 1638
            ++ W  L +P  +L+A+ ++GF  PTQIQ L LP AI  + DILGAA TG+GKTLAFGIPM++ I+  KQ+ I       I ++  ++        D+ +L+P   EL+     +D+E   E           E   +    +YGLVLTPTRELA QV +HL  A ++T ++V AIFGG++  +QER+L++ P+IVV TPGR W      + H      +S LVIDE DR++EKGHF E+ + +  + ++   +         RQ  V+SATLT VH   D ++K+         K T + K+ + +E+LG+ + P I+D T     AQ L++ ++LCP  + KD  LY+F++ H GRTIVF NS + V+RL ++   L  +P  L+A+M QK RLK LE F  +   LLIA+DVAARGLDIP ++ VIH+ V  T+E ++HRSGRTARA   G +++ + P E+  + KL  +L+++E   +  I  + +    E V LAR+++ +    K V + R W +K AE+ D+ +D
Sbjct:  214 MSAWNGLGVPASILRALGEQGFKTPTQIQALTLPAAIHGKKDILGAAETGSGKTLAFGIPMLAGIMELKQRNIR----SGIRKAPKVKGQQPEPAADEHELTPPPEELDHVSGASDEESDAE-----------EQAQRVQTPLYGLVLTPTRELAVQVKNHLVAAAKYTGIRVAAIFGGLAVAKQERVLRQCPDIVVATPGRLWELYAQGNRHLGKIEDVSFLVIDETDRMVEKGHFEELRSLLKVLNSDEQKKH-------QRQNFVYSATLTLVHDLPDHMQKRNVGKRPKFVKQTVDQKIESLIEELGISQ-PKIVDITSSQQTAQTLTESRLLCPI-DHKDYHLYYFIQRHPGRTIVFCNSIDCVKRLATLFGLLDCNPLPLHANMIQKQRLKNLERFRDSPTGLLIATDVAARGLDIPNVEHVIHYQVPRTSENYVHRSGRTARANKHGITVMFMEPGEVKSYVKLYKTLERTEDLPLFPILERFMGAVRERVNLARDLDKEELKLKRVQSERGWMKKHAEEMDMIID 722          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Fly
Match: CG9253 (gene:FBgn0032919 transcript:FBtr0081468)

HSP 1 Score: 148.673 bits (374), Expect = 4.771e-38
Identity = 104/334 (31.14%), Postives = 169/334 (50.60%), Query Frame = 1
Query:  484 QHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTT---IDVAQLSQWKILCPTQEDKDTRLYWFLKNHQGRT-IVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQK 1473
            Q  + LVLTPTRELA Q+ +  +       ++ C + GGM    Q   L ++P I++ TPGR    +++     L A K   LV+DEADRIL      E+            D+ +  +P + R+T +FSAT+T       VKK                  +++  +K+ P+ ++ +     V QL Q  +  P +  KD  L   L    G + ++F ++ N+  +   +L+ LGL+   L+  M Q  RL  L  F     S+LI++DVA+RGLDIP +D V++FD+   ++ ++HR GRTARA  SG +I ++S  ++  + ++   L K
Sbjct:  128 QRYFALVLTPTRELAFQIGEQFEALGSGIGIKCCVVVGGMDMVAQGLQLAKKPHIIIATPGRLVDHLENMKGFNLKAIKY--LVMDEADRILNMDFEVEL------------DKILKVLP-RERRTFLFSATMT-----KKVKK------------------LQRASLKD-PVKVEVSNKYQTVEQLQQSYLFIPVKY-KDVYLVHILNELAGNSFMIFCSTCNNTVKTALMLRALGLAAIPLHGQMSQNKRLAALNKFKAKNRSILISTDVASRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITLVSQYDIELYQRIEHLLGK 421          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Fly
Match: Rs1 (gene:FBgn0021995 transcript:FBtr0345935)

HSP 1 Score: 140.198 bits (352), Expect = 2.529e-34
Identity = 107/318 (33.65%), Postives = 158/318 (49.69%), Query Frame = 1
Query:  499 LVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTIDVA-QLSQWKILCPTQEDKDTRLYWFLKNHQGRT-----IVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNE 1434
            LVL PTREL  QV    K+ CQFT + V    GG+  + QE +L++ P+IV+ TPGR    I++     L +  + +L++DEADR+L+       E F   MK       IN    K RQT++FSAT++     + VK                         K   + ++    VA  L Q  I    +EDK+      L +   RT     +VF  +K    RL  +L  LG+    L+ ++ Q+ RL+ L+ F + +  +LIA+DVAARGLDI  +  VI+F +  T E ++HR GRTARA  +G S+ +    E
Sbjct:  233 LVLVPTRELGAQVYQVTKQLCQFTTIDVGLAIGGLDVKAQEAVLRQNPDIVIATPGRLIDHIKNTPSFTLDS--IEVLILDEADRMLD-------EYFAEQMK-----EIINSC-CKTRQTMLFSATMS-----EQVKDLAAVSLD-----------------KPIKVFVNNNQQVAFNLRQEFIRI--REDKEGDREPILASLICRTFHDHCMVFVQTKKQAHRLHILLGLLGVRAGELHGNLTQQQRLESLKKFKEEQIDVLIATDVAARGLDIVGVKTVINFVMPITTEHYIHRVGRTARAGRAGISVSLAGEKE 511          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Fly
Match: Rs1 (gene:FBgn0021995 transcript:FBtr0088788)

HSP 1 Score: 140.198 bits (352), Expect = 2.529e-34
Identity = 107/318 (33.65%), Postives = 158/318 (49.69%), Query Frame = 1
Query:  499 LVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTIDVA-QLSQWKILCPTQEDKDTRLYWFLKNHQGRT-----IVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNE 1434
            LVL PTREL  QV    K+ CQFT + V    GG+  + QE +L++ P+IV+ TPGR    I++     L +  + +L++DEADR+L+       E F   MK       IN    K RQT++FSAT++     + VK                         K   + ++    VA  L Q  I    +EDK+      L +   RT     +VF  +K    RL  +L  LG+    L+ ++ Q+ RL+ L+ F + +  +LIA+DVAARGLDI  +  VI+F +  T E ++HR GRTARA  +G S+ +    E
Sbjct:  233 LVLVPTRELGAQVYQVTKQLCQFTTIDVGLAIGGLDVKAQEAVLRQNPDIVIATPGRLIDHIKNTPSFTLDS--IEVLILDEADRMLD-------EYFAEQMK-----EIINSC-CKTRQTMLFSATMS-----EQVKDLAAVSLD-----------------KPIKVFVNNNQQVAFNLRQEFIRI--REDKEGDREPILASLICRTFHDHCMVFVQTKKQAHRLHILLGLLGVRAGELHGNLTQQQRLESLKKFKEEQIDVLIATDVAARGLDIVGVKTVINFVMPITTEHYIHRVGRTARAGRAGISVSLAGEKE 511          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Fly
Match: pit (gene:FBgn0266581 transcript:FBtr0084174)

HSP 1 Score: 134.42 bits (337), Expect = 1.345e-32
Identity = 104/353 (29.46%), Postives = 167/353 (47.31%), Query Frame = 1
Query:  499 LVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDT-----TIDVAQLSQWKILCPTQEDKDTRLYWFLK-NHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALN-SGYSIIMLSPNEMG----------QFNKLLFSLQKSESDVKDIQIK 1506
            ++++PTREL+ Q    LK+           + GG + + +   L +   I+V TPGR    +Q+  P  L  + L  L+IDE DRILE G   E++  +N +              K RQT++FSAT T    A                       + KL +K  P+ +       T  V  L Q  I+CP+ E +   L+ FLK N + + +VF +S  SV+    +   + L   S++   +Q  R      F   E+ +L+ +DVAARGLDIP++D+++ +D       ++HR GRTAR    SG++++++ P E+G            N+  FS QK    + DIQ++
Sbjct:  263 IIISPTRELSMQTFGVLKELMAHHHHTYGLVMGGSNRQVESEKLGKGINILVATPGRLLDHLQN-SPDFLYKN-LQCLIIDEVDRILEIGFEEELKQIINLLP-------------KRRQTMLFSATQTARIEA-----------------------LSKLALKSEPIYVGVHDNQDTATVDGLEQGYIVCPS-EKRLLVLFTFLKKNRKKKVMVFFSSCMSVKYHHELFNYIDLPVTSIHGKQKQTKRTTTFFQFCNAESGILLCTDVAARGLDIPQVDWIVQYDPPDDPREYIHRVGRTARGSGTSGHALLLMRPEELGFLRYLKAAKVPLNEFEFSWQK----IADIQLQ 572          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Zebrafish
Match: ddx24 (DEAD (Asp-Glu-Ala-Asp) box helicase 24 [Source:ZFIN;Acc:ZDB-GENE-100716-4])

HSP 1 Score: 353.214 bits (905), Expect = 4.402e-111
Identity = 226/545 (41.47%), Postives = 328/545 (60.18%), Query Frame = 1
Query:   70 LNNWKNLYIPEPVLKAIEKEGFLKPTQIQTLVLPCAIRDRMDILXXXXXXXXXXLAFGIPMISRILM-DKQKEIDIYKDXXXXXXXXXXXXXXXXXXDQCDLSPSESELEFAWNDDEIKPELFTGVEMCRIKEDN-------------CKPYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTT---IDVAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSES-DVKDIQIKNIEYYEEVVKLAREIESQSHVTKTVVNNRNWFEKMAEKADIKLDDEIV 1650
            +++W++L +PEPVL+A+   GF  PT IQ LVLP AIRDR+DILGAA TG+GKTL FGIPMI  IL   +Q E     +     ++ + +  E  E+D  D    E + +   +DDE       G E C    D+             C+P   + GLVLTPTRELA QV  H+    QFT ++   + GGM+ ++Q R+L RRPEI++ TPGR W  I+++ PH     +L  LV+DEADR++EKGHFAE+E+ +  + T+   +F +      RQT VFSATLT VHS  +  +Q KK      + SKL   +EK+G+++ P +ID T     V  L++ +I C T+EDKD  LY+FL    GR++VFANS   ++RL ++L  L  +P  L+A+M QK RLK LE F++    +L+ +DVAARGLDIP +  VIH+ V  T+ET++HRSGRTARA   G S++++SP+++  + ++  +L KSE   V  ++ K +   +E V LA  IE   +       + +W  + AE  DI +DDE++
Sbjct:  204 VSSWRDLLVPEPVLRALAVLGFSAPTAIQALVLPPAIRDRLDILGAAETGSGKTLCFGIPMIHMILQWREQTEEHSTPERTHTPAQSLYLQEEHGEDDDDDDDDDEKKDDEVIDDDE------GGAEGCSAPPDDPDGQNDPDPASGVCRP---LLGLVLTPTRELAVQVKHHIDAVAQFTGIKTAIVVGGMAPQKQHRVLMRRPEIIIATPGRLWEMIREKHPHLQDLRQLRCLVLDEADRMVEKGHFAELESLLELLNTS---QFSSR-----RQTFVFSATLTLVHSLPSRLQQKKKKQRPAEQRSKLQLLMEKVGVRDKPKVIDLTRKQATVETLTETRISC-TKEDKDLFLYYFLLQFPGRSMVFANSIACIKRLYALLHLLDCTPLMLHANMHQKQRLKNLERFAENTRCVLLTTDVAARGLDIPDVQHVIHYQVPRTSETYVHRSGRTARATREGLSLLLISPDDLLNYRRICRTLDKSEELPVFPVESKCMAAVKERVDLAHRIEKMEYFHSRQTQHNSWVRQAAEAMDIDVDDELL 730          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Zebrafish
Match: ddx24 (DEAD (Asp-Glu-Ala-Asp) box helicase 24 [Source:ZFIN;Acc:ZDB-GENE-100716-4])

HSP 1 Score: 354.369 bits (908), Expect = 6.649e-111
Identity = 226/545 (41.47%), Postives = 328/545 (60.18%), Query Frame = 1
Query:   70 LNNWKNLYIPEPVLKAIEKEGFLKPTQIQTLVLPCAIRDRMDILXXXXXXXXXXLAFGIPMISRILM-DKQKEIDIYKDXXXXXXXXXXXXXXXXXXDQCDLSPSESELEFAWNDDEIKPELFTGVEMCRIKEDN-------------CKPYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTT---IDVAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSES-DVKDIQIKNIEYYEEVVKLAREIESQSHVTKTVVNNRNWFEKMAEKADIKLDDEIV 1650
            +++W++L +PEPVL+A+   GF  PT IQ LVLP AIRDR+DILGAA TG+GKTL FGIPMI  IL   +Q E     +     ++ + +  E  E+D  D    E + +   +DDE       G E C    D+             C+P   + GLVLTPTRELA QV  H+    QFT ++   + GGM+ ++Q R+L RRPEI++ TPGR W  I+++ PH     +L  LV+DEADR++EKGHFAE+E+ +  + T+   +F +      RQT VFSATLT VHS  +  +Q KK      + SKL   +EK+G+++ P +ID T     V  L++ +I C T+EDKD  LY+FL    GR++VFANS   ++RL ++L  L  +P  L+A+M QK RLK LE F++    +L+ +DVAARGLDIP +  VIH+ V  T+ET++HRSGRTARA   G S++++SP+++  + ++  +L KSE   V  ++ K +   +E V LA  IE   +       + +W  + AE  DI +DDE++
Sbjct:  233 VSSWRDLLVPEPVLRALAVLGFSAPTAIQALVLPPAIRDRLDILGAAETGSGKTLCFGIPMIHMILQWREQTEEHSTPERTHTPAQSLYLQEEHGEDDDDDDDDDEKKDDEVIDDDE------GGAEGCSAPPDDPDGQNDPDPASGVCRP---LLGLVLTPTRELAVQVKHHIDAVAQFTGIKTAIVVGGMAPQKQHRVLMRRPEIIIATPGRLWEMIREKHPHLQDLRQLRCLVLDEADRMVEKGHFAELESLLELLNTS---QFSSR-----RQTFVFSATLTLVHSLPSRLQQKKKKQRPAEQRSKLQLLMEKVGVRDKPKVIDLTRKQATVETLTETRISC-TKEDKDLFLYYFLLQFPGRSMVFANSIACIKRLYALLHLLDCTPLMLHANMHQKQRLKNLERFAENTRCVLLTTDVAARGLDIPDVQHVIHYQVPRTSETYVHRSGRTARATREGLSLLLISPDDLLNYRRICRTLDKSEELPVFPVESKCMAAVKERVDLAHRIEKMEYFHSRQTQHNSWVRQAAEAMDIDVDDELL 759          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Zebrafish
Match: ddx49 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:ZFIN;Acc:ZDB-GENE-031030-3])

HSP 1 Score: 147.902 bits (372), Expect = 6.028e-38
Identity = 109/334 (32.63%), Postives = 171/334 (51.20%), Query Frame = 1
Query:  478 PYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTIDVA---QLSQWKILCPTQEDKDTRLYWFLKNHQGR-----TIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKL 1455
            PY  ++ LVLTPTRELA Q+ +  +   +   L+ C I GGM    Q   L ++P +VV TPGR    I+  D   ++ +++  L++DEADR+LE+G      +F     T   +  ++ VP+K RQTL+FSATLT     D +++                  ++ + M   P   +   DV    +L Q  IL P ++ KD  L   ++  Q        I+F N+  S + LT +L+       SL++ M+Q+ R   L  F      +LIA+DVAARGLDIP +  VI+ +     + ++HR GRTARA  +G SI +++  ++   N +
Sbjct:   68 PY-GVFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVTQGLELSKKPHVVVATPGRLADHIRSSD--TINLNRIQFLIMDEADRLLEQG----CTDF-----TKDLEVILSAVPVK-RQTLLFSATLT-----DTLQQ------------------LQSIAMNR-PFFWEHKSDVQTVKELDQRFILTP-EKVKDAYLVHLIQTFQDEHDDWSIIIFTNTCKSCQILTMMLREFNFPTISLHSMMKQRQRFANLAKFKSNVFKILIATDVAARGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRNGVSITLVTQYDIHLINAI 363          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Zebrafish
Match: ddx27 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 27 [Source:ZFIN;Acc:ZDB-GENE-031001-8])

HSP 1 Score: 133.265 bits (334), Expect = 6.466e-32
Identity = 95/317 (29.97%), Postives = 159/317 (50.16%), Query Frame = 1
Query:  499 LVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKE-CPMIIDTTIDVAQL--SQWKILCPTQE-DKDTRLYWFL-KNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNE 1434
            LVL PTREL  QV    ++  QFT +  C   GG+  + QE  L+  P++++ TPGR    + +     LS  ++ IL++DEADR+L+       E F   MK       I  +    RQT++FSAT++     + VK                   +  + +K+   + +++  DVA     ++  + P +E D++  +   L +  Q   ++F  +K    R+  +L  +GL    L+ ++ Q  RL+ L  F   +  +L+A+DVAARGLDI  +  VI+F + +T + ++HR GRTARA   G S+ ++   E
Sbjct:  276 LVLVPTRELGIQVHTVARQLAQFTTISTCLAVGGLDLKSQEAALRAGPDVLIATPGRLIDHLHNTPSFELS--QIEILILDEADRMLD-------EYFEEQMKE------IIRMCAYQRQTMLFSATMS-----EEVKD------------------LASVSLKQPVRIFVNSNTDVAPYLRQEFVRIRPNKEGDREAIVAALLTRTFQDHVMLFTQTKKQAHRMHILLGLMGLKVGELHGNLSQTQRLESLRRFKDEQIDILVATDVAARGLDIEGVKTVINFTMPNTVKHYVHRVGRTARAGKVGRSVSLVGETE 554          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Zebrafish
Match: ddx18 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 [Source:ZFIN;Acc:ZDB-GENE-030131-9685])

HSP 1 Score: 131.724 bits (330), Expect = 1.477e-31
Identity = 94/321 (29.28%), Postives = 154/321 (47.98%), Query Frame = 1
Query:  499 LVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDT-----TIDVAQLSQWKILCPTQEDKDTRLYWFLK-NHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNS-GYSIIMLSPNEMG 1440
            +VL+PTRELA Q    LK+           I GG +   + + L     I+V TPGR    +Q+          L  L+IDEADRILE G   E++  +  +              K RQ+++FSAT T                       +    + ++ +K+ P+ +       T  V  L Q  ++CP+ E +   L+ FLK N + + +VF +S  SV+    +L  + L   +++   +Q  R      F   ++ +L+ +DVAARGLDIP +D+++ FD     + ++HR GRTAR +N  G+++++L P E+G
Sbjct:  237 IVLSPTRELAMQTYGVLKELMTHHVHTYGLIMGGSNRSAEAQKLANGVNILVATPGRLLDHLQNTP--GFMFKNLQCLIIDEADRILEVGFEEELKQIIKLLP-------------KKRQSMLFSATQT-----------------------RKVEDLARISLKKEPLYVGVDDNKDTATVEGLEQGYVVCPS-EKRFLLLFTFLKKNRKKKLMVFFSSCMSVKFHYELLNYIDLPVMAIHGKQKQTKRTTTFFQFCNADSGILLCTDVAARGLDIPEVDWIVQFDPPDDPKEYIHRVGRTARGINGRGHALLILRPEELG 518          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Xenopus
Match: DDX24 (DEAD-box helicase 24 [Source:NCBI gene;Acc:100490359])

HSP 1 Score: 350.903 bits (899), Expect = 4.436e-110
Identity = 218/529 (41.21%), Postives = 321/529 (60.68%), Query Frame = 1
Query:   70 LNNWKNLYIPEPVLKAIEKEGFLKPTQIQTLVLPCAIRDRMDILXXXXXXXXXXLAFGIPMISRIL-MDKQKEIDIYKDXXXXXXXXXXXXXXXXXXDQCDLSPSESELEFAWNDDEIKPELFTGVEMCRIKED-NCKPYQH---------IYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTT---IDVAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSESDVKD--IQIKNIEYYEEVVKLAREIESQSHVTKTVVNNRNWFEK 1608
            ++ WKNLY+P+ VLKA+   GF  PT IQ L LP AIRD+MDILGAA TG+GKTLAF IPMI  IL   K++E    + E  E+    +  +E++  ++ +   SE+E +    DD ++P     + +  I  + N  P            + GLV+TPTRELA QV  H+    +FT ++   + GGM+ ++Q+RLL RRPEIV+ TPGR W  I+++ PH  +  +L  LVIDEADR++EKGH+AE+      +     +   N      RQT VFSATLT +H A     Q KK       +  +S  +EK+GMK+ P +ID T     V  L++ +I C T E+KD  LY+FL  + GRT+VFANS + ++RL+S+L  L  +P  ++A+M QK RLK LE F++ E+ +L+ +DVAARGLDIP +  VIH+ V  T+ET++HRSGRTARA + G +++++ PN+M  F K+  +L+K+E ++ D  ++ K +   +E V LAR IE   +         +W ++
Sbjct:  172 VSAWKNLYVPQVVLKALSYLGFACPTPIQALALPSAIRDKMDILGAAETGSGKTLAFAIPMIHSILEWQKRQEYGAAEGETEEKPTTSDGKNEMDVAEKEEQDMSENEEDVEQVDDNVEPLSAACINVENIDINVNAVPSSKTGTWDKERPLLGLVVTPTRELAVQVKHHIDAVAKFTGIRTAIVVGGMAPQKQQRLLDRRPEIVIATPGRLWELIRERHPHLRNLRQLRCLVIDEADRMVEKGHYAELSQLFELL----SEVHYNS----KRQTFVFSATLTLIHQAPTRLLQKKKYKKIDKDSKLVS-LMEKIGMKDKPKVIDLTRKQATVETLTETRIHCAT-EEKDFYLYYFLLQYPGRTMVFANSIDCIKRLSSLLTILDCNPLPMHANMHQKQRLKNLERFAERESCVLLTTDVAARGLDIPNVQHVIHYQVPRTSETYVHRSGRTARASSDGLTLLLIGPNDMINFKKIFRTLEKNE-ELPDFPVESKCMSGIKERVNLARMIEKMEYFNCKAKQQNSWLQQ 689          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Xenopus
Match: DDX24 (DEAD-box helicase 24 [Source:NCBI gene;Acc:100490359])

HSP 1 Score: 350.903 bits (899), Expect = 7.926e-110
Identity = 218/529 (41.21%), Postives = 321/529 (60.68%), Query Frame = 1
Query:   70 LNNWKNLYIPEPVLKAIEKEGFLKPTQIQTLVLPCAIRDRMDILXXXXXXXXXXLAFGIPMISRIL-MDKQKEIDIYKDXXXXXXXXXXXXXXXXXXDQCDLSPSESELEFAWNDDEIKPELFTGVEMCRIKED-NCKPYQH---------IYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTT---IDVAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSESDVKD--IQIKNIEYYEEVVKLAREIESQSHVTKTVVNNRNWFEK 1608
            ++ WKNLY+P+ VLKA+   GF  PT IQ L LP AIRD+MDILGAA TG+GKTLAF IPMI  IL   K++E    + E  E+    +  +E++  ++ +   SE+E +    DD ++P     + +  I  + N  P            + GLV+TPTRELA QV  H+    +FT ++   + GGM+ ++Q+RLL RRPEIV+ TPGR W  I+++ PH  +  +L  LVIDEADR++EKGH+AE+      +     +   N      RQT VFSATLT +H A     Q KK       +  +S  +EK+GMK+ P +ID T     V  L++ +I C T E+KD  LY+FL  + GRT+VFANS + ++RL+S+L  L  +P  ++A+M QK RLK LE F++ E+ +L+ +DVAARGLDIP +  VIH+ V  T+ET++HRSGRTARA + G +++++ PN+M  F K+  +L+K+E ++ D  ++ K +   +E V LAR IE   +         +W ++
Sbjct:  188 VSAWKNLYVPQVVLKALSYLGFACPTPIQALALPSAIRDKMDILGAAETGSGKTLAFAIPMIHSILEWQKRQEYGAAEGETEEKPTTSDGKNEMDVAEKEEQDMSENEEDVEQVDDNVEPLSAACINVENIDINVNAVPSSKTGTWDKERPLLGLVVTPTRELAVQVKHHIDAVAKFTGIRTAIVVGGMAPQKQQRLLDRRPEIVIATPGRLWELIRERHPHLRNLRQLRCLVIDEADRMVEKGHYAELSQLFELL----SEVHYNS----KRQTFVFSATLTLIHQAPTRLLQKKKYKKIDKDSKLVS-LMEKIGMKDKPKVIDLTRKQATVETLTETRIHCAT-EEKDFYLYYFLLQYPGRTMVFANSIDCIKRLSSLLTILDCNPLPMHANMHQKQRLKNLERFAERESCVLLTTDVAARGLDIPNVQHVIHYQVPRTSETYVHRSGRTARASSDGLTLLLIGPNDMINFKKIFRTLEKNE-ELPDFPVESKCMSGIKERVNLARMIEKMEYFNCKAKQQNSWLQQ 705          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Xenopus
Match: DDX24 (DEAD-box helicase 24 [Source:NCBI gene;Acc:100490359])

HSP 1 Score: 348.591 bits (893), Expect = 2.953e-109
Identity = 216/518 (41.70%), Postives = 316/518 (61.00%), Query Frame = 1
Query:   70 LNNWKNLYIPEPVLKAIEKEGFLKPTQIQTLVLPCAIRDRMDILXXXXXXXXXXLAFGIPMISRILMDKQKEIDIYKDXXXXXXXXXXXXXXXXXXDQCDLSPSESELEFAWNDDEIKPELFTGVEMCRIKEDNCKPYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTT---IDVAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSESDVKD--IQIKNIEYYEEVVKLAREIESQSHVTKTVVNNRNWFEK 1608
            ++ WKNLY+P+ VLKA+   GF  PT IQ L LP AIRD+MDILGAA TG+GKTLAF IPMI  IL     E    ++    E E  E  +  +  ++ D++  E E + + N++++     TG        D  +P   + GLV+TPTRELA QV  H+    +FT ++   + GGM+ ++Q+RLL RRPEIV+ TPGR W  I+++ PH  +  +L  LVIDEADR++EKGH+AE+      +     +   N      RQT VFSATLT +H A     Q KK       +  +S  +EK+GMK+ P +ID T     V  L++ +I C T E+KD  LY+FL  + GRT+VFANS + ++RL+S+L  L  +P  ++A+M QK RLK LE F++ E+ +L+ +DVAARGLDIP +  VIH+ V  T+ET++HRSGRTARA + G +++++ PN+M  F K+  +L+K+E ++ D  ++ K +   +E V LAR IE   +         +W ++
Sbjct:  188 VSAWKNLYVPQVVLKALSYLGFACPTPIQALALPSAIRDKMDILGAAETGSGKTLAFAIPMIHSIL-----EWQKRQEYGAAEGETEEKPTTSDGKNEMDVAEKE-EQDMSENEEDVDK---TGTW------DKERP---LLGLVVTPTRELAVQVKHHIDAVAKFTGIRTAIVVGGMAPQKQQRLLDRRPEIVIATPGRLWELIRERHPHLRNLRQLRCLVIDEADRMVEKGHYAELSQLFELL----SEVHYNS----KRQTFVFSATLTLIHQAPTRLLQKKKYKKIDKDSKLVS-LMEKIGMKDKPKVIDLTRKQATVETLTETRIHCAT-EEKDFYLYYFLLQYPGRTMVFANSIDCIKRLSSLLTILDCNPLPMHANMHQKQRLKNLERFAERESCVLLTTDVAARGLDIPNVQHVIHYQVPRTSETYVHRSGRTARASSDGLTLLLIGPNDMINFKKIFRTLEKNE-ELPDFPVESKCMSGIKERVNLARMIEKMEYFNCKAKQQNSWLQQ 676          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Xenopus
Match: mki67 (marker of proliferation Ki-67 [Source:Xenbase;Acc:XB-GENE-6457930])

HSP 1 Score: 154.451 bits (389), Expect = 3.941e-40
Identity = 103/328 (31.40%), Postives = 169/328 (51.52%), Query Frame = 1
Query:  484 QHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKE---CPMIIDTTIDVAQLSQWKILCPTQEDKDTRLYWFLKNHQGRT-IVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKL 1455
            Q +Y LVLTPTRELA Q+++  +       ++   I GG+    Q   L ++P +V+ TPGR    +++     L A  L  LV+DEADRIL      EV            D+ +  +P + R+T +FSAT+T       V+K                  +++  +K+   C  +      V +L Q+ +  P++  KD+ L + L    G + ++F ++ N+ +R+  +L+ LG +   L+  M Q  RL  L  F     S+L+A+DVA+RGLDIP +D VI+FD+   ++ ++HR GRTARA  SG +I  +S  ++  F ++
Sbjct:   86 QRLYALVLTPTRELAFQISEQFEALGSTIGVKSAVIVGGIDMMSQSLALAKKPHVVIATPGRLIDHLENTKGFNLRA--LKYLVMDEADRILNMDFETEV------------DKILKVIP-RDRKTFLFSATMT-----KKVQK------------------LQRAALKDPVKCA-VSSKYQTVEKLQQFYVFIPSK-FKDSYLVYILNELAGNSFMIFCSTCNNTQRVALLLRNLGFTAIPLHGQMSQNKRLGSLNKFKAKSRSILLATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGKAITFVSQYDVELFQRI 373          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Xenopus
Match: mki67 (marker of proliferation Ki-67 [Source:Xenbase;Acc:XB-GENE-6457930])

HSP 1 Score: 153.68 bits (387), Expect = 4.158e-40
Identity = 103/328 (31.40%), Postives = 169/328 (51.52%), Query Frame = 1
Query:  484 QHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKE---CPMIIDTTIDVAQLSQWKILCPTQEDKDTRLYWFLKNHQGRT-IVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKL 1455
            Q +Y LVLTPTRELA Q+++  +       ++   I GG+    Q   L ++P +V+ TPGR    +++     L A  L  LV+DEADRIL      EV            D+ +  +P + R+T +FSAT+T       V+K                  +++  +K+   C  +      V +L Q+ +  P++  KD+ L + L    G + ++F ++ N+ +R+  +L+ LG +   L+  M Q  RL  L  F     S+L+A+DVA+RGLDIP +D VI+FD+   ++ ++HR GRTARA  SG +I  +S  ++  F ++
Sbjct:   63 QRLYALVLTPTRELAFQISEQFEALGSTIGVKSAVIVGGIDMMSQSLALAKKPHVVIATPGRLIDHLENTKGFNLRA--LKYLVMDEADRILNMDFETEV------------DKILKVIP-RDRKTFLFSATMT-----KKVQK------------------LQRAALKDPVKCA-VSSKYQTVEKLQQFYVFIPSK-FKDSYLVYILNELAGNSFMIFCSTCNNTQRVALLLRNLGFTAIPLHGQMSQNKRLGSLNKFKAKSRSILLATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGKAITFVSQYDVELFQRI 350          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Mouse
Match: Ddx24 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 24 [Source:MGI Symbol;Acc:MGI:1351337])

HSP 1 Score: 298.516 bits (763), Expect = 3.524e-90
Identity = 172/430 (40.00%), Postives = 259/430 (60.23%), Query Frame = 1
Query:  358 DQCDLSPSESELEFAWNDDEIKPELFTGVEMCRIKEDNC--------KPYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKP-RQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTID---VAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSES-DVKDIQIKNIEYYEEVVKLAREIESQSHVTKTVVNNRNWFEK 1608
            D     PS  E +     +E   E F   +  ++K++ C         P + + GLVLTPTRELA QV  H+    +FT +    + GGMS ++Q+R+L R PEIV+ TPGR W  ++++ PH  +  +L  LVIDEADR++EKGHFAE+   +           +N     P RQTLVFSATLT VH A A +   KK   K+ K  KL   ++K+GM+  P +ID T +   V  L++ KI C T E KD  LY+FL  + GR++VFANS + ++RL+ +L+ L + P +L+A M QK RL+ LE F++ ++ +L+A+DVAARGLDIP++  VIH+ V  T+E ++HRSGRTARA + G S++++ P ++  F K+  +LQK E   +  +Q K ++  +E ++LAR+IE   +       + +W E+
Sbjct:  336 DDAGEGPSSLEEKPVPKQNEDGEEKFDAEQAGKLKQELCDQIAIYKVHPRRPLLGLVLTPTRELAIQVRQHIDAVAKFTGINTAILVGGMSTQKQQRMLNRHPEIVIATPGRLWELVKEKHPHLSNLRQLRCLVIDEADRMVEKGHFAELSQLLE---------MLNDSQYNPSRQTLVFSATLTLVHQAPA-RILHKKHVKKMDKTDKLDLLMQKVGMRGKPKVIDLTRNEGTVETLTETKIHCETDE-KDLYLYYFLMQYPGRSLVFANSISCIKRLSGLLKVLDVMPLTLHACMHQKQRLRNLEQFARLQDCVLLATDVAARGLDIPKVQHVIHYQVPRTSEIYIHRSGRTARAASEGLSLMLIGPEDVINFKKIYKTLQKDEDIPLFPVQSKYMDVVKERIRLARQIEKAEYRNFQACLHNSWIEQ 754          

HSP 2 Score: 64.3142 bits (155), Expect = 4.048e-10
Identity = 37/66 (56.06%), Postives = 50/66 (75.76%), Query Frame = 1
Query:   70 LNNWKNLYIPEPVLKAIEKEGFLKPTQIQTLVLPCAIRDRMDILXXXXXXXXXXLAFGIPMISRIL 267
            ++ W++L++P+ VL+A+   GF  PT IQ L L  AIRD++DILGAA TG+GKTLAF IPMI  +L
Sbjct:  192 VSAWRDLFVPKAVLRALSFLGFSAPTPIQALTLAPAIRDKLDILGAAETGSGKTLAFAIPMIHSVL 257          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Mouse
Match: Ddx24 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 24 [Source:MGI Symbol;Acc:MGI:1351337])

HSP 1 Score: 299.286 bits (765), Expect = 5.973e-90
Identity = 172/430 (40.00%), Postives = 259/430 (60.23%), Query Frame = 1
Query:  358 DQCDLSPSESELEFAWNDDEIKPELFTGVEMCRIKEDNC--------KPYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKP-RQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTID---VAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSES-DVKDIQIKNIEYYEEVVKLAREIESQSHVTKTVVNNRNWFEK 1608
            D     PS  E +     +E   E F   +  ++K++ C         P + + GLVLTPTRELA QV  H+    +FT +    + GGMS ++Q+R+L R PEIV+ TPGR W  ++++ PH  +  +L  LVIDEADR++EKGHFAE+   +           +N     P RQTLVFSATLT VH A A +   KK   K+ K  KL   ++K+GM+  P +ID T +   V  L++ KI C T E KD  LY+FL  + GR++VFANS + ++RL+ +L+ L + P +L+A M QK RL+ LE F++ ++ +L+A+DVAARGLDIP++  VIH+ V  T+E ++HRSGRTARA + G S++++ P ++  F K+  +LQK E   +  +Q K ++  +E ++LAR+IE   +       + +W E+
Sbjct:  336 DDAGEGPSSLEEKPVPKQNEDGEEKFDAEQAGKLKQELCDQIAIYKVHPRRPLLGLVLTPTRELAIQVRQHIDAVAKFTGINTAILVGGMSTQKQQRMLNRHPEIVIATPGRLWELVKEKHPHLSNLRQLRCLVIDEADRMVEKGHFAELSQLLE---------MLNDSQYNPSRQTLVFSATLTLVHQAPA-RILHKKHVKKMDKTDKLDLLMQKVGMRGKPKVIDLTRNEGTVETLTETKIHCETDE-KDLYLYYFLMQYPGRSLVFANSISCIKRLSGLLKVLDVMPLTLHACMHQKQRLRNLEQFARLQDCVLLATDVAARGLDIPKVQHVIHYQVPRTSEIYIHRSGRTARAASEGLSLMLIGPEDVINFKKIYKTLQKDEDIPLFPVQSKYMDVVKERIRLARQIEKAEYRNFQACLHNSWIEQ 754          

HSP 2 Score: 64.3142 bits (155), Expect = 4.230e-10
Identity = 37/66 (56.06%), Postives = 50/66 (75.76%), Query Frame = 1
Query:   70 LNNWKNLYIPEPVLKAIEKEGFLKPTQIQTLVLPCAIRDRMDILXXXXXXXXXXLAFGIPMISRIL 267
            ++ W++L++P+ VL+A+   GF  PT IQ L L  AIRD++DILGAA TG+GKTLAF IPMI  +L
Sbjct:  192 VSAWRDLFVPKAVLRALSFLGFSAPTPIQALTLAPAIRDKLDILGAAETGSGKTLAFAIPMIHSVL 257          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Mouse
Match: Ddx24 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 24 [Source:MGI Symbol;Acc:MGI:1351337])

HSP 1 Score: 298.516 bits (763), Expect = 3.078e-89
Identity = 172/430 (40.00%), Postives = 259/430 (60.23%), Query Frame = 1
Query:  358 DQCDLSPSESELEFAWNDDEIKPELFTGVEMCRIKEDNC--------KPYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKP-RQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTID---VAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSES-DVKDIQIKNIEYYEEVVKLAREIESQSHVTKTVVNNRNWFEK 1608
            D     PS  E +     +E   E F   +  ++K++ C         P + + GLVLTPTRELA QV  H+    +FT +    + GGMS ++Q+R+L R PEIV+ TPGR W  ++++ PH  +  +L  LVIDEADR++EKGHFAE+   +           +N     P RQTLVFSATLT VH A A +   KK   K+ K  KL   ++K+GM+  P +ID T +   V  L++ KI C T E KD  LY+FL  + GR++VFANS + ++RL+ +L+ L + P +L+A M QK RL+ LE F++ ++ +L+A+DVAARGLDIP++  VIH+ V  T+E ++HRSGRTARA + G S++++ P ++  F K+  +LQK E   +  +Q K ++  +E ++LAR+IE   +       + +W E+
Sbjct:  382 DDAGEGPSSLEEKPVPKQNEDGEEKFDAEQAGKLKQELCDQIAIYKVHPRRPLLGLVLTPTRELAIQVRQHIDAVAKFTGINTAILVGGMSTQKQQRMLNRHPEIVIATPGRLWELVKEKHPHLSNLRQLRCLVIDEADRMVEKGHFAELSQLLE---------MLNDSQYNPSRQTLVFSATLTLVHQAPA-RILHKKHVKKMDKTDKLDLLMQKVGMRGKPKVIDLTRNEGTVETLTETKIHCETDE-KDLYLYYFLMQYPGRSLVFANSISCIKRLSGLLKVLDVMPLTLHACMHQKQRLRNLEQFARLQDCVLLATDVAARGLDIPKVQHVIHYQVPRTSEIYIHRSGRTARAASEGLSLMLIGPEDVINFKKIYKTLQKDEDIPLFPVQSKYMDVVKERIRLARQIEKAEYRNFQACLHNSWIEQ 800          

HSP 2 Score: 63.929 bits (154), Expect = 4.872e-10
Identity = 37/66 (56.06%), Postives = 50/66 (75.76%), Query Frame = 1
Query:   70 LNNWKNLYIPEPVLKAIEKEGFLKPTQIQTLVLPCAIRDRMDILXXXXXXXXXXLAFGIPMISRIL 267
            ++ W++L++P+ VL+A+   GF  PT IQ L L  AIRD++DILGAA TG+GKTLAF IPMI  +L
Sbjct:  238 VSAWRDLFVPKAVLRALSFLGFSAPTPIQALTLAPAIRDKLDILGAAETGSGKTLAFAIPMIHSVL 303          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Mouse
Match: Ddx47 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 47 [Source:MGI Symbol;Acc:MGI:1915005])

HSP 1 Score: 154.836 bits (390), Expect = 2.573e-40
Identity = 104/330 (31.52%), Postives = 166/330 (50.30%), Query Frame = 1
Query:  484 QHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTID-----VAQLSQWKILCPTQEDKDTRLYWFLKNHQGRT-IVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKL 1455
            Q ++ LVLTPTRELA Q+++  +       +Q   I GG+ +  Q   L ++P IV+ TPGR    +++     L A  L  LV+DEADRIL      EV            D+ +  +P + R+T +FSAT+T        KK                  V+KL        +   +      V +L Q+ +  P++  KDT L + L    G + ++F ++ N+ +R   +L+ LG +   L+  M Q  RL  L  F     S+L+A+DVA+RGLDIP +D V++FD+   ++ ++HR GRTARA  SG +I  ++  ++  F ++
Sbjct:   91 QRLFALVLTPTRELAFQISEQFEALGSSIGVQCAVIVGGIDSMSQSLALAKKPHIVIATPGRLIDHLENTKGFNLRA--LKYLVMDEADRILNMDFETEV------------DKILKVIP-RDRKTFLFSATMT--------KK------------------VQKLQRAALKNPVKCAVSSKYQTVEKLQQYYLFIPSKF-KDTYLVYILNELAGNSFMIFCSTCNNTQRTALLLRNLGFTAIPLHGQMSQSKRLGSLNKFKAKARSILLATDVASRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITFVTQYDVELFQRI 378          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Mouse
Match: Ddx49 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:MGI Symbol;Acc:MGI:2136689])

HSP 1 Score: 142.51 bits (358), Expect = 6.819e-36
Identity = 106/324 (32.72%), Postives = 164/324 (50.62%), Query Frame = 1
Query:  478 PYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIID---TTIDVAQLSQWKILCPTQEDKDTRLYWFLKNHQGR-----TIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLS 1425
            PY  I+ LVLTPTRELA Q+ +  +   +   L+ C I GGM    Q   L R+P +V+ TPGR    ++  +    +  K+  LV+DEADR+LE+G      +F   ++T      +  VP + RQTL+FSATLT     D +K+                  ++ L   E P   +   T   V QL Q  +L P ++ KD  L   ++  Q +      I+F N+  + + L  +L+       +L++ M+QK R   L  F  +   +LIA+DVA+RGLDIP +  VI+ +     + ++HR GRTARA   G +I +++
Sbjct:   68 PY-GIFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGRLADHLRSSN--TFNMKKIQFLVMDEADRLLEQG----CTDFTTDLET-----ILAAVPAR-RQTLLFSATLT-----DTLKE------------------LQGLATNE-PFFWEAQATVRTVEQLDQRYLLVP-EKVKDAYLVHLVQTFQDQLEDCSIIIFTNTCKTCQILCMMLRKFNFPTVALHSMMKQKERFAALAKFKSSIYRILIATDVASRGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRQGQAITLVT 353          
BLAST of ATP-dependent RNA helicase DDX24 vs. UniProt/SwissProt
Match: sp|Q9GZR7|DDX24_HUMAN (ATP-dependent RNA helicase DDX24 OS=Homo sapiens OX=9606 GN=DDX24 PE=1 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 1.582e-92
Identity = 176/432 (40.74%), Postives = 274/432 (63.43%), Query Frame = 1
Query:  460 KEDNCKPY--QHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKP-RQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTID---VAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSES-DVKDIQIKNIEYYEEVVKLAREIESQSHVTKTVVNNRNWFEKMAEKADIKLDDEIVEKKNAPSKKKTQEFEKKSEALDLKIKYL 1734
            K   CK Y  + + GLVLTPTRELA QV  H+    +FT ++   + GGMS ++Q+R+L RRPEIVV TPGR W  I+++  H  +  +L  LV+DEADR++EKGHFAE+   +           +N     P RQTLVFSATLT VH A A +   KK T K+ K +KL   ++K+GM+  P +ID T +   V  L++ KI C T E KD  LY+FL  + GR++VFANS + ++RL+ +L+ L + P +L+A M QK RL+ LE F++ E+ +L+A+DVAARGLDIP++  VIH+ V  T+E ++HRSGRTARA N G S++++ P ++  F K+  +L+K E   +  +Q K ++  +E ++LAR+IE   +       + +W E+ A   +I+L++++ +   A  +++ +  +K+ + L  ++++L
Sbjct:  376 KSATCKAYPKRPLLGLVLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRMLNRRPEIVVATPGRLWELIKEKHYHLRNLRQLRCLVVDEADRMVEKGHFAELSQLLE---------MLNDSQYNPKRQTLVFSATLTLVHQAPA-RILHKKHTKKMDKTAKLDLLMQKIGMRGKPKVIDLTRNEATVETLTETKIHCETDE-KDFYLYYFLMQYPGRSLVFANSISCIKRLSGLLKVLDIMPLTLHACMHQKQRLRNLEQFARLEDCVLLATDVAARGLDIPKVQHVIHYQVPRTSEIYVHRSGRTARATNEGLSLMLIGPEDVINFKKIYKTLKKDEDIPLFPVQTKYMDVVKERIRLARQIEKSEYRNFQACLHNSWIEQAAAALEIELEEDMYKGGKA-DQQEERRRQKQMKVLKKELRHL 795          

HSP 2 Score: 68.1662 bits (165), Expect = 1.544e-10
Identity = 39/66 (59.09%), Postives = 50/66 (75.76%), Query Frame = 1
Query:   70 LNNWKNLYIPEPVLKAIEKEGFLKPTQIQTLVLPCAIRDRMDILXXXXXXXXXXLAFGIPMISRIL 267
            ++ WK+L++P PVL+A+   GF  PT IQ L L  AIRD++DILGAA TG+GKTLAF IPMI  +L
Sbjct:  191 VSAWKDLFVPRPVLRALSFLGFSAPTPIQALTLAPAIRDKLDILGAAETGSGKTLAFAIPMIHAVL 256          
BLAST of ATP-dependent RNA helicase DDX24 vs. UniProt/SwissProt
Match: sp|Q5RDL2|DDX24_PONAB (ATP-dependent RNA helicase DDX24 OS=Pongo abelii OX=9601 GN=DDX24 PE=2 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 2.916e-92
Identity = 176/432 (40.74%), Postives = 274/432 (63.43%), Query Frame = 1
Query:  460 KEDNCKPY--QHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKP-RQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTID---VAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSES-DVKDIQIKNIEYYEEVVKLAREIESQSHVTKTVVNNRNWFEKMAEKADIKLDDEIVEKKNAPSKKKTQEFEKKSEALDLKIKYL 1734
            K   CK Y  + + GLVLTPTRELA QV  H+    +FT ++   + GGMS ++Q+R+L RRPEIVV TPGR W  I+++  H  +  +L  LV+DEADR++EKGHFAE+   +           +N     P RQTLVFSATLT VH A A +   KK T K+ K +KL   ++K+GM+  P +ID T +   V  L++ KI C T E KD  LY+FL  + GR++VFANS + ++RL+ +L+ L + P +L+A M QK RL+ LE F++ E+ +L+A+DVAARGLDIP++  VIH+ V  T+E ++HRSGRTARA N G S++++ P ++  F K+  +L+K E   +  +Q K ++  +E ++LAR+IE   +       + +W E+ A   +I+L++++ +   A  +++ +  +K+ + L  ++++L
Sbjct:  376 KSATCKTYPKRPLLGLVLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRMLNRRPEIVVATPGRLWELIKEKHYHLRNLRQLRCLVVDEADRMVEKGHFAELSQLLE---------MLNDSQYNPKRQTLVFSATLTLVHQAPA-RILHKKHTKKMDKTAKLDLLMQKIGMRGKPKVIDLTRNEATVETLTETKIHCETDE-KDFYLYYFLMQYPGRSLVFANSISCIKRLSGLLKVLDIMPLTLHACMHQKQRLRNLEQFARLEDCVLLATDVAARGLDIPKVQHVIHYQVPRTSEIYVHRSGRTARATNEGLSLMLIGPEDVINFKKIYKTLKKDEDIPLFPVQTKYMDVVKERIRLARQIEKSEYRNFQACLHNSWIEQAAAALEIELEEDMYKGGKA-DQQEERRRQKQMKVLKKELRHL 795          

HSP 2 Score: 68.1662 bits (165), Expect = 1.849e-10
Identity = 39/66 (59.09%), Postives = 50/66 (75.76%), Query Frame = 1
Query:   70 LNNWKNLYIPEPVLKAIEKEGFLKPTQIQTLVLPCAIRDRMDILXXXXXXXXXXLAFGIPMISRIL 267
            ++ WK+L++P PVL+A+   GF  PT IQ L L  AIRD++DILGAA TG+GKTLAF IPMI  +L
Sbjct:  191 VSAWKDLFVPRPVLRALSFLGFSAPTPIQVLTLAPAIRDKLDILGAAETGSGKTLAFAIPMIHAVL 256          
BLAST of ATP-dependent RNA helicase DDX24 vs. UniProt/SwissProt
Match: sp|Q9ESV0|DDX24_MOUSE (ATP-dependent RNA helicase DDX24 OS=Mus musculus OX=10090 GN=Ddx24 PE=1 SV=2)

HSP 1 Score: 299.286 bits (765), Expect = 4.178e-89
Identity = 172/430 (40.00%), Postives = 259/430 (60.23%), Query Frame = 1
Query:  358 DQCDLSPSESELEFAWNDDEIKPELFTGVEMCRIKEDNC--------KPYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKP-RQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTID---VAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSES-DVKDIQIKNIEYYEEVVKLAREIESQSHVTKTVVNNRNWFEK 1608
            D     PS  E +     +E   E F   +  ++K++ C         P + + GLVLTPTRELA QV  H+    +FT +    + GGMS ++Q+R+L R PEIV+ TPGR W  ++++ PH  +  +L  LVIDEADR++EKGHFAE+   +           +N     P RQTLVFSATLT VH A A +   KK   K+ K  KL   ++K+GM+  P +ID T +   V  L++ KI C T E KD  LY+FL  + GR++VFANS + ++RL+ +L+ L + P +L+A M QK RL+ LE F++ ++ +L+A+DVAARGLDIP++  VIH+ V  T+E ++HRSGRTARA + G S++++ P ++  F K+  +LQK E   +  +Q K ++  +E ++LAR+IE   +       + +W E+
Sbjct:  336 DDAGEGPSSLEEKPVPKQNEDGEEKFDAEQAGKLKQELCDQIAIYKVHPRRPLLGLVLTPTRELAIQVRQHIDAVAKFTGINTAILVGGMSTQKQQRMLNRHPEIVIATPGRLWELVKEKHPHLSNLRQLRCLVIDEADRMVEKGHFAELSQLLE---------MLNDSQYNPSRQTLVFSATLTLVHQAPA-RILHKKHVKKMDKTDKLDLLMQKVGMRGKPKVIDLTRNEGTVETLTETKIHCETDE-KDLYLYYFLMQYPGRSLVFANSISCIKRLSGLLKVLDVMPLTLHACMHQKQRLRNLEQFARLQDCVLLATDVAARGLDIPKVQHVIHYQVPRTSEIYIHRSGRTARAASEGLSLMLIGPEDVINFKKIYKTLQKDEDIPLFPVQSKYMDVVKERIRLARQIEKAEYRNFQACLHNSWIEQ 754          

HSP 2 Score: 64.3142 bits (155), Expect = 2.959e-9
Identity = 37/66 (56.06%), Postives = 50/66 (75.76%), Query Frame = 1
Query:   70 LNNWKNLYIPEPVLKAIEKEGFLKPTQIQTLVLPCAIRDRMDILXXXXXXXXXXLAFGIPMISRIL 267
            ++ W++L++P+ VL+A+   GF  PT IQ L L  AIRD++DILGAA TG+GKTLAF IPMI  +L
Sbjct:  192 VSAWRDLFVPKAVLRALSFLGFSAPTPIQALTLAPAIRDKLDILGAAETGSGKTLAFAIPMIHSVL 257          
BLAST of ATP-dependent RNA helicase DDX24 vs. UniProt/SwissProt
Match: sp|A3AVH5|RH13_ORYSJ (DEAD-box ATP-dependent RNA helicase 13 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0510400 PE=2 SV=2)

HSP 1 Score: 273.478 bits (698), Expect = 9.382e-80
Identity = 191/561 (34.05%), Postives = 295/561 (52.58%), Query Frame = 1
Query:   55 MANDILNNWKNLYIPEPVLKAIEKEGFLKPTQIQTLVLPCAIRDRMDILXXXXXXXXXXLAFGIPMISRILMDKQKEIDIYKDXXXXXXXXXXXXXXXXXXDQCDLSPSESELEFAWNDDEIKPELFTGVEMCRIKEDNCKPYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMK-TNAGDRFING-------VP---MKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLG----MKECPMIIDTT---IDVAQLSQWKILCPTQEDKDTRLYWFLKNH-QGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSESDVKDIQIKNIEYYEEVVKLAREIESQSHVTKTVVNNRNWFEKMAEKADIKLDDEIVEKKNAPSKKK 1680
            +  D +  W+ L +   ++ A+ + GF +PT IQ    P A     D++GAA TG+GKTLAFG+P++ R+L +++K + + +++   +                D +  ES L                                   L+LTPTRELA QV DHLK+A +F  +QV  I GG+S E+QERLLKR+PEIVV TPGR W  +   + H +    LS  V+DEADR++E+GHF E+++ +  +  TN  D    G       VP   +K RQT VFSATL    SA+  KK  + L +     S   + +E L     MK    I+D T   I   +L +  I C + +DKD  LY+ L  H QGRTI+F  S  ++R L+S+L+ LG++  + +A MQQ+ R+K ++ F ++ENS+L+A+D  ARG+D   +  VIH+ + H+ + ++HRSGRTAR   +G SI ++SP +  +F  L  SL K       +    +      + LAR+I+  +        N++W ++ AE   + L+    E++     K+
Sbjct:  192 LGEDEVYAWRELRLHPLLITAVRRLGFKEPTPIQKACFPAAAHQGKDVIGAAETGSGKTLAFGLPILQRLLEEQEKAMRLSREDESTQ----------------DENSRESPLR---------------------------------ALILTPTRELAKQVCDHLKEAAKFLRIQVVPIVGGLSMEKQERLLKRKPEIVVGTPGRLWELMSTGNQHLIKLHSLSFFVLDEADRMIERGHFHELQSIIEMLPVTNGSDEQTVGTTPSCETVPILQIKKRQTFVFSATLAL--SANFRKKLKRGLVTAKASASTDLSSIEALSKQARMKPNAEIVDLTKASILPEKLEESFIEC-SDDDKDAYLYYILSVHGQGRTIIFCTSIAALRHLSSILRVLGINVLTNHAQMQQRARMKAVDRFRESENSILVATDGFARGMDFDDVRTVIHYQLPHSTDVYIHRSGRTARKSMAGCSIALISPADKAKFYSLCKSLSKENLQQFPVDHAYMPAVMNRLTLARQIDKITRKNSQENANKSWLQRNAESMGLLLETSDSEEERVQGHKQ 700          
BLAST of ATP-dependent RNA helicase DDX24 vs. UniProt/SwissProt
Match: sp|A2XVF7|RH13_ORYSI (DEAD-box ATP-dependent RNA helicase 13 OS=Oryza sativa subsp. indica OX=39946 GN=OsI_016050 PE=3 SV=2)

HSP 1 Score: 273.478 bits (698), Expect = 9.382e-80
Identity = 191/561 (34.05%), Postives = 295/561 (52.58%), Query Frame = 1
Query:   55 MANDILNNWKNLYIPEPVLKAIEKEGFLKPTQIQTLVLPCAIRDRMDILXXXXXXXXXXLAFGIPMISRILMDKQKEIDIYKDXXXXXXXXXXXXXXXXXXDQCDLSPSESELEFAWNDDEIKPELFTGVEMCRIKEDNCKPYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMK-TNAGDRFING-------VP---MKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLG----MKECPMIIDTT---IDVAQLSQWKILCPTQEDKDTRLYWFLKNH-QGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSESDVKDIQIKNIEYYEEVVKLAREIESQSHVTKTVVNNRNWFEKMAEKADIKLDDEIVEKKNAPSKKK 1680
            +  D +  W+ L +   ++ A+ + GF +PT IQ    P A     D++GAA TG+GKTLAFG+P++ R+L +++K + + +++   +                D +  ES L                                   L+LTPTRELA QV DHLK+A +F  +QV  I GG+S E+QERLLKR+PEIVV TPGR W  +   + H +    LS  V+DEADR++E+GHF E+++ +  +  TN  D    G       VP   +K RQT VFSATL    SA+  KK  + L +     S   + +E L     MK    I+D T   I   +L +  I C + +DKD  LY+ L  H QGRTI+F  S  ++R L+S+L+ LG++  + +A MQQ+ R+K ++ F ++ENS+L+A+D  ARG+D   +  VIH+ + H+ + ++HRSGRTAR   +G SI ++SP +  +F  L  SL K       +    +      + LAR+I+  +        N++W ++ AE   + L+    E++     K+
Sbjct:  192 LGEDEVYAWRELRLHPLLITAVRRLGFKEPTPIQKACFPAAAHQGKDVIGAAETGSGKTLAFGLPILQRLLEEQEKAMRLSREDESTQ----------------DENSRESPLR---------------------------------ALILTPTRELAKQVCDHLKEAAKFLRIQVVPIVGGLSMEKQERLLKRKPEIVVGTPGRLWELMSTGNQHLIKLHSLSFFVLDEADRMIERGHFHELQSIIEMLPVTNGSDEQTVGTTPSCETVPILQIKKRQTFVFSATLAL--SANFRKKLKRGLVTAKASASTDLSSIEALSKQARMKPNAEIVDLTKASILPEKLEESFIEC-SDDDKDAYLYYILSVHGQGRTIIFCTSIAALRHLSSILRVLGINVLTNHAQMQQRARMKAVDRFRESENSILVATDGFARGMDFDDVRTVIHYQLPHSTDVYIHRSGRTARKSMAGCSIALISPADKAKFYSLCKSLSKENLQQFPVDHAYMPAVMNRLTLARQIDKITRKNSQENANKSWLQRNAESMGLLLETSDSEEERVQGHKQ 700          
BLAST of ATP-dependent RNA helicase DDX24 vs. TrEMBL
Match: A0A4W6FC87 (DEAD (Asp-Glu-Ala-Asp) box helicase 24 OS=Lates calcarifer OX=8187 PE=3 SV=1)

HSP 1 Score: 360.147 bits (923), Expect = 1.169e-110
Identity = 230/549 (41.89%), Postives = 329/549 (59.93%), Query Frame = 1
Query:   61 NDILNNWKNLYIPEPVLKAIEKEGFLKPTQIQTLVLPCAIRDRMDILXXXXXXXXXXLAFGIPMISRILMDKQKEIDIYKDXXXXXXXXXXXXXXXXXXDQCDLSPSESELEF--------AWNDDEIKPELFTGVEMCRIKEDNCKPY------------QHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKP-RQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTT---IDVAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSES-DVKDIQIKNIEYYEEVVKLAREIES-QSHVTKTVVNNRNWFEKMAEKADI 1629
            N  ++ WK+L++P  VLKA+   GF  PT IQ L LP AIRDRMDILGAA TG+GKTLAFGIPMI  IL  K+                    S+   +D C+L+   +E+E         A  DDE + E    V++    E +  P             Q + GLVLTPTRELA QV  H+    +FTD++   + GGM+ ++Q R+LKRRP+I++ TPGR W  I+++ PH L+  +L  LVIDEADR++E+GHFAE+E+ +           +N V   P RQT VFSATLT  HS     + ++K    L + +KL   +EK+G+K  P IID T     V  L++ +I C  +E+KD  LY+FL  + GRT+VFANS + ++RL S+L  L  +P  L+A+M QK RLK LE F++ E+ +L+ +DVAARGLDIP +  VIH+ V  T+ET++HRSGRTARA   G S++++ P++M  F K+  +L K E   +  I+ K +E  +E V LAR+IE  + H ++   +N +W ++ AE  ++
Sbjct:  133 NTDVSAWKDLFVPFAVLKALSSLGFSSPTPIQALALPPAIRDRMDILGAAETGSGKTLAFGIPMIHTILEWKK-------------------GSDKPVSDNCELT---TEVERGPGGQCGDASEDDEGEDERLGCVQVIENAEFDFGPAAEAEEESAGGQNQPLLGLVLTPTRELAVQVKHHIDAVAKFTDIKTAIVVGGMAQQKQRRMLKRRPQIIIATPGRLWDLIKERHPHLLNLRQLRCLVIDEADRMVERGHFAELESLLE---------MLNTVHFNPTRQTFVFSATLTMAHSLPT--RLLQKKKKNLDQRNKLEILMEKVGIKSKPKIIDLTRKEATVETLTETRIHC-QKEEKDFYLYYFLLQYPGRTMVFANSIDCIKRLNSLLVILDCTPLPLHANMHQKQRLKNLERFAERESCVLLTTDVAARGLDIPNVQHVIHYQVPRTSETYVHRSGRTARATKEGLSLLLIGPDDMMNFRKIYKTLGKDEELPMFPIETKCMEAIKERVNLARKIEKIEFHNSREKQHN-SWLKQAAEALEV 646          
BLAST of ATP-dependent RNA helicase DDX24 vs. TrEMBL
Match: A0A0L8IDB5 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22015589mg PE=3 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 2.938e-110
Identity = 222/552 (40.22%), Postives = 323/552 (58.51%), Query Frame = 1
Query:   70 LNNWKNLYIPEPVLKAIEKEGFLKPTQIQTLVLPCAIRDRMDILXXXXXXXXXXLAFGIPMISRILMDKQKEIDIYKDXXXXXXXXXXXXXXXXXXDQCDLSPSESELEFAWNDDE----------------------IKPELFTGVEMCRIKEDNCKPYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIID---TTIDVAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSESDVKDIQIKN--IEYYEEVVKLAREIESQSHVTKTVVNNRNWFEKMAEKADIKLDDE 1644
            +  W +L +PE VL+AI ++GF +PT IQ   L  AI  + DI+GAAATG+GKTLAFGIP++  I+ D++  I   K E +E   +    S     +    S  E+E     ND++                       +  +F   E  +I ED+      +  L+LTPTRELA QV +HL    ++T ++V AI GGMS +RQER+LK++P I+V TPGR W   + ++P+ L+   +  LVIDEADR++EKGHF E++  ++ +      R  + +  K RQT +FSATLT  H     K   K   + LT   K+   + K+G+K+   ++D    T    +LS+ K+LC  +E KD  LY+FLK H GRT+VF NSK+ +RRL S+   L   P  L++DM QK RLK LE FS   N+LL+A+D+AARGLDIP+ID VIHF V HT E ++HRSGRTARA   G +++++SP E   + K+L+SL +++ D     + N  I      ++LA +I+++ H      +  NWF K AE+ DI+LD+E
Sbjct:   18 MGAWAHLPVPELVLQAIAEQGFTQPTPIQNECLIPAIEYKQDIIGAAATGSGKTLAFGIPILYNIMEDEK--IKASKSEKLETDNENNESSLAPGKEDEGKSSDENEALETDNDNQNVEINVTATNRELLEDEVEDDDDEDSVFKKFEESQIPEDDG-----LKALILTPTRELAVQVKNHLVAVAKYTKIKVVAIIGGMSEQRQERILKKQPHIIVATPGRLWELYEKRNPYILTVKNIQYLVIDEADRMVEKGHFEELQKLLSML------RHFSKMTQKRRQTFLFSATLTLAHIGPQRKLSRKFQANLLTTEGKIRMMMYKMGLKKGAKMVDLTEKTRTAEKLSEAKVLC-EREKKDVYLYYFLKQHLGRTLVFCNSKDCIRRLVSIFTLLECHPLPLHSDMHQKQRLKNLERFSSNPNALLLATDIAARGLDIPKIDHVIHFQVPHTVENYIHRSGRTARASQEGLTVLLISPEEQKGYRKILYSLNRTK-DFDQFPVDNSYIPAINARMQLALKIDTEEHRFDKKKHENNWFRKTAEEMDIELDEE 554          
BLAST of ATP-dependent RNA helicase DDX24 vs. TrEMBL
Match: A0A3Q1CQA7 (DEAD (Asp-Glu-Ala-Asp) box helicase 24 OS=Amphiprion ocellaris OX=80972 PE=4 SV=1)

HSP 1 Score: 361.303 bits (926), Expect = 9.256e-110
Identity = 234/554 (42.24%), Postives = 335/554 (60.47%), Query Frame = 1
Query:   61 NDILNNWKNLYIPEPVLKAIEKEGFLKPTQIQTLVLPCAIRDRMDILXXXXXXXXXXLAFGIPMISRILMDK---QKEIDIYKDXXXXXXXXX--XXXXXXXXXDQCD-LSPSESELEFAWNDDEIKPE---------------LFTGVEMCRIKEDNC--KPY----QHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTT---IDVAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSES-DVKDIQIKNIEYYEEVVKLAREIESQSHVTKTVVNNRNWFEKMAEKADI 1629
            N  ++ WK+L++P PVL A+   GF  PT IQ LVLP AIRDRMDILGAA TG+GKTLAFGIPMI  IL  K   ++ +D   +   + +     ++D    E DQ D +  SE E E A  +D+IK +               L   V      E N   KP     Q + GLVLTPTRELA QV  H+    +FTD++   + GGM+ ++Q R+LKRRPEI++ TPGR W  I+++ PH L+  +L  LVIDEADR++E+GHFAE+E+ +  + T       N      RQT VFSATLT  HS     + ++K    L K SKL   +EK+G+K  P +ID T     V  L++ +I C  +++KD  LY+FL  + GRT+VFANS + ++RL ++L  L ++P  L+A+M QK RLK LE F++ E+ +L+ +DVAARGLDIP +  VIH+ V  T+ET++HRSGRTARA   G S++++ P++M  F K+  +L K E   +  I+ K ++  +E V LAR+IE+  +       + +WF++ AE  ++
Sbjct:  240 NTDVSAWKDLFVPSPVLNALSSLGFGSPTPIQALVLPPAIRDRMDILGAAETGSGKTLAFGIPMIHTILEWKNSPEQTVDENTEPPAKVASLYLPDVDEATAEEDQEDNVEASEEEDEGA--EDQIKEDSDKDGSAREETAEDDLLGCVPQIETAEFNSDEKPAGGQNQPLLGLVLTPTRELAVQVKHHIDAVAKFTDIKTAIVVGGMAQQKQRRMLKRRPEIIIATPGRLWDLIKERHPHLLNLRQLKCLVIDEADRMVERGHFAELESLLEMLSTT----HFNPT----RQTFVFSATLTMAHSLPT--RLLQKKKKTLDKRSKLEILMEKVGIKSKPKVIDLTRKEATVETLTETQIHC-QKDEKDFYLYYFLLQYPGRTMVFANSIDCIKRLNTLLVILDITPLPLHANMHQKQRLKNLERFAERESCVLLTTDVAARGLDIPNVQHVIHYQVPRTSETYVHRSGRTARATKEGLSLLLIGPDDMMNFKKIYKTLGKDEELPMFPIETKCMDAIKERVNLARKIENFEYHNSREKQHNSWFKQAAEALEV 780          
BLAST of ATP-dependent RNA helicase DDX24 vs. TrEMBL
Match: G1KHY9 (DEAD-box helicase 24 OS=Anolis carolinensis OX=28377 GN=DDX24 PE=4 SV=1)

HSP 1 Score: 358.607 bits (919), Expect = 1.631e-109
Identity = 230/577 (39.86%), Postives = 339/577 (58.75%), Query Frame = 1
Query:   70 LNNWKNLYIPEPVLKAIEKEGFLKPTQIQTLVLPCAIRDRMDILXXXXXXXXXXLAFGIPMISRIL-------MDKQKEIDIYKDXXXXXXXXXXXXXXXXXXDQCDLSPSESELEFAWNDDEIKPELFTGVEMC-RIKEDNCKPYQH--------IYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKP-RQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTT---IDVAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSES-DVKDIQIKNIEYYEEVVKLAREIESQSHVTKTVVNNRNWFEKMAEKADIKL-DDEIVEKKNAPSKKKTQEFEKKSEALDLKIKYL 1734
            ++ WK L++P+PVL+A+ + GF  PT IQ L LP AIRD MD+LGAA TG+GKTLAF IPMI  IL       + K  +I +          + E+  E    D   LS +E+      + + +       V +C +  ED   P           + GLVLTPTRELA QV  H+    ++T ++   + GGM+ ++Q+R+LKR+PEIV+ TPGR W  IQ++ PH  S  +L  LVIDEADR++EKGHF E+   +           +N     P RQT VFSATLT +H A A   Q KK   ++ K +KL   ++K+GMK  P +ID T     V  L++ +I C T E+KD  LY+FL  + GRT+VFANS + ++RLT++L  L  +P  L+A+M QK RLK LE F++  ++ L+ +DVAARGLDIP +  VIH+ V  T+E ++HRSGRTARA N G S++++ P++M  F ++  +L+KSE      ++ K +   +E V LAR+IE   +       + +W ++ AE  +  L DDE++  K  PS+++  E +K  + +   +K+L
Sbjct:  189 ISAWKGLFVPKPVLQALSELGFSAPTPIQALALPSAIRDSMDVLGAAETGSGKTLAFAIPMIHSILQWYKSRGLPKGSKIQL----EDGGDSEEELSKEEASEDIGGLSSAEANCAAISSVESL-------VTLCEKASEDGDHPKHDTVGERSNPLLGLVLTPTRELAVQVKHHIDAVTRYTGIKTANLVGGMAPQKQQRILKRKPEIVIATPGRLWELIQEKQPHLSSLKQLRCLVIDEADRMVEKGHFLELSQLLE---------MLNSSQYNPKRQTFVFSATLTLIHQAPARVFQ-KKNAIRIDKKTKLELLMQKVGMKSKPKVIDLTRKEATVETLTETRIHCDT-EEKDYFLYYFLLQYPGRTMVFANSIDCIKRLTALLTILDCNPLPLHANMHQKQRLKSLERFAERNSATLLTTDVAARGLDIPHVQHVIHYQVPRTSELYVHRSGRTARAANEGLSLLLIGPSDMMNFKRIYKTLEKSEELPFFPVETKCMTAIKERVNLARQIEKVEYFNSRAKQHNSWLQQAAEALERDLDDDELIGGK--PSEQEESEKQKMLKGMKKHLKHL 741          
BLAST of ATP-dependent RNA helicase DDX24 vs. TrEMBL
Match: A0A1A8FBC7 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 24 OS=Nothobranchius korthausae OX=1143690 GN=DDX24 PE=3 SV=1)

HSP 1 Score: 356.295 bits (913), Expect = 4.167e-109
Identity = 222/537 (41.34%), Postives = 319/537 (59.40%), Query Frame = 1
Query:   70 LNNWKNLYIPEPVLKAIEKEGFLKPTQIQTLVLPCAIRDRMDILXXXXXXXXXXLAFGIPMISRILMDKQKEIDIYKDXXXXXXXXXXXXXXXXXXDQC-----DLSPSESELE---FAWNDDEIKPELFTGVEMCR-----IKEDNCKPYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTT---IDVAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSESDVK-DIQIKNIEYYEEVVKLAREIESQSHVTKTVVNNRNWFEKMAEKADI 1629
            ++ WK+L++P  VLKA+   GF  PT IQ L LP AIRDRMDILGAA TG+GKTLAFGIPMI  IL  K       +D     + +       +   +      D    E +L+    A ++D  + E    V++        +E      + + GLVLTPTRELA QV  H+    +FTD++   + GGMS  +Q RLLKRRPEI++ TPGR W  I+++ PH ++  +L  LVIDEADR++E+GHFAE+EN +  + T   +          RQT VFSATLT  HS  +  + ++K   +L   SKL   +EK+G+K  P ++D T     V  L++ +I C  +++KD  LY+FL  H GRT+VFANS + ++RLTS+L  L  SP  L+A+M QK RLK LE F++ +N +L+ +DVAARGLDIP +  V H+ V  T+ET++HRSGRTARA   G S +++ P++M  F K+  +L K E   +  ++IK +E  +E V LAR IE   +       + +WF++ A   ++
Sbjct:  213 VSAWKDLFVPPLVLKALSSLGFSSPTPIQALALPSAIRDRMDILGAAETGSGKTLAFGIPMIHTILEWKSGTKRTTEDTGPASTVESLRLPSEDVPTESPNQDSDEDSEEGDLDQTLEASDEDGDENEQLGCVKVIDKVEFDFEEKTDSQSRPLLGLVLTPTRELAVQVKHHIDAITKFTDIKTVVVVGGMSQPKQRRLLKRRPEILIATPGRLWDLIKERHPHLVNLRQLKCLVIDEADRMVERGHFAELENLLEMLNTTHSN--------PTRQTFVFSATLTMAHSLPS--RLLQKKKRRLDSRSKLEILMEKVGIKSKPKVVDLTRKEATVETLTETQIHC-QKDEKDFYLYYFLLCHPGRTMVFANSIDCIKRLTSLLVILDCSPLPLHANMHQKQRLKNLERFAEGKNFVLLTTDVAARGLDIPDVQHVFHYQVPRTSETYVHRSGRTARATKEGLSFLLIGPDDMMNFRKIYKTLGKDEELPEFPVEIKCMEAVKERVNLARSIEKIEYYNSREKQHNSWFKRAAAALEV 738          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Cavefish
Match: ddx24 (DEAD-box helicase 24 [Source:NCBI gene;Acc:103042633])

HSP 1 Score: 315.849 bits (808), Expect = 2.853e-96
Identity = 176/392 (44.90%), Postives = 251/392 (64.03%), Query Frame = 1
Query:  490 IYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKP-RQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTT---IDVAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSES-DVKDIQIKNIEYYEEVVKLAREIESQSHVTKTVVNNRNWFEKMAEKADIKLDDEIV 1650
            + GLVLTPTRELA QV  H+    QFT ++   + GGM+ ++Q+R+LKRRPEIV+ TPGR W  IQD+ PH  +  +L  LVIDEADR++EKGHFAE+E  +  + T+            P RQT VFSATLT VHS  +  +  +K   +L + SKL   +EK+G+K  P IID +     V  L++ KI C  +E+KD  LY+FL  + GRT+VFANS + ++RLTS+L  L  +P  L+A+M QK RLK LE F++ E+ +L+ +DVAARGLDIP +  V+H+ V  T+ET++HRSGRTARA   G S++++ P++M  F K+  +L K E   V  IQ K +   +E V +AR IE   +       + +W  + AE+ DI +DD+++
Sbjct:  399 LLGLVLTPTRELAVQVQHHIDAVAQFTGIKTAILVGGMAPQKQDRVLKRRPEIVIATPGRLWEMIQDRHPHLRNLRQLRCLVIDEADRMVEKGHFAELEKLLEMLSTSQ---------FNPKRQTFVFSATLTMVHSLPS--RLARKKGKQLEQRSKLELLMEKVGIKNKPKIIDLSRKEATVETLTETKIHC-EKEEKDFYLYYFLLQYPGRTMVFANSIDCIKRLTSLLTILDCNPLPLHANMHQKQRLKNLERFAERESCVLLTTDVAARGLDIPDVQHVLHYQVPRTSETYVHRSGRTARAAKEGLSLLLIGPDDMINFKKIYKTLGKDEDLPVFPIQNKCMAAIKERVNVARGIEKIEYHNSRAKQHNSWLRQAAEEMDIDVDDDLL 778          

HSP 2 Score: 79.337 bits (194), Expect = 6.628e-15
Identity = 45/66 (68.18%), Postives = 53/66 (80.30%), Query Frame = 1
Query:   70 LNNWKNLYIPEPVLKAIEKEGFLKPTQIQTLVLPCAIRDRMDILXXXXXXXXXXLAFGIPMISRIL 267
            ++ WK+L++PE VLKA+ K GF  PT IQ L LP AIRD MDILGAA TG+GKTL+FGIPMI RIL
Sbjct:  228 VSAWKDLFVPELVLKALSKLGFSAPTPIQALALPPAIRDHMDILGAAETGSGKTLSFGIPMIHRIL 293          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Cavefish
Match: ddx47 (DEAD-box helicase 47 [Source:NCBI gene;Acc:103034543])

HSP 1 Score: 150.984 bits (380), Expect = 4.903e-39
Identity = 104/329 (31.61%), Postives = 168/329 (51.06%), Query Frame = 1
Query:  484 QHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKE---CPMIID-TTIDVAQLSQWKILCPTQEDKDTRLYWFLKNHQGRT-IVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKL 1455
            Q ++ LVLTPTRELA Q+ +  +       ++   + GG+    Q  +L ++P IV+ TPGR    +++     L A  L  LV+DEADRIL     +EV            D+ +  +P + R T +FSAT+T       V+K                  +++  +K+   C +     T+D  +L Q+ I  P +  KD  L   L    G + ++F  + N+ +R+  +L+ LG++   L+  M Q  RL  L  F     S+L+A+DVA+RGLDIP +D VI+FD+   ++ ++HR GRTARA  SG SI  ++  ++  F ++
Sbjct:   95 QRLHTLVLTPTRELAFQIAEQFEALGSSIGVKTAVVVGGIDMMSQAMVLAKKPHIVIATPGRLIDHLENTKGFNLRA--LRFLVMDEADRILNMDFESEV------------DKILKVIP-RERHTFLFSATMT-----KKVQK------------------LQRAALKDPVKCAVSTKYATVD--KLQQYYIFIPAKY-KDCYLVSILNELAGNSFMIFCGTCNNAQRVALLLRNLGITAIPLHGQMSQNKRLGSLNKFKAKSRSVLLATDVASRGLDIPHVDCVINFDIPTHSKDYIHRVGRTARAGRSGKSITFVTQYDVELFQRI 382          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Cavefish
Match: ddx49 (DEAD-box helicase 49 [Source:NCBI gene;Acc:103043246])

HSP 1 Score: 142.51 bits (358), Expect = 5.271e-36
Identity = 109/334 (32.63%), Postives = 169/334 (50.60%), Query Frame = 1
Query:  478 PYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTIDVA---QLSQWKILCPTQEDKDTRLYWFLKNHQGR-----TIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKL 1455
            PY  I+ LVLTPTRELA Q+ +  +   +   L+ C I GGM    Q   L ++P IVV TPGR    I+  D    +  ++  L++DEADR+LE+G      +F     T   +  ++ VP K RQTL+FSATLT     D +++                  ++ + M E P   +   +V    +L Q  IL P ++ KD  L   ++  Q        ++F N+  + + LT +L+       SL++ M+Q+ R   L  F      +LIA+DVAARGLDIP +  VI+ +     + ++HR GRTARA  +G SI +++  ++   N +
Sbjct:   68 PY-GIFCLVLTPTRELAYQIAEQFRALGKPLGLRDCIIVGGMDMVAQGLELSKKPHIVVATPGRLADHIRSSD--TFNMKRIKFLILDEADRLLEQG----CTDF-----TKDLEVILSVVPAK-RQTLLFSATLT-----DTLQE------------------LKTIAMNE-PFFWENKSEVRTVDELDQRYILTP-EKVKDAYLVHLIQKIQDEHDDWSVMIFTNTCKNCQILTMMLREFKFPAISLHSMMKQRQRFANLAKFKSNVFKILIATDVAARGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRNGVSITLVTQYDIHLVNAI 363          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Cavefish
Match: ddx27 (DEAD-box helicase 27 [Source:NCBI gene;Acc:103032272])

HSP 1 Score: 133.265 bits (334), Expect = 4.882e-32
Identity = 95/317 (29.97%), Postives = 159/317 (50.16%), Query Frame = 1
Query:  499 LVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKE-CPMIIDTTIDVAQL--SQWKILCPTQE-DKDTRLYWFL-KNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNE 1434
            LVL PTREL  QV    ++  QFT +  C   GG+  + QE  L+  P+I++ TPGR    + +     LS  ++ +L++DEADR+L+       E F   MK       I  +    RQT++FSAT++     + VK                   +  + +K+   + +++  DVA     ++  + P +E D++  +   L +  Q   ++F  +K    R+  +L  +GL    L+ ++ Q  RL+ L  F   +  +L+A+DVAARGLDI  +  VI+F + +T + ++HR GRTARA   G S+ ++   E
Sbjct:  241 LVLVPTRELGIQVHSVARQLSQFTTISTCLAVGGLDLKSQEAALRAGPDILIATPGRLIDHLHNTPSFELS--QIEVLILDEADRMLD-------EYFEEQMKE------IIRLCAYQRQTMLFSATMS-----EEVKD------------------LASVSLKQPVRIFVNSNTDVAPYLRQEFVRIRPAREGDREAIVAALLTRTFQDHVMLFTQTKKQAHRMHILLGLMGLKVGELHGNLSQTQRLESLRRFKDEQIDILVATDVAARGLDIEGVKTVINFTMPNTVKHYVHRVGRTARAGKVGRSVSLVGETE 519          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Cavefish
Match: ddx27 (DEAD-box helicase 27 [Source:NCBI gene;Acc:103032272])

HSP 1 Score: 133.265 bits (334), Expect = 5.745e-32
Identity = 95/317 (29.97%), Postives = 159/317 (50.16%), Query Frame = 1
Query:  499 LVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKE-CPMIIDTTIDVAQL--SQWKILCPTQE-DKDTRLYWFL-KNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNE 1434
            LVL PTREL  QV    ++  QFT +  C   GG+  + QE  L+  P+I++ TPGR    + +     LS  ++ +L++DEADR+L+       E F   MK       I  +    RQT++FSAT++     + VK                   +  + +K+   + +++  DVA     ++  + P +E D++  +   L +  Q   ++F  +K    R+  +L  +GL    L+ ++ Q  RL+ L  F   +  +L+A+DVAARGLDI  +  VI+F + +T + ++HR GRTARA   G S+ ++   E
Sbjct:  271 LVLVPTRELGIQVHSVARQLSQFTTISTCLAVGGLDLKSQEAALRAGPDILIATPGRLIDHLHNTPSFELS--QIEVLILDEADRMLD-------EYFEEQMKE------IIRLCAYQRQTMLFSATMS-----EEVKD------------------LASVSLKQPVRIFVNSNTDVAPYLRQEFVRIRPAREGDREAIVAALLTRTFQDHVMLFTQTKKQAHRMHILLGLMGLKVGELHGNLSQTQRLESLRRFKDEQIDILVATDVAARGLDIEGVKTVINFTMPNTVKHYVHRVGRTARAGKVGRSVSLVGETE 549          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000613.1 (pep scaffold:Pmarinus_7.0:GL494823:624:4032:1 gene:ENSPMAG00000000552.1 transcript:ENSPMAT00000000613.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 166.392 bits (420), Expect = 1.531e-47
Identity = 88/231 (38.10%), Postives = 141/231 (61.04%), Query Frame = 1
Query:  997 PMIIDTTIDVAQ---LSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKS-ESDVKDIQIKNIEYYEEVVKLAREIESQSHVTKTVVNNRNWFEKMAEKADIKLDDEIVEKKNAPSKK 1677
            P ++D T   A    L + ++ C   +DKD  LY+FL  H GRT+VFANS   V+RL  +L  L      L+A+M QK RLK LE F++ ++ +L+ +DVAARGLDIP ++ VIH+ +  T+ET++HRSGRTARA   G+S+I++ P ++  + K+  +L+   E     +   N+   +  V LAR IE + +      ++ +WF+K A+  DI+L+D+++     PS++
Sbjct:    3 PKVVDLTRREATAETLMESRVHC-DADDKDHYLYYFLLRHPGRTMVFANSIECVKRLAGLLGALACEALPLHANMHQKQRLKNLERFAERQSCVLLTTDVAARGLDIPNVEHVIHYQLPRTSETYVHRSGRTARATREGFSLILVGPGDVPAYRKICRALRGDKELPCFPVDPHNLTAVKARVALARSIEKELYHHSRAQHHNSWFQKAADAMDIELEDDML--MGEPSRR 230          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000216.1 (pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-1 gene:ENSPMAG00000000186.1 transcript:ENSPMAT00000000216.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 155.221 bits (391), Expect = 1.490e-41
Identity = 103/328 (31.40%), Postives = 169/328 (51.52%), Query Frame = 1
Query:  484 QHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTI---DVAQLSQWKILCPTQEDKDTRLYWFLKNHQGRT-IVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKL 1455
            Q ++ LVLTPTRELA Q+++  +       ++   + GG+    Q   L ++P +++ TPGR    +++     + A  L  LV+DEADRIL      EV            D+ +  +P K R+T +FSAT+T       V+K                  +++  +KE P+    +     V +L Q+ +  P +  KD+ L + L    G + I+F ++ N+ +R+  +L+ LG +   L+  M Q  RL  L  F     S+L+A+DVA+RGLDIP +D VI+FD+   ++ ++HR GRTARA  SG SI  +S  ++  F ++
Sbjct:   62 QRLFALVLTPTRELAFQISEQFEALGSSIGIKSAVVVGGIDMMSQSLALAKKPHVIIATPGRLVDHLENTKGFNIRA--LKYLVMDEADRILNMDFETEV------------DKILKVIP-KERKTYLFSATMT-----KKVQK------------------LQRAALKE-PVKCSVSTKYQTVEKLQQYYVFIPAK-FKDSYLVYILNELAGNSFIIFCSTCNNTQRIALLLRNLGFTAIPLHGQMSQNKRLGSLNKFKGKARSILLATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGKSITFVSQYDVELFQRI 349          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Sea Lamprey
Match: ddx42 (DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFIN;Acc:ZDB-GENE-050706-53])

HSP 1 Score: 133.265 bits (334), Expect = 9.136e-33
Identity = 100/362 (27.62%), Postives = 166/362 (45.86%), Query Frame = 1
Query:  475 KPYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEK-LGMKECPMIIDTTIDVAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSESDVK----DIQIKNIEYYEEVVKLAR 1545
            KP     GL+  PTREL  Q+    K+  +  +L   A++GG S   Q + L+   EIVV TPGR    ++ +   A +  +++ LV DEADR+ + G   +V +  N ++ +             RQT+++SAT            +M+               V+  +G     +     I     ++W  LC       + L  F  +  G  ++F   K++   L++ L+  G     L+ DM Q  R K +  F K    +++A+DVAARGLDIP I  V+++DVA   +TH HR GRT RA   G +  +++  +M     L+ +L+ +   V     D+ ++N  + +   K  R
Sbjct:  318 KPGDGPIGLICVPTRELCQQINVECKRFGKAYNLHSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKKK---ATNLQRVTYLVFDEADRMFDMGFEYQVRSIANHVRPD-------------RQTMLYSATF-----------RMRVEKLARDILIDPIRVVQGDIGEANEDVTQRVEIFSNGAAKWNWLC-------SHLVEFTSS--GSVLIFVTRKDNSEELSNDLEQEGFQVGLLHGDMDQSERNKVISDFKKKVIPIMVATDVAARGLDIPSIKTVVNYDVARDIDTHTHRVGRTGRAGEKGTAFTLMTHKDMNFAGDLVRNLEGANQHVHKELMDLAMQNPWFRKTRFKGGR 643          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Sea Lamprey
Match: ddx49 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:ZFIN;Acc:ZDB-GENE-031030-3])

HSP 1 Score: 124.79 bits (312), Expect = 8.776e-31
Identity = 98/318 (30.82%), Postives = 161/318 (50.63%), Query Frame = 1
Query:  490 IYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVK--KQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTIDVAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVA----ARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLS 1425
            I+ LVL PTRELA Q+ +  +   +   L+   I GGM + RQ + L R+P +V+ TPGR    ++  +    S  K+  LV+DEADR+LE+G      +F   ++       I  +P K RQTL+FSATLT     D ++  + +        ++ +    VE+L  +   ++ D   D        ++   Q+ +D    W +       IVF N+  + + L  +L+       +L++ M+Q  R   L  F  +   +LIA+DVA    ARGLDIP +  V++ +     +T++HR GRTARA  +G +I +++
Sbjct:   74 IFCLVLAPTRELAYQIAEQFRVMGKPLGLKDSVIVGGMDSVRQAQELARKPHVVIATPGRLADHLRSSN--TFSLKKIQFLVMDEADRLLEQG----ATDFTKDLQV------ILALPAK-RQTLLFSATLT-----DTLQELRNLALTNPFFWESKEPVRTVEELDQRYI-LVADKVKDAY------LVHIIQKIQDAHDDWSI-------IVFTNTCKNCQVLNMMLRHFNFPSVALHSMMRQTERFASLSKFKSSMFKILIATDVASSFWARGLDIPTVQVVLNHNTPSLPKTYIHRVGRTARAGRNGVAITIVT 359          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010109.1 (pep scaffold:Pmarinus_7.0:GL476492:615610:626431:-1 gene:ENSPMAG00000009147.1 transcript:ENSPMAT00000010109.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.405 bits (311), Expect = 3.177e-30
Identity = 95/325 (29.23%), Postives = 154/325 (47.38%), Query Frame = 1
Query:  499 LVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDT-----TIDVAQLSQWK----ILCPTQEDKDTRLYWFLK-NHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNS-GYSIIMLSPNEMG 1440
            LVL+PTRELA Q    L++  +        I GG +   + + L +   I+V TPGR    +Q+ +        L  LVIDEADRILE G   E++  +  +              K RQT++FSAT T                       +    + K+ +K+ P+ +       T  V  L Q +    ++CP+ E +   L+ FLK N + + +VF +S  SV+    +   + L    ++   +Q  R      F   ++  L+ +DVAARGLDIP +D+++ FD     + ++HR GRTAR +   G+++++L P E+G
Sbjct:  253 LVLSPTRELAMQTYGVLRELMKHHVHTYGLIMGGSNRTAEAQKLAKGINILVATPGRLLDHMQNTN--TFMYKNLQCLVIDEADRILEVGFEEEIKQIIRLLP-------------KKRQTMLFSATQT-----------------------RKIEDLAKISLKKEPLYVGVDDHKETATVDGLEQQRSTPYVVCPS-EKRFLLLFTFLKKNRKKKIMVFFSSCMSVKFHYELFNYIDLPVMGIHGKQKQTKRTTTFFQFCNADSGTLLCTDVAARGLDIPEVDWIVQFDPPDDPKEYIHRVGRTARGIGGQGHALLILRPEELG 538          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Yeast
Match: MAK5 (Essential nucleolar protein; putative DEAD-box RNA helicase required for maintenance of M1 dsRNA virus; involved in biogenesis of large (60S) ribosomal subunits [Source:SGD;Acc:S000000346])

HSP 1 Score: 205.682 bits (522), Expect = 2.292e-57
Identity = 149/444 (33.56%), Postives = 233/444 (52.48%), Query Frame = 1
Query:  499 LVLTPTRELACQVTDHLKKACQ----FTDLQVCAIFGGMSAERQERLLK--RRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFM-NWMKTNAGDRFINGVPMKPRQTLVFSATLTF-----VHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTIDVAQLSQWK---ILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESF------SKTEN----------SLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNE-MGQFNKLLFSLQKSESDVKDIQIKN---------------------IEYYEEVVKLAREIESQSHVTKTVVNNRNWFEKMAEK--ADIKLDDEIVEKKNA 1665
            L+ TPTRELA QVTDHLKK C+     +   + ++ GG+S ++Q+RLLK     +IV+ TPGRF   ++  +      SK++ L++DEADR+L+ GHF E E  + + +     +R  +    K  QTL+FSAT +      + S+  VK + +   ++   N+ + + + K+     P+IIDT  +    SQ K   I CP  E +D   Y+FL    G T++F N+ +SV++LT  L  LG+    +++ M QK RLK LE F       KT N          ++LIASDVAARGLDIP +  VIH+ +  + + ++HRSGRTARA + G S ++ SP E MG   KL  +L    S   D+  ++                     +    E  +LA E+      + ++  + NW +K A++   D+  D++ + K N+
Sbjct:  247 LIFTPTRELAHQVTDHLKKICEPVLAKSQYSILSLTGGLSIQKQQRLLKYDNSGQIVIATPGRFLELLEKDNTLIKRFSKVNTLILDEADRLLQDGHFDEFEKIIKHLLVERRKNRENSEGSSKIWQTLIFSATFSIDLFDKLSSSRQVKDR-RFKNNEDELNAVIQHLMSKIHFNSKPVIIDTNPESKVSSQIKESLIECPPLE-RDLYCYYFLTMFPGTTLIFCNAIDSVKKLTVYLNNLGIPAFQIHSSMTQKNRLKSLERFKQQSAKQKTINHSNPDSVQLSTVLIASDVAARGLDIPGVQHVIHYHLPRSTDIYIHRSGRTARAGSEGVSAMICSPQESMGPLRKLRKTLATKNSVSTDLNSRSTNRKPIKWQNTVPLLPIETDILSQLRERSRLAGELADHEIASNSLRKDDNWLKKAADELGIDVDSDEDDISKSNS 688          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Yeast
Match: RRP3 (Protein involved in rRNA processing; required for maturation of the 35S primary transcript of pre-rRNA and for cleavage leading to mature 18S rRNA; homologous to eIF-4a, which is a DEAD box RNA-dependent ATPase with helicase activity [Source:SGD;Acc:S000001107])

HSP 1 Score: 155.221 bits (391), Expect = 3.585e-41
Identity = 103/318 (32.39%), Postives = 160/318 (50.31%), Query Frame = 1
Query:  475 KPYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTIDVAQLSQWKILCPTQEDKDTRLYWFLKNHQGRT-IVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLS 1425
            +PY   Y  +L PTRELA Q+ +          ++   I GGM+   Q R L R+P I++ TPGR    +++      S  KL  LV+DEADR+L+   F  V            DR +  +P + R T +FSAT+T     D +++                    K  +      +DT      L Q  ++ P    K+T L + L    G+T I+F  +K +  RL+ +   L  S  +L+ D+ Q  R+  L+ F   + S+L+A+DVAARGLDIP +D V+++D+   +++++HR GRTARA  SG SI ++S
Sbjct:  148 EPY---YACILAPTRELAQQIKETFDSLGSLMGVRSTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENT--KGFSLRKLKFLVMDEADRLLDM-EFGPVL-----------DRILKIIPTQERTTYLFSATMT--SKIDKLQRASLTNPV-------------KCAVSNKYQTVDT------LVQTLMVVPGGL-KNTYLIYLLNEFIGKTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGSLDLFKAGKRSILVATDVAARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVS 426          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Yeast
Match: DRS1 (Nucleolar DEAD-box protein required for ribosome assembly and function; including synthesis of 60S ribosomal subunits; constituent of 66S pre-ribosomal particles [Source:SGD;Acc:S000003931])

HSP 1 Score: 149.058 bits (375), Expect = 4.752e-38
Identity = 103/316 (32.59%), Postives = 162/316 (51.27%), Query Frame = 1
Query:  499 LVLTPTRELACQVTDHLKKACQF-TDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTIDVA-QLSQWKILCPTQED-KDTRLYWFLK----NHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLS 1425
            +VL PTRELA QV D  K+  +F + +      GG++  +QE++LK RP+IV+ TPGRF   I++    + +   + ILV+DEADR+LE+G   E+   M  + +N             RQ L+FSAT+                       SK+ + V     K   ++ID     A +L+Q  +    ++  K   L+  ++      Q R +VF   K +  RL  ++  LG+S   L+  + Q+ RL  +  F   E  +LI +D+A+RGLDIP+I+ VI++D+  + E +LHR GRTARA   G S+  + 
Sbjct:  306 IVLLPTRELAIQVADVGKQIARFVSGITFGLAVGGLNLRQQEQMLKSRPDIVIATPGRFIDHIRNS--ASFNVDSVEILVMDEADRMLEEGFQDELNEIMGLLPSN-------------RQNLLFSATMN----------------------SKIKSLVSLSLKKPVRIMIDPPKKAATKLTQEFVRIRKRDHLKPALLFNLIRKLDPTGQKRIVVFVARKETAHRLRIIMGLLGMSVGELHGSLTQEQRLDSVNKFKNLEVPVLICTDLASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSVTFVG 584          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Yeast
Match: HAS1 (ATP-dependent RNA helicase; involved in the biogenesis of 40S and 60S ribosome subunits; localizes to both the nuclear periphery and nucleolus; highly enriched in nuclear pore complex fractions; constituent of 66S pre-ribosomal particles [Source:SGD;Acc:S000004903])

HSP 1 Score: 137.502 bits (345), Expect = 5.499e-35
Identity = 111/392 (28.32%), Postives = 184/392 (46.94%), Query Frame = 1
Query:  475 KPYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTIDVAQ-----LSQWKILCPTQEDKDTR---LYWFLK-NHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNS-GYSIIMLSPNEMGQFNKLLFS-LQKSESDVKDIQIKNIEYYEEVVKLAREIESQSHVTKTVVNN-RNWFEKMA 1614
            KP      +V+TPTRELA Q+    ++  +F       + GG +  ++   L +   +++ TPGR    +Q+          L  L+IDEADRILE G       F + M+     + I  +P + RQ+++FSAT T                            + ++ ++  P+ I+   +        L Q  ++C    D D R   L+ FLK N + + IVF +S NSV+    +L  + L    L+   +Q+ R      F   E  +LI +DVAARGLDIP +D++I FD       ++HR GRTAR     G S++ L+PNE+G    L  S +  +E +  + +I N++      +L + I+S  ++ +T  +  R++ +  A
Sbjct:  110 KPRNGTGIIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKLMKGVNMLIATPGRLLDHLQNT--KGFVFKNLKALIIDEADRILEIG-------FEDEMR-----QIIKILPNEDRQSMLFSATQT-----------------------TKVEDLARISLRPGPLFINVVPETDNSTADGLEQGYVVC----DSDKRFLLLFSFLKRNQKKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICTDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTARGTKGKGKSLMFLTPNELGFLRYLKASKVPLNEYEFPENKIANVQ-----SQLEKLIKSNYYLHQTAKDGYRSYLQAYA 455          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Yeast
Match: DBP3 (RNA-Dependent ATPase, member of DExD/H-box family; involved in cleavage of site A3 within the ITS1 spacer during rRNA processing; not essential for growth, but deletion causes severe slow-growth phenotype [Source:SGD;Acc:S000003046])

HSP 1 Score: 129.798 bits (325), Expect = 2.538e-32
Identity = 97/324 (29.94%), Postives = 158/324 (48.77%), Query Frame = 1
Query:  499 LVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTI-DVAQLSQWKILCPTQEDKDTR------LYWFLKNHQG-----RTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNE 1434
            LV++PTRELA Q+ D+L        +Q C ++GG+  + Q R+  ++ ++VV TPGR    +Q+    ++  S+++ LV+DEADR+LEKG   +++N +   +T+A            RQTL+F+AT                              V +L        I  +I +  QL+  K +    E  D R      L    K H G     + ++FA  K    R+   L+  G +  +++ D+ Q+ R + L  F   +++LL+A+DVAARGLDIP +  VI+     T E ++HR GRT RA  +G +  + +  E
Sbjct:  186 LVISPTRELASQIYDNLIVLTDKVGMQCCCVYGGVPKDEQ-RIQLKKSQVVVATPGRLLDLLQE---GSVDLSQVNYLVLDEADRMLEKGFEEDIKNIIR--ETDASK----------RQTLMFTATWP--------------------------KEVRELASTFMNNPIKVSIGNTDQLTANKRITQIVEVVDPRGKERKLLELLKKYHSGPKKNEKVLIFALYKKEAARVERNLKYNGYNVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFTEQE 467          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Nematostella
Match: EDO48238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF5])

HSP 1 Score: 301.212 bits (770), Expect = 4.274e-94
Identity = 196/544 (36.03%), Postives = 299/544 (54.96%), Query Frame = 1
Query:   79 WKNLYIPEPVLKAIEKEGFLKPTQIQTLVLPCAIRDRMDILXXXXXXXXXXLAFGIPMISRILMDKQKEIDIYKDXXXXXXXXXXXXXXXXXXDQCDLSPSESELEFAWNDDEIKPELFTGVEMCRIKEDNCKPYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMK-TNAGDRFIN-----------GVPMKPR-QTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTID---VAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSESDVKDIQIKNIEYYEEV---VKLAREIESQSHVTKTVVNNRNWFEKMAEKADIKLDDEIVE 1653
            W+ L +   +L+A+  +GF KPT IQ+L +P A+    DI+GAA TG+GKTLAFGIP+I        + I+ YK                    + + SPS+ E +                      E    P   +  L++ PTRELA QV DHL KA ++T ++V AI GGM+A +Q+RLLK+RPEIVV TPGR W  I  Q+ H  +   L  LVIDEADR++E+GH+ E+ + +  +    +G+  ++             P K R Q  +FSATLT   S     ++      +L  +      +E+   K    +ID T     V  L++ KI C T+EDKD  LY+FL  + GRT+VFAN+ + VRRLTS+L+ + L+P  L+A MQQ+ RLK L+ F  +   LL+A+DVAARGLDI  I+ VIH+ V    E ++HRSGRTARA + G S++++ P ++  + K + +L   E D+    + ++ Y   +   + +AR+I+ +        ++ +W    A+  DI++D++++E
Sbjct:    4 WEGLGVAPDILRALGDQGFSKPTPIQSLSIPPALLYHRDIIGAAETGSGKTLAFGIPII--------QHIEAYKKR------------------KAEQSPSDKESDL---------------------ESQGYP---LLALIMAPTRELALQVKDHLVKAAKYTSVKVAAIVGGMAAPKQQRLLKQRPEIVVATPGRLWELISQQEEHVSNIQLLRYLVIDEADRMVEQGHYEELSSILELIHLKKSGNMEVDQEDAERPSNSSKTPEKARLQKFIFSATLTLPKSFKKRGREKTVSKGELLASLMDKIHLERKRSK----VIDVTSSRGTVETLTEAKITC-TKEDKDVYLYYFLLKYPGRTLVFANTIDCVRRLTSILRLVQLNPLPLHASMQQRQRLKNLDRFKASNTGLLLATDVAARGLDIANIEHVIHYQVPKDPEVYVHRSGRTARASHEGLSVVLVGPEDLAHYRKTMKTLNNGE-DLGSFPV-DVSYLPGIRNRLSIARQIDKEELKVSKKKSSNSWILNSAKAMDIEVDEDLLE 490          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Nematostella
Match: EDO33593 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRU4])

HSP 1 Score: 155.606 bits (392), Expect = 3.108e-41
Identity = 105/330 (31.82%), Postives = 168/330 (50.91%), Query Frame = 1
Query:  484 QHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKL--GMKECPMIIDTTI---DVAQLSQWKILCPTQEDKDTRLYWFLKNHQGRT-IVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKL 1455
            Q ++ L+LTPTRELA Q+++  +       ++   I GG+    Q  +L ++P I++ TPGR    +++      S   L  LV+DEADRIL      EV            D+ +  +P K R+T +FSAT+T        KK                  V+KL     + P+ ++       V +L Q  +  P++  KD  L + L    G + +VF  + N+V+R+T +L+ LGL    L+  M Q  RL  L  F     S+L+A+DVA+RGLDIP +D VI+FD+   ++ ++HR GRTARA  SG S+  ++  ++  + ++
Sbjct:   81 QRLFALILTPTRELAFQISEQCEALGSGIGVKCAVIVGGIDMMSQALMLAKKPHIIIATPGRLIDHLENT--KGFSLRTLKYLVMDEADRILNMDFEKEV------------DKLLKVIP-KERRTFLFSATMT--------KK------------------VQKLQRASLQAPVKVEVATKYQTVEKLQQSYLFIPSKF-KDCYLVYVLNELAGNSFMVFCGTCNNVQRVTLMLRNLGLDAVPLHGQMSQSKRLGALNKFKSKSRSILVATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGRSVTFVTQYDVELYQRI 368          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Nematostella
Match: EDO43011 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZV2])

HSP 1 Score: 140.969 bits (354), Expect = 3.300e-36
Identity = 105/331 (31.72%), Postives = 168/331 (50.76%), Query Frame = 1
Query:  478 PYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTID---VAQLSQWKILCPTQEDKDTRLYWFLKNHQGR--TIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKL 1455
            PY  I+ +VLTPTRELA Q+ D  K   +   L+   I GG+   +Q   L  +P +V+ TPGR    I+  D   L+  K+  LV+DEADR+L+        +F + +K        + VP K RQTL+FSATLT     D + +                  ++K+   + P   +   D   VA+L Q  +L P    +D  L   L+ +      IVF ++  + + L S+   LGL+   L++ + Q  RL  L  F      +L+A+DVA+RGLDIP+++ V++ ++    + ++HR GRTARA   G +I M++  ++ +  K+
Sbjct:   73 PY-GIFAVVLTPTRELAFQIADQFKVLGRPIGLKEAVIVGGLDMMKQALSLANKPHVVIATPGRLADHIKSTD--TLNLKKIQFLVLDEADRLLD-------PSFGDDLKV-----IFDAVPEK-RQTLLFSATLT-----DTMGE------------------LQKMSGSQ-PFSYEVQSDIATVAELDQRYLLTPAHV-RDCYLVHLLRENDDNQSVIVFTHTCKNCQVLVSMFHKLGLTCVGLHSLLSQGERLAALARFKSGTIKILVATDVASRGLDIPQVELVVNSNIPADPKDYIHRVGRTARAGRGGMAISMVTQYDIDRVKKI 362          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Nematostella
Match: EDO42894 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S034])

HSP 1 Score: 130.954 bits (328), Expect = 1.117e-31
Identity = 116/412 (28.16%), Postives = 185/412 (44.90%), Query Frame = 1
Query:  496 GLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTIDVAQLSQWKILCPTQE------DKDTRLYWFLK-----NHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFN-KLLFSLQKSESDVKDIQIKNIEYYEEVVKLARE-IESQSHVTKTVVNNRNWFEKMAEKADIKLDDEIVEKKNAPSKKKTQEF 1692
             +V+TPTRELA Q+    KK C+  +L+   ++GG     Q   LKR  EI+V TPGR    +   +    +  + + LV+DEADR+ + G   +V   ++ ++ +             RQT++FSAT           +QM                 E L  K    I+D  I++ Q+    ++C   E      ++D +    L+       QG  +VF   ++S   L   L        SL+  M Q  R   +  F      L+IA+ VAARGLD+  ++ V+++D  +  E ++HR GRT RA N G +   L+P E G+F   ++ +L+ +E+ V           E+V  LA   IE++    K +V N  +  K       K +DE  EK      KK Q++
Sbjct:  213 AIVMTPTRELAIQIHRECKKFCKPNNLRCVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLTANNGRVTNCQRCTYLVLDEADRMFDMGFEPQVMRIIDCIRPD-------------RQTVMFSATFP---------RQM-----------------EALARK----ILDKPIEI-QVGGRSVVCSDVEQNVVVIEEDDKFLKLLELLGLYQEQGSVLVFVEKQDSADSLFKDLLKRSYPCLSLHGGMDQFDRDSTIADFKNGVTKLMIATSVAARGLDVKHLNLVVNYDCPNHYEDYVHRVGRTGRAGNKGTAYTFLTP-EQGRFAIDVIKALEMAENPVP----------EDVRNLANTYIETRKAEGKNIVKNSGFSGK-----GFKFNDE--EKAKVSEAKKIQKW 562          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Nematostella
Match: EDO38731 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC22])

HSP 1 Score: 126.716 bits (317), Expect = 4.579e-31
Identity = 103/368 (27.99%), Postives = 173/368 (47.01%), Query Frame = 1
Query:  499 LVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDT-----TIDVAQLSQWKILCPTQEDKDTRLYWFLK-NHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNS-GYSIIMLSPNEMGQFNKLLFS-LQKSESDVKDIQIKNIEYYEEVVKLAREIESQSHVTKT 1578
            ++++PTREL+ Q     +   +  +     I GG++ + +   L++   +++ TPGR    +Q+          L  LVIDEADRILE G   E+   +  +            P K RQT++FSAT T                       K    + KL +K  P+ +       T  V  L Q  I+ P+ E +   L+ FLK N   + +VF +S NSV+  + +L  + L    ++   +Q+ R      F   ++ +L+ +DVAARGLDIP +D+++ +D A   + ++HR GRTAR     G++++ L P E+     L  + +  +E D    +I NI+      +L R IE   ++ K+
Sbjct:   77 IIISPTRELSLQTYGVARDLLKHHNFTYGIIMGGVNRKAEAERLQKGVNLLIATPGRLLDHLQN--TQGFLYKNLQCLVIDEADRILEIGFEEEMRQIIRIL------------PSK-RQTVLFSATQT-----------------------KNVEDLAKLSLKRSPLYVGVDDHKETSTVEGLEQGYIVVPS-EKRFLVLFTFLKKNRSKKVMVFFSSCNSVKYHSELLNYIDLPVLEIHGKQKQQKRTTTFFEFCNAKSGILLCTDVAARGLDIPEVDWIVQYDPADDPKEYIHRVGRTARGTEGKGHALLFLLPEELAFLRYLKHAKVPLNEYDFSSSKILNIQ-----SQLERLIEKNYYLHKS 400          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Medaka
Match: ddx24 (DEAD-box helicase 24 [Source:NCBI gene;Acc:101158676])

HSP 1 Score: 349.362 bits (895), Expect = 5.726e-109
Identity = 221/546 (40.48%), Postives = 327/546 (59.89%), Query Frame = 1
Query:   70 LNNWKNLYIPEPVLKAIEKEGFLKPTQIQTLVLPCAIRDRMDILXXXXXXXXXXLAFGIPMISRIL-------------MDKQ--KEIDIY----KDXXXXXXXXXXXXXXXXXXDQCDLSPSESELEFAWNDDEIKPELFT--GVEMCRIKEDNCKPYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKP-RQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTT---IDVAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQK-SESDVKDIQIKNIEYYEEVVKLAREIESQSHVTKTVVNNRNWFEKMAEKADI 1629
            ++ WK+L++P  VLKA+   GF  PT IQ L LP AIRD MD+LGAA TG+GKTLAFGIPMI  IL             +DK   K + +Y    ++    E E   + ++    +  D   S +E + + + DE    + T    E C  ++      + + G+VLTPTRELA QV  H+    +FTD++   + GGM+ ++Q+R+LKR PEI++ TPGR W  I+++ PH L+   L  LVIDEADR++E+GHFAE+E+ +           +N     P RQT VFSATLT  HS   +  ++ +    L K SKL   +EK+G+K  P +ID T     V  L++ +I C  +++KD  LY+FL  + GRT+VFANS + ++RL S+L  L  +P  L+A+M QK RLK LE F++ E+ +L+ +DVAARGLDIP +  VIH+ V  T+ET++HRSGRTARA   G S++++ P++M    K+  +L+K  ES +  I+ K +E  +E V LAR+IE          ++ +WF++ AE  ++
Sbjct:  215 VSAWKDLFVPSSVLKALSSLGFESPTPIQALALPPAIRDHMDVLGAAETGSGKTLAFGIPMIHAILEWKRGTEQSLHDNIDKTPPKVVSLYLPSVEESAKSEDESTAVGNQEGSVEASDEEDSSAE-DGSEDQDEKTGSVCTVKNAERCVEEQLAGGRSRPLLGMVLTPTRELAVQVKHHIDAVTKFTDIKTAILVGGMAQQKQKRMLKRCPEIIIATPGRLWDLIKEKHPHLLNLRHLRCLVIDEADRMVERGHFAELESLLE---------MLNTTHFNPKRQTFVFSATLTLTHS---LPSRLLQKKKNLEKRSKLDILIEKVGIKSKPKVIDLTRKEATVETLTETQIHC-QKDEKDFYLYYFLLQYPGRTMVFANSIDCIKRLNSLLVILECNPLPLHANMHQKQRLKNLERFAERESGVLLTTDVAARGLDIPDVQHVIHYQVPRTSETYVHRSGRTARATKEGLSLLLVGPDDMINLKKIYKTLEKDEESPMFPIETKCLEAIKERVNLARKIEKIEFYNSREKHHDSWFKQAAEALEV 746          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Medaka
Match: ddx47 (DEAD-box helicase 47 [Source:NCBI gene;Acc:101159675])

HSP 1 Score: 152.14 bits (383), Expect = 2.829e-39
Identity = 103/329 (31.31%), Postives = 172/329 (52.28%), Query Frame = 1
Query:  484 QHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKE---CPMIID-TTIDVAQLSQWKILCPTQEDKDTRLYWFLKNHQGRT-IVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKL 1455
            Q ++ LVLTPTRELA Q+++  +       ++   I GG+    Q  +L ++P IV+ TPGR    +++    +L A  L  LV+DEADRIL      EV            D+ +  +P + R+T +FSAT+T       V+K                  +++  +K+   C +    +T+D  +L Q+ +  P +  KD  L   L    G + ++F ++ N+ +R+  +L+ LG++   L+  M Q  RL  L  F     S+L+A+DVA+RGLDIP +D VI++D+   ++ ++HR GRTARA  SG SI  ++  ++  F ++
Sbjct:  106 QRLHTLVLTPTRELAFQISEQFEALGSSIGVKCAVIVGGIDMMSQSLVLAKKPHIVIATPGRLIDHMENTKGFSLRA--LKFLVMDEADRILNMDFETEV------------DKILKVIP-RERRTFLFSATMT-----KKVQK------------------LQRAALKDPVKCAVSTKYSTVD--KLQQYYVFIPAKY-KDCYLVSILNELAGNSFMIFCSTCNNAQRVALMLRNLGITAIPLHGQMSQNKRLGALNKFKSKSRSVLLATDVASRGLDIPHVDCVINYDIPTHSKDYIHRVGRTARAGRSGKSITFVTQYDVELFQRI 393          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Medaka
Match: ddx49 (DEAD-box helicase 49 [Source:NCBI gene;Acc:101169189])

HSP 1 Score: 144.436 bits (363), Expect = 8.385e-37
Identity = 129/420 (30.71%), Postives = 202/420 (48.10%), Query Frame = 1
Query:  478 PYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTID---VAQLSQWKILCPTQEDKDTRLYWFL-----KNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSESDVKDIQIKNIEYYEEVVKLAREIESQSHVTKTVVN-NRNWFEKMAEKADIKLDDEIVEKKNAPSKKKTQEFEKKSEA 1710
            PY  I+ LVLTPTRELA Q+ +  +   +   L+ C + GGM    Q   L ++P +VV TPGR    ++  +    S  K+  L++DEADR+LE+G      +F     T   +  +  +P K RQTL+FSATLT     D +++                  ++ + M + P   ++T +   V +L Q  IL P ++ KD  L   +     K+     I+F N+  + + LT +L+       SL++ M+Q+ R   L  F  +   +LIA+DVAARGLDIP +  VI+ +     + ++HR GRTARA  +G SI +++  ++     L+ S+++        + K  EY  E        E + H   T VN  R   E   E  D     EI ++K    + K  E E K +A
Sbjct:   68 PYG-IFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCIVVGGMDMVTQALELSKQPHVVVATPGRLADHVRSSN--TFSMRKIKFLILDEADRLLEQG----CTDF-----TKDLEEILGTLPAK-RQTLLFSATLT-----DTLQE------------------LKSIAMNK-PFFWESTSETRTVEELDQRYILTP-EKVKDAYLVHLIQTFTDKHDDWSIIIFTNTCKNCQILTMMLREFNFPTISLHSMMKQRQRFANLAKFKASVYKILIATDVAARGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRNGVSITLVTQYDI----HLVHSIEEQ------TKTKLTEYPVE--------EKEVHKILTQVNVTRRECEIRLESTDFDEKKEINKRKQLILEGKDPELEAKRKA 431          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Medaka
Match: ddx27 (DEAD-box helicase 27 [Source:NCBI gene;Acc:101158015])

HSP 1 Score: 134.42 bits (337), Expect = 1.796e-32
Identity = 93/317 (29.34%), Postives = 159/317 (50.16%), Query Frame = 1
Query:  499 LVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKE-CPMIIDTTIDVAQLSQWKILC--PTQE-DKDTRLYWFL-KNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNE 1434
            LVL PTREL  QV    ++  QFT +  C   GG+  + QE  L+  P++++ TPGR    + +     LS   + IL++DEADR+L++    +++  +     N             RQT++FSAT+T     + VK                   +  + +K+   + +++  DVA   + + +   P +E D++  +   L +  Q   ++F  ++    RL  +L  +GL    L+ ++ Q  RL+ L  F   +  +L+A+DVAARGLDI  +  VI+F +  T + ++HR GRTARA  SG S+ ++  +E
Sbjct:  248 LVLVPTRELGIQVHSVARQLAQFTSITTCLAVGGLDLKSQEAALRAGPDVLIATPGRLIDHLHNTPNFELS--HIEILILDEADRMLDEYFEEQMKEIIRLCSYN-------------RQTMLFSATMT-----EEVKD------------------LAAVSLKQPVRIFVNSNTDVAPFLRQEFIRIRPHREGDREAVVAALLTRTFQDHVMLFTQTRKQAHRLHILLGLMGLKVGELHGELSQNQRLENLRRFKDDQIDILVATDVAARGLDIDGVKTVINFTMPSTVKHYVHRVGRTARAGRSGRSVSLVGESE 526          
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Medaka
Match: ddx27 (DEAD-box helicase 27 [Source:NCBI gene;Acc:101158015])

HSP 1 Score: 134.035 bits (336), Expect = 2.808e-32
Identity = 93/317 (29.34%), Postives = 159/317 (50.16%), Query Frame = 1
Query:  499 LVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKE-CPMIIDTTIDVAQLSQWKILC--PTQE-DKDTRLYWFL-KNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNE 1434
            LVL PTREL  QV    ++  QFT +  C   GG+  + QE  L+  P++++ TPGR    + +     LS   + IL++DEADR+L++    +++  +     N             RQT++FSAT+T     + VK                   +  + +K+   + +++  DVA   + + +   P +E D++  +   L +  Q   ++F  ++    RL  +L  +GL    L+ ++ Q  RL+ L  F   +  +L+A+DVAARGLDI  +  VI+F +  T + ++HR GRTARA  SG S+ ++  +E
Sbjct:  270 LVLVPTRELGIQVHSVARQLAQFTSITTCLAVGGLDLKSQEAALRAGPDVLIATPGRLIDHLHNTPNFELS--HIEILILDEADRMLDEYFEEQMKEIIRLCSYN-------------RQTMLFSATMT-----EEVKD------------------LAAVSLKQPVRIFVNSNTDVAPFLRQEFIRIRPHREGDREAVVAALLTRTFQDHVMLFTQTRKQAHRLHILLGLMGLKVGELHGELSQNQRLENLRRFKDDQIDILVATDVAARGLDIDGVKTVINFTMPSTVKHYVHRVGRTARAGRSGRSVSLVGESE 548          
BLAST of ATP-dependent RNA helicase DDX24 vs. Planmine SMEST
Match: SMESG000016093.1 (SMESG000016093.1)

HSP 1 Score: 1199.11 bits (3101), Expect = 0.000e+0
Identity = 626/630 (99.37%), Postives = 628/630 (99.68%), Query Frame = 1
Query:   55 MANDILNNWKNLYIPEPVLKAIEKEGFLKPTQIQTLVLPCAIRDRMDILXXXXXXXXXXLAFGIPMISRILMDKQKEIDIYKDXXXXXXXXXXXXXXXXXXDQCDLSPSESELEFAWNDDEIKPELFTGVEMCRIKEDNCKPYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTIDVAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSESDVKDIQIKNIEYYEEVVKLAREIESQSHVTKTVVNNRNWFEKMAEKADIKLDDEIVEKKNAPSKKKTQEFEKKSEALDLKIKYLDKIDLDFKSPLSGHVKIVSEESKFEPIATVTKFQSDPNTVKKNSTNNKRKKPINDNILSENPGYKKMKNK 1944
            MANDILNNWKNLYIPEPVLKAIEKEGFLKPTQIQTLVLPCAIRDRMDILGAAATGTGKTLAFGIPMISRILMDKQKEIDIYKDENIEESEDIEMDSEVEENDQCDLSPSESELEFAWNDDEIKPELFTGVEMCRIKEDNCKPYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLS+LVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMKKLTSKLTKNSKLSNFVEKLGMKECPMIIDTTIDVAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSESDVKDIQIKNIEYYEEVVKLAREIESQSHVTKTVVNNRNWFEKMAEKADIKLDDEIVEKKNAPSKKKTQEFEKKSEALDLKIKYLDKIDLDFKSPLSGHVKIVSEESKFEPIATV+KFQSD NTVKKNSTN KRKKPINDNILSENPGYKKMKNK
Sbjct:    1 MANDILNNWKNLYIPEPVLKAIEKEGFLKPTQIQTLVLPCAIRDRMDILGAAATGTGKTLAFGIPMISRILMDKQKEIDIYKDENIEESEDIEMDSEVEENDQCDLSPSESELEFAWNDDEIKPELFTGVEMCRIKEDNCKPYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSVLVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMKKLTSKLTKNSKLSNFVEKLGMKECPMIIDTTIDVAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSESDVKDIQIKNIEYYEEVVKLAREIESQSHVTKTVVNNRNWFEKMAEKADIKLDDEIVEKKNAPSKKKTQEFEKKSEALDLKIKYLDKIDLDFKSPLSGHVKIVSEESKFEPIATVSKFQSDSNTVKKNSTNKKRKKPINDNILSENPGYKKMKNK 630          
BLAST of ATP-dependent RNA helicase DDX24 vs. Planmine SMEST
Match: SMESG000060345.1 (SMESG000060345.1)

HSP 1 Score: 149.828 bits (377), Expect = 2.323e-38
Identity = 106/345 (30.72%), Postives = 176/345 (51.01%), Query Frame = 1
Query:  454 RIKEDNCKPYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXX----XXXXXXXXXXXXXFVEKLGMKECPMIIDTTID-------------VAQLSQWKILCPTQEDKDTRLYWFLKNHQGRTI-VFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNE 1434
            ++   N +P      ++++PTREL+ Q  + L+K    T+L+   + GG + + + + L+    I+V TPGR    + +         +L  L+IDEADR++E+G   E+               +  +P K RQT++FSATL    S+  +K +MKK      S      +    +  L MKE  M+ID + +             V+QLSQ  ++C    D+   LY F+K +Q + I VF ++   V+    +   + +   +L+    Q  RLK  E F++ E +++  +DVAARGLDIP +D+V+ +D     + ++HR GRTARA N+G ++I L P E
Sbjct:   77 KVLNSNFEPRHGTAAIIMSPTRELSVQTFEVLRKLVVHTELRTGLLIGGNNRQVEAKYLQEGVTILVATPGRLLDHLNNTKFFLFH--RLQTLIIDEADRLMEQGFLEEM------------TAIVRKLP-KKRQTVLFSATLKM--SSAKLKMKMKKPEIDKRSSKVSTEEKVLTLACLSMKENCMLIDMSKEKLEANVVGGDNATVSQLSQGYVVC-KPSDRFRLLYTFIKKNQKKKIMVFMSTCLEVKYFYELFNIINVPVLALHGKQSQPKRLKNFEKFNENEAAIIFCTDVAARGLDIPLVDWVLQYDPPDDPKEYIHRVGRTARAGNAGQALIFLRPEE 403          
BLAST of ATP-dependent RNA helicase DDX24 vs. Planmine SMEST
Match: SMESG000051946.1 (SMESG000051946.1)

HSP 1 Score: 134.806 bits (338), Expect = 1.168e-33
Identity = 101/366 (27.60%), Postives = 162/366 (44.26%), Query Frame = 1
Query:  436 TGVEMCRIKEDNCKPYQHIYGLVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDP-HALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPM---KPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKECPMIIDTTIDVAQLSQWKILCPTQEDKDTRLYWFLKNHQGRT-------------------------IVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQF 1446
            TG     I ++  K  +  + LV TPTRELA Q+        +   ++   + GG+  + Q   +  +P I++ TPGRF   +      +  +   L  LV+DEADR+L                ++  DR +N +     + R+T +FSAT T     D V K  +       K S    + E                 ++L ++ +LCP  E +   L W LK    ++                         IVF  ++     L   LQ LGL+ + +N+DM Q+ R   +      +  +++A+DVAARG+DIP +D VI +D+  +A+T+ HR+GRTARA   G SI M++     Q+
Sbjct:   52 TGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRML----------------SSQFDRDLNKILYILPRTRRTFLFSATNT-----DKVSKLQRASLIDPVKVSVDEKYAES----------------SELKEFMLLCP-YEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHRAGRTARAGKRGVSITMVNQYNTPQY 379          
BLAST of ATP-dependent RNA helicase DDX24 vs. Planmine SMEST
Match: SMESG000072404.1 (SMESG000072404.1)

HSP 1 Score: 127.487 bits (319), Expect = 1.349e-30
Identity = 103/366 (28.14%), Postives = 178/366 (48.63%), Query Frame = 1
Query:  496 GLVLTPTRELACQVTDHLKKACQFT-DLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEKLGMKE-CPMIIDTTIDVA---QLSQWKILCPTQEDKDTRLYWFL-KNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKT--ENS---LLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSPNEMGQFNKLLFSLQKSESDVKDIQIKNIEYYEEVVKLAREIESQ 1560
             +VL+PTRELA Q+ +  K   +F+  L V  + GG++   QE  L+   +I++ TPGR    I +     L   K+   ++DEAD++L++    +++  +                   RQ ++FSAT+T     + VK  +                   L +K+   + ++   DVA   Q    +I     ED++  L   + +    RTI+F  +KN   R+  +L   G+    L+++M Q  RL  L  F+KT  EN    +L+ +D+AARGLD+  I+ V+++ +    E ++HR GRTAR   SG +I +++ +E     KL+    K+   ++ I  + +++Y E +KL  E  SQ
Sbjct:  175 AVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLL--KIEFFILDEADKMLDEYFIEQIKEVLKGCSPT-------------RQVMLFSATMT-----ENVKDLIS------------------LSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNML-KLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQ 501          
BLAST of ATP-dependent RNA helicase DDX24 vs. Planmine SMEST
Match: SMESG000012031.1 (SMESG000012031.1)

HSP 1 Score: 128.642 bits (322), Expect = 2.246e-30
Identity = 92/334 (27.54%), Postives = 167/334 (50.00%), Query Frame = 1
Query:  499 LVLTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVVVTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWMKTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMXXXXXXXXXXXXXXXFVEK-LGMKECPMIIDTTIDVAQLSQWKILCPTQEDKDTRLYWFL-KNHQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSKTENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSGYSIIMLSP--NEMGQFNKLLFSLQKSESDV 1488
            L+L PTRELA QV     +  ++  +++   +GG S   Q   L + PE+V+ TPGR   F+ D+     +  + + LV+DEADR+L+ G   ++   ++ ++ +             RQTL++SAT                        +  S+F++  + +    + +    D+ Q    K+    +++K+ RL   L  N + R++VF+ +K  V  L  ++   G+   +++ D  Q+ R K L+ F      +LIA+DVA+RGLDI  I++VI++D     E ++HR GRTAR+   G +    +P  ++  Q   L+  L++++ +V
Sbjct:  154 LILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDK---ITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPD-------------RQTLMWSATWP------------------NEVQNLASDFLKNYVQINVGSLYLHANPDIKQ----KVEILDEKEKEERLIEILCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIDDIEYVINYDYPSKLEDYIHRIGRTARSGKKGIAYTFFNPMKDKPRQAQDLIMILEEAKQEV 449          
The following BLAST results are available for this feature:
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX247.233e-9740.89DEAD-box helicase 24 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX247.233e-9740.89DEAD-box helicase 24 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX243.230e-9640.74DEAD-box helicase 24 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX243.230e-9640.74DEAD-box helicase 24 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX246.536e-9640.74DEAD-box helicase 24 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F55F8.24.879e-7037.72pep chromosome:WBcel235:I:5646369:5649656:-1 gene:... [more]
T26G10.13.004e-3830.90Putative ATP-dependent RNA helicase T26G10.1 [Sou... [more]
H20J04.44.199e-3731.68pep chromosome:WBcel235:II:4329023:4334091:1 gene:... [more]
H20J04.44.199e-3731.68pep chromosome:WBcel235:II:4329023:4334484:1 gene:... [more]
H20J04.44.254e-3731.68pep chromosome:WBcel235:II:4329023:4332507:1 gene:... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG91434.837e-10439.40gene:FBgn0034496 transcript:FBtr0086304[more]
CG92534.771e-3831.14gene:FBgn0032919 transcript:FBtr0081468[more]
Rs12.529e-3433.65gene:FBgn0021995 transcript:FBtr0345935[more]
Rs12.529e-3433.65gene:FBgn0021995 transcript:FBtr0088788[more]
pit1.345e-3229.46gene:FBgn0266581 transcript:FBtr0084174[more]
back to top
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx244.402e-11141.47DEAD (Asp-Glu-Ala-Asp) box helicase 24 [Source:ZFI... [more]
ddx246.649e-11141.47DEAD (Asp-Glu-Ala-Asp) box helicase 24 [Source:ZFI... [more]
ddx496.028e-3832.63DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:... [more]
ddx276.466e-3229.97DEAD (Asp-Glu-Ala-Asp) box polypeptide 27 [Source:... [more]
ddx181.477e-3129.28DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 [Source:... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX244.436e-11041.21DEAD-box helicase 24 [Source:NCBI gene;Acc:1004903... [more]
DDX247.926e-11041.21DEAD-box helicase 24 [Source:NCBI gene;Acc:1004903... [more]
DDX242.953e-10941.70DEAD-box helicase 24 [Source:NCBI gene;Acc:1004903... [more]
mki673.941e-4031.40marker of proliferation Ki-67 [Source:Xenbase;Acc:... [more]
mki674.158e-4031.40marker of proliferation Ki-67 [Source:Xenbase;Acc:... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddx243.524e-9040.00DEAD (Asp-Glu-Ala-Asp) box polypeptide 24 [Source:... [more]
Ddx245.973e-9040.00DEAD (Asp-Glu-Ala-Asp) box polypeptide 24 [Source:... [more]
Ddx243.078e-8940.00DEAD (Asp-Glu-Ala-Asp) box polypeptide 24 [Source:... [more]
Ddx472.573e-4031.52DEAD (Asp-Glu-Ala-Asp) box polypeptide 47 [Source:... [more]
Ddx496.819e-3632.72DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX24 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9GZR7|DDX24_HUMAN1.582e-9240.74ATP-dependent RNA helicase DDX24 OS=Homo sapiens O... [more]
sp|Q5RDL2|DDX24_PONAB2.916e-9240.74ATP-dependent RNA helicase DDX24 OS=Pongo abelii O... [more]
sp|Q9ESV0|DDX24_MOUSE4.178e-8940.00ATP-dependent RNA helicase DDX24 OS=Mus musculus O... [more]
sp|A3AVH5|RH13_ORYSJ9.382e-8034.05DEAD-box ATP-dependent RNA helicase 13 OS=Oryza sa... [more]
sp|A2XVF7|RH13_ORYSI9.382e-8034.05DEAD-box ATP-dependent RNA helicase 13 OS=Oryza sa... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX24 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4W6FC871.169e-11041.89DEAD (Asp-Glu-Ala-Asp) box helicase 24 OS=Lates ca... [more]
A0A0L8IDB52.938e-11040.22Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A3Q1CQA79.256e-11042.24DEAD (Asp-Glu-Ala-Asp) box helicase 24 OS=Amphipri... [more]
G1KHY91.631e-10939.86DEAD-box helicase 24 OS=Anolis carolinensis OX=283... [more]
A0A1A8FBC74.167e-10941.34DEAD (Asp-Glu-Ala-Asp) box polypeptide 24 OS=Notho... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx242.853e-9644.90DEAD-box helicase 24 [Source:NCBI gene;Acc:1030426... [more]
ddx474.903e-3931.61DEAD-box helicase 47 [Source:NCBI gene;Acc:1030345... [more]
ddx495.271e-3632.63DEAD-box helicase 49 [Source:NCBI gene;Acc:1030432... [more]
ddx274.882e-3229.97DEAD-box helicase 27 [Source:NCBI gene;Acc:1030322... [more]
ddx275.745e-3229.97DEAD-box helicase 27 [Source:NCBI gene;Acc:1030322... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000613.11.531e-4738.10pep scaffold:Pmarinus_7.0:GL494823:624:4032:1 gene... [more]
ENSPMAT00000000216.11.490e-4131.40pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-... [more]
ddx429.136e-3327.62DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFI... [more]
ddx498.776e-3130.82DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:... [more]
ENSPMAT00000010109.13.177e-3029.23pep scaffold:Pmarinus_7.0:GL476492:615610:626431:-... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MAK52.292e-5733.56Essential nucleolar protein; putative DEAD-box RNA... [more]
RRP33.585e-4132.39Protein involved in rRNA processing; required for ... [more]
DRS14.752e-3832.59Nucleolar DEAD-box protein required for ribosome a... [more]
HAS15.499e-3528.32ATP-dependent RNA helicase; involved in the biogen... [more]
DBP32.538e-3229.94RNA-Dependent ATPase, member of DExD/H-box family;... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO482384.274e-9436.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO335933.108e-4131.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430113.300e-3631.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428941.117e-3128.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387314.579e-3127.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX24 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx245.726e-10940.48DEAD-box helicase 24 [Source:NCBI gene;Acc:1011586... [more]
ddx472.829e-3931.31DEAD-box helicase 47 [Source:NCBI gene;Acc:1011596... [more]
ddx498.385e-3730.71DEAD-box helicase 49 [Source:NCBI gene;Acc:1011691... [more]
ddx271.796e-3229.34DEAD-box helicase 27 [Source:NCBI gene;Acc:1011580... [more]
ddx272.808e-3229.34DEAD-box helicase 27 [Source:NCBI gene;Acc:1011580... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX24 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016093.10.000e+099.37SMESG000016093.1[more]
SMESG000060345.12.323e-3830.72SMESG000060345.1[more]
SMESG000051946.11.168e-3327.60SMESG000051946.1[more]
SMESG000072404.11.349e-3028.14SMESG000072404.1[more]
SMESG000012031.12.246e-3027.54SMESG000012031.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032193 ID=SMED30032193|Name=ATP-dependent RNA helicase DDX24|organism=Schmidtea mediterranea sexual|type=transcript|length=1984bp
ATTCTTCTAAATGTGCTTTTTTTAATTGTTATAATTATTATTAATTAAAC
TTAGATGGCAAACGATATTCTTAATAACTGGAAAAATTTATATATACCAG
AACCAGTTTTAAAAGCAATAGAAAAAGAAGGATTTTTGAAACCGACACAA
ATTCAAACATTAGTATTACCATGTGCAATAAGAGATCGCATGGACATTCT
AGGAGCTGCTGCTACTGGTACCGGCAAAACATTAGCATTTGGGATCCCAA
TGATATCTCGTATCTTAATGGATAAGCAAAAAGAAATTGATATTTACAAA
GATGAAAATATTGAGGAAAGTGAAGACATAGAAATGGATAGTGAAGTTGA
AGAAAATGACCAATGTGACTTATCTCCTTCTGAAAGCGAATTAGAATTTG
CGTGGAATGACGATGAGATAAAACCGGAACTTTTTACTGGTGTTGAAATG
TGTCGAATTAAAGAAGATAATTGCAAACCATATCAACATATTTACGGTTT
AGTTTTAACTCCAACAAGAGAACTTGCATGCCAGGTGACCGATCATTTAA
AAAAAGCATGTCAGTTTACTGATTTGCAAGTTTGTGCAATTTTCGGTGGA
ATGTCTGCCGAACGACAAGAGAGATTGTTGAAAAGACGTCCAGAAATTGT
TGTTGTTACTCCCGGTCGGTTTTGGGCATTTATTCAAGATCAAGATCCTC
ATGCTCTGAGTGCTAGTAAACTATCGATTCTTGTCATTGATGAAGCAGAT
CGAATTTTGGAAAAGGGACATTTTGCCGAAGTGGAAAACTTCATGAATTG
GATGAAAACCAATGCAGGTGACAGGTTTATCAATGGAGTTCCAATGAAAC
CGAGACAAACTCTCGTGTTTTCGGCCACATTGACATTTGTTCATTCAGCA
GACGCTGTGAAAAAACAAATGAAAAAATTAACTTCGAAATTAACAAAGAA
TTCAAAATTAAGTAATTTTGTCGAAAAGCTCGGTATGAAAGAATGTCCAA
TGATAATTGATACTACAATTGATGTTGCTCAATTGAGCCAATGGAAGATT
TTATGTCCAACACAAGAAGACAAGGACACTAGATTATATTGGTTCTTGAA
AAATCATCAAGGAAGAACTATTGTCTTTGCCAACAGCAAGAACTCAGTGC
GAAGGTTAACATCGGTTCTGCAAACTCTTGGCCTATCTCCGAAATCTCTA
AACGCAGACATGCAACAGAAAATGAGATTGAAAAAGTTGGAATCATTTTC
AAAAACCGAAAACAGTCTGCTGATTGCTAGTGATGTGGCAGCAAGAGGTT
TGGATATCCCGAGAATCGATTTCGTAATTCATTTCGATGTTGCACACACT
GCTGAGACTCATTTGCATCGTAGCGGTCGAACAGCGAGAGCTCTCAATTC
CGGGTACAGCATCATTATGTTGTCACCGAATGAAATGGGACAATTTAATA
AACTCTTGTTCAGTCTTCAAAAATCAGAATCTGACGTGAAAGACATTCAA
ATAAAGAACATTGAATATTACGAAGAAGTTGTCAAATTGGCAAGAGAGAT
CGAATCGCAATCTCATGTTACTAAAACCGTTGTGAACAATAGAAATTGGT
TTGAGAAAATGGCTGAAAAGGCAGACATAAAACTCGATGATGAGATCGTA
GAGAAGAAAAACGCACCGTCGAAGAAAAAAACCCAAGAATTCGAGAAAAA
ATCCGAAGCACTGGATTTGAAGATAAAATATCTGGATAAAATCGATTTGG
ATTTTAAGTCCCCTCTTTCTGGCCACGTGAAAATTGTCAGTGAGGAATCA
AAATTTGAACCTATCGCCACTGTTACCAAGTTTCAATCGGATCCGAATAC
CGTCAAAAAGAACTCCACGAATAATAAACGAAAGAAACCAATCAATGATA
ATATATTATCAGAGAATCCGGGCTATAAAAAGATGAAAAATAAATAATTT
GACTTGTAATTTTTTATAATATTTAGAATTATTT
back to top

protein sequence of SMED30032193-orf-1

>SMED30032193-orf-1 ID=SMED30032193-orf-1|Name=SMED30032193-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=631bp
MANDILNNWKNLYIPEPVLKAIEKEGFLKPTQIQTLVLPCAIRDRMDILG
AAATGTGKTLAFGIPMISRILMDKQKEIDIYKDENIEESEDIEMDSEVEE
NDQCDLSPSESELEFAWNDDEIKPELFTGVEMCRIKEDNCKPYQHIYGLV
LTPTRELACQVTDHLKKACQFTDLQVCAIFGGMSAERQERLLKRRPEIVV
VTPGRFWAFIQDQDPHALSASKLSILVIDEADRILEKGHFAEVENFMNWM
KTNAGDRFINGVPMKPRQTLVFSATLTFVHSADAVKKQMKKLTSKLTKNS
KLSNFVEKLGMKECPMIIDTTIDVAQLSQWKILCPTQEDKDTRLYWFLKN
HQGRTIVFANSKNSVRRLTSVLQTLGLSPKSLNADMQQKMRLKKLESFSK
TENSLLIASDVAARGLDIPRIDFVIHFDVAHTAETHLHRSGRTARALNSG
YSIIMLSPNEMGQFNKLLFSLQKSESDVKDIQIKNIEYYEEVVKLAREIE
SQSHVTKTVVNNRNWFEKMAEKADIKLDDEIVEKKNAPSKKKTQEFEKKS
EALDLKIKYLDKIDLDFKSPLSGHVKIVSEESKFEPIATVTKFQSDPNTV
KKNSTNNKRKKPINDNILSENPGYKKMKNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR001650Helicase_C
IPR014001Helicase_ATP-bd
IPR011545DEAD/DEAH_box_helicase_dom
IPR027417P-loop_NTPase
IPR000629RNA-helicase_DEAD-box_CS
IPR014014RNA_helicase_DEAD_Q_motif
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0005524ATP binding
GO:0004386helicase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 366..447
e-value: 4.2E-21
score: 86.1
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 340..446
e-value: 5.3E-23
score: 81.5
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 340..487
score: 18.745
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 26..308
e-value: 7.4E-38
score: 141.8
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 39..294
score: 20.462
IPR011545DEAD/DEAH box helicase domainPFAMPF00270DEADcoord: 31..278
e-value: 2.2E-37
score: 128.5
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 325..566
e-value: 1.3E-42
score: 148.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 594..630
NoneNo IPR availablePANTHERPTHR24031:SF91ATP-DEPENDENT RNA HELICASE DDX24coord: 8..473
NoneNo IPR availablePANTHERPTHR24031RNA HELICASEcoord: 8..473
NoneNo IPR availableCDDcd17946DEADc_DDX24coord: 18..319
e-value: 3.64953E-93
score: 284.902
NoneNo IPR availableCDDcd18787SF2_C_DEADcoord: 327..456
e-value: 1.29494E-42
score: 147.654
IPR000629ATP-dependent RNA helicase DEAD-box, conserved sitePROSITEPS00039DEAD_ATP_HELICASEcoord: 227..235
IPR014014RNA helicase, DEAD-box type, Q motifPROSITEPS51195Q_MOTIFcoord: 7..35
score: 9.618
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 146..464
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 7..75