Guanine nucleotide-binding protein G(i) subunit alpha

Overview
NameGuanine nucleotide-binding protein G(i) subunit alpha
Smed IDSMED30032172
Length (bp)1292
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Guanine nucleotide-binding protein G(i) subunit alpha (SMED30032172) t-SNE clustered cells

Violin plots show distribution of expression levels for Guanine nucleotide-binding protein G(i) subunit alpha (SMED30032172) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Guanine nucleotide-binding protein G(i) subunit alpha (SMED30032172) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Guanine nucleotide-binding protein G(i) subunit alpha (SMED30032172) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032172

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30032172SMESG000005418.1 Contig3229GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30032172SMESG000005418.1 dd_Smed_v4_1773_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032172SMESG000005418.1 dd_Smed_v4_1773_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Human
Match: GNAI1 (G protein subunit alpha i1 [Source:HGNC Symbol;Acc:HGNC:4384])

HSP 1 Score: 407.527 bits (1046), Expect = 9.436e-141
Identity = 202/356 (56.74%), Postives = 259/356 (72.75%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC L   D+    E S  ID+ L+ + + + R VKLLLLG GESGKSTIVKQMK+I   G+S+ E   ++++++SNTIQS+I IIRAM +L I F +  R +DA+ L  LAG  E  G +  EL   +  LW+D G+Q CF RS EYQL DSA YYLN L+R++  NY+PT+QD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIF VAL++YDL L ED E+NRM ES++LFDS+CNN  F DT +ILFLNK+DLFE KIKKSPL+IC+ EYA  NTYE+A  YI+ +FE LNK + TK I+TH TCATDT NV+ VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCTLSAEDKAAV-ERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEE-GFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Human
Match: GNAI1 (G protein subunit alpha i1 [Source:HGNC Symbol;Acc:HGNC:4384])

HSP 1 Score: 407.527 bits (1046), Expect = 9.436e-141
Identity = 202/356 (56.74%), Postives = 259/356 (72.75%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC L   D+    E S  ID+ L+ + + + R VKLLLLG GESGKSTIVKQMK+I   G+S+ E   ++++++SNTIQS+I IIRAM +L I F +  R +DA+ L  LAG  E  G +  EL   +  LW+D G+Q CF RS EYQL DSA YYLN L+R++  NY+PT+QD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIF VAL++YDL L ED E+NRM ES++LFDS+CNN  F DT +ILFLNK+DLFE KIKKSPL+IC+ EYA  NTYE+A  YI+ +FE LNK + TK I+TH TCATDT NV+ VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCTLSAEDKAAV-ERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEE-GFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Human
Match: GNAI1 (G protein subunit alpha i1 [Source:HGNC Symbol;Acc:HGNC:4384])

HSP 1 Score: 407.527 bits (1046), Expect = 9.436e-141
Identity = 202/356 (56.74%), Postives = 259/356 (72.75%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC L   D+    E S  ID+ L+ + + + R VKLLLLG GESGKSTIVKQMK+I   G+S+ E   ++++++SNTIQS+I IIRAM +L I F +  R +DA+ L  LAG  E  G +  EL   +  LW+D G+Q CF RS EYQL DSA YYLN L+R++  NY+PT+QD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIF VAL++YDL L ED E+NRM ES++LFDS+CNN  F DT +ILFLNK+DLFE KIKKSPL+IC+ EYA  NTYE+A  YI+ +FE LNK + TK I+TH TCATDT NV+ VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCTLSAEDKAAV-ERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEE-GFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Human
Match: GNAI1 (G protein subunit alpha i1 [Source:HGNC Symbol;Acc:HGNC:4384])

HSP 1 Score: 407.527 bits (1046), Expect = 9.436e-141
Identity = 202/356 (56.74%), Postives = 259/356 (72.75%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC L   D+    E S  ID+ L+ + + + R VKLLLLG GESGKSTIVKQMK+I   G+S+ E   ++++++SNTIQS+I IIRAM +L I F +  R +DA+ L  LAG  E  G +  EL   +  LW+D G+Q CF RS EYQL DSA YYLN L+R++  NY+PT+QD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIF VAL++YDL L ED E+NRM ES++LFDS+CNN  F DT +ILFLNK+DLFE KIKKSPL+IC+ EYA  NTYE+A  YI+ +FE LNK + TK I+TH TCATDT NV+ VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCTLSAEDKAAV-ERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEE-GFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Human
Match: GNAI1 (G protein subunit alpha i1 [Source:HGNC Symbol;Acc:HGNC:4384])

HSP 1 Score: 407.527 bits (1046), Expect = 9.436e-141
Identity = 202/356 (56.74%), Postives = 259/356 (72.75%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC L   D+    E S  ID+ L+ + + + R VKLLLLG GESGKSTIVKQMK+I   G+S+ E   ++++++SNTIQS+I IIRAM +L I F +  R +DA+ L  LAG  E  G +  EL   +  LW+D G+Q CF RS EYQL DSA YYLN L+R++  NY+PT+QD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIF VAL++YDL L ED E+NRM ES++LFDS+CNN  F DT +ILFLNK+DLFE KIKKSPL+IC+ EYA  NTYE+A  YI+ +FE LNK + TK I+TH TCATDT NV+ VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCTLSAEDKAAV-ERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEE-GFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Celegans
Match: goa-1 (Guanine nucleotide-binding protein G(o) subunit alpha [Source:UniProtKB/Swiss-Prot;Acc:P51875])

HSP 1 Score: 375.17 bits (962), Expect = 2.488e-128
Identity = 188/355 (52.96%), Postives = 249/355 (70.14%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGL 1112
            MGC + + +E    E S  I+K LK +   + + +KLLLLG GESGKSTIVKQMK+I  +G +  +   ++ +++SNT+QSL+ I+RAMS L +SF + +R  DA+ ++ +   +E   P +EEL S+M  LW D G+Q+CF RS EYQL DSA+Y+L+ LERL  + Y PTEQDILRTRVKT GI+E    FK L  K+ DVGGQR+ERKKWIHCF++V AIIF VA++EYD  L ED   NRM ESL+LFDS+CNN  F DT +ILFLNK+DLFE KIKKSPL+ICF EY+    Y +A  YI+ +FE+ NK    K I+ H+TCATDT N++ VF+ +  ++I   L   GL
Sbjct:    1 MGCTMSQ-EERAALERSRMIEKNLKEDGMQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDYKQYKPVVYSNTVQSLVAILRAMSNLGVSFGSADREVDAKLVMDVVARMEDTEPFSEELLSSMKRLWGDAGVQDCFSRSNEYQLNDSAKYFLDDLERLGEAIYQPTEQDILRTRVKTTGIVEVHFTFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMHESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICFPEYSGRQDYHEASAYIQAQFEAKNK-SANKEIYCHMTCATDTTNIQFVFDAVTDVIIANNLRGCGL 353          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Celegans
Match: gpa-7 (Guanine nucleotide-binding protein alpha-7 subunit [Source:UniProtKB/Swiss-Prot;Acc:Q21917])

HSP 1 Score: 357.451 bits (916), Expect = 1.679e-121
Identity = 177/348 (50.86%), Postives = 247/348 (70.98%), Query Frame = 3
Query:   72 DEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGP-LNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGL 1112
            D+ E   ++ +ID+++K +   S RI+KLLLLG GESGKSTI+KQM+++  +G SQ +    R +++SN I S++ I+RAM  L I +  P+R+ D+Q +     TV +N   L EEL +AM  LW D G++EC++RS EYQ+ DSA+Y+L++L RLS+ NYVP+EQD+LRTR+KT GI E   E K L  +++DVGGQR+ERKKWIHCFDNV+AIIFI +L+EYD  LRED   NRM ESL+LFDS+CN+  F D   ILFLNK+DLF  KI +SPL++CF EY  +    + + YI++KFE LN+  Q + I+ H TCATDT+NV+ V +    ++I + L+  GL
Sbjct:    8 DQKEGKRLNRRIDEQIKKDQSMSLRIIKLLLLGAGESGKSTILKQMRILHKDGFSQQDLEMIRPVVYSNCIHSMLSILRAMFHLQIEYGEPDRVRDSQLVF---ATVHANKEELTEELAAAMQRLWHDPGVRECYRRSNEYQIDDSAKYFLDNLPRLSSPNYVPSEQDLLRTRIKTTGITEVLFELKGLTFRVIDVGGQRSERKKWIHCFDNVNAIIFISSLSEYDQTLREDNCTNRMQESLKLFDSICNSPWFADIHFILFLNKKDLFAEKIVRSPLTVCFPEYKGQQNQTECINYIQWKFEQLNRSSQRE-IYCHHTCATDTNNVQFVLDACLDMIIAKNLKSMGL 351          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Celegans
Match: gpa-16 (Guanine nucleotide-binding protein alpha-16 subunit [Source:UniProtKB/Swiss-Prot;Acc:Q9N2V6])

HSP 1 Score: 355.525 bits (911), Expect = 1.221e-120
Identity = 184/358 (51.40%), Postives = 250/358 (69.83%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKY---RQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGL 1112
            MGC + + DE  +   S KID+ LK + ++S R +KLLLLG GESGKSTI+KQM++I + G++  ER  FR +++ N I SL  II AM +L ISFT  +  +DA+ LL  + T E +  L EEL   M ++W D GIQ+  +RS EYQL DSA YYL+ L+R+   NY+PT+ DILRTR+KT GI+ET   +K+ +  + DVGGQR+ERKKWIHCF++V A+IF VAL+EYD+ L ED + NRM ESL+LFDS+CNN  F +T +ILFLNK+DLFE KI +SPL+ CF EY   N YE+A  YI+ +FE +NK     + + I+T  TCATDT+N++ VF+ +  I+I+  L   GL
Sbjct:    1 MGCIMSQEDEAAKRR-SKKIDRLLKEDGENSMRTIKLLLLGAGESGKSTILKQMRIIHDVGYTTEERKVFRGVVYGNIILSLNAIIHAMEQLKISFTTLDHESDARKLLMFSTTGEED-ELPEELVVLMKSVWSDSGIQKALERSREYQLNDSAGYYLSQLDRICAPNYIPTQDDILRTRIKTTGIVETQFVYKDRLFLVFDVGGQRSERKKWIHCFEDVTALIFCVALSEYDMVLVEDCQTNRMRESLKLFDSICNNKWFVETSIILFLNKKDLFEEKIVRSPLTHCFPEYTGANNYEEASAYIQQQFEDMNKRTTGEKNQEIYTQFTCATDTNNIRFVFDAVTDIIIRDNLRTCGL 356          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Celegans
Match: gpa-4 (Guanine nucleotide-binding protein alpha-4 subunit [Source:UniProtKB/Swiss-Prot;Acc:Q9BIG5])

HSP 1 Score: 349.747 bits (896), Expect = 2.935e-118
Identity = 179/362 (49.45%), Postives = 255/362 (70.44%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNE----ELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQT---KLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGL 1112
            MGC      E ++   S  ID++L+ + +     +KLLLLG GESGKSTIV+QM+++   G ++ E++ +R ++FSN +QS++ I++AM  L+ISFT+  R  DA+  +     V +N  L+E    EL   M  LW D G+++C +R+ EYQL DSAEYY N+L+R+S+S+Y+PT+ DILR RVK+ GI+ETT  +K+L  K+ DVGGQR+ERKKWIHCFD+V A+IF VAL+EYDLRL ED  +NRM ES++LFDS+ NN  F +T +ILFLNK D+FE +I+ +PL++CF EY    T  +  T+I+ +FE LNK RQT   K I++H TCATDT+N++ VF+ +  I+I+  L L GL
Sbjct:    1 MGCFHSTGSEAKKR--SKLIDEQLRHDHERCVGEIKLLLLGAGESGKSTIVRQMRILHETGFNKQEQMAYRPVVFSNMVQSMLAILKAMQPLNISFTDAAREEDARMFISHFLHV-NNAELSEAFSLELSDLMKQLWMDEGVKKCVKRAHEYQLNDSAEYYFNALDRISSSSYLPTQDDILRARVKSTGIVETTFMYKDLCFKMFDVGGQRSERKKWIHCFDSVTAVIFCVALSEYDLRLAEDQTMNRMHESMQLFDSIVNNCWFTETSIILFLNKMDIFEERIRYTPLTVCFPEYQGGMTITETSTFIQSRFEILNK-RQTPAQKEIYSHFTCATDTNNIRFVFDAVTDIIIRNNLYLCGL 358          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Celegans
Match: gpa-15 (Guanine nucleotide-binding protein alpha-15 subunit [Source:UniProtKB/Swiss-Prot;Acc:P91907])

HSP 1 Score: 311.227 bits (796), Expect = 2.652e-103
Identity = 149/355 (41.97%), Postives = 230/355 (64.79%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGL 1112
            MG     P+  EQ  I+  IDK+++ +        KLLLLGTGE GKSTI+KQ+ ++ ++G S+A+       ++SN IQ +  +++A        + PE   DAQ +L LA + +   P     ++A+  LW D  +Q+ F+R AE+Q++D+  Y++N L+R++N++Y+PT  D+LR R+ T G+++ T+E K    +I DVGGQR+ER+KWIH FDNV+A IFI A+NE++ +L ED + NRM ES++LF+++CN+  F    MILFLNKRDLFE K+K + +++ F  Y   N Y + V YI+ +FE LNKY   K I+TH+TCATDT+ ++ V + +  ++I R L   G+
Sbjct:    1 MGSTCSTPESKEQKRINSVIDKQIRKDEDDEIGNQKLLLLGTGECGKSTILKQINILHSSGFSKADLKNVAGTVYSNIIQGVATLLKAKDHFYYELSTPELDADAQHILSLADSSKDAMPFIPLTFNAIKRLWHDPVVQKTFERRAEFQMMDTLVYFMNELDRINNADYIPTVDDMLRIRIPTMGVVQQTIEIKGTKFRIYDVGGQRSERRKWIHLFDNVNATIFISAINEFNQKLNEDGQTNRMKESIKLFETICNSRWFVQAAMILFLNKRDLFEQKLKTTSINVLFSTYQGSNDYAECVAYIQMRFERLNKYSDIKKIYTHVTCATDTNQIQLVIDSVVDMVIGRNLRGTGM 355          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Fly
Match: Galphai (gene:FBgn0001104 transcript:FBtr0076934)

HSP 1 Score: 395.586 bits (1015), Expect = 2.379e-136
Identity = 199/356 (55.90%), Postives = 256/356 (71.91%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC +    + E  E S  ID+ L+ E + +   VKLLLLG GESGKSTIVKQMK+I + G+SQ E   +R ++FSNT+QSL+VIIRAM +L I F +P R + A+     A   +  G L  E+   M  LW D G+Q+ F RS EYQL DSA YYLNSL+R++  NY+PT+QD+LRTRVKT GIIET    K+L  K+ DVGGQR+ERKKWIHCF+ V AIIF VAL+ YDL L ED E+NRM+ESL+LFDS+CN+  F +T +ILFLNK+DLFE KIK+SPL+ICF EY   NT+E+A  YI+ KFE+LNK +  K I+TH+TCATDT+NVK VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCAVSTARDKEAIERSKNIDRALRAEGERAASEVKLLLLGAGESGKSTIVKQMKIIHDTGYSQEECEEYRRVVFSNTVQSLMVIIRAMGRLKIEFADPSRTDIARQFFTHASAADE-GILLPEIVLLMKKLWADGGVQQSFARSREYQLNDSAGYYLNSLDRIAQPNYIPTQQDVLRTRVKTTGIIETHFSCKQLHFKLFDVGGQRSERKKWIHCFEGVTAIIFCVALSGYDLVLAEDEEMNRMIESLKLFDSICNSKWFVETSIILFLNKKDLFEEKIKRSPLTICFPEYTGTNTFEEAANYIRMKFENLNKRKDQKEIYTHLTCATDTNNVKFVFDAVTDVIIKNNLKQIGLF 355          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Fly
Match: Galphao (gene:FBgn0001122 transcript:FBtr0088267)

HSP 1 Score: 375.941 bits (964), Expect = 1.395e-128
Identity = 188/355 (52.96%), Postives = 248/355 (69.86%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGL 1112
            MGC     +E    + S +I+K LK +   + + +KLLLLG GESGKSTIVKQMK+I  +G +  +   +R +++SNTIQSL+ I+RAM  L I ++N ER +DA+ +  +   +    P +EEL +AM  LWQD G+QECF RS EYQL DSA+Y+L+ L+RL   +Y PTEQDILRTRVKT GI+E    FK L  K+ DVGGQR+ERKKWIHCF++V AIIF VA++EYD  L ED   NRM ESL+LFDS+CNN  F DT +ILFLNK+DLFE KI+KSPL+ICF EY     Y +A  YI+ +FE+ NK   +K I+ H+TCATDT+N++ VF+ +  ++I   L   GL
Sbjct:    1 MGCTTS-AEERAAIQRSKQIEKNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDFKQYRPVVYSNTIQSLVAILRAMPTLSIQYSNNERESDAKMVFDVCQRMHDTEPFSEELLAAMKRLWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQEYGEAAAYIQAQFEAKNK-STSKEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRGCGL 353          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Fly
Match: Galphao (gene:FBgn0001122 transcript:FBtr0088269)

HSP 1 Score: 375.941 bits (964), Expect = 1.395e-128
Identity = 188/355 (52.96%), Postives = 248/355 (69.86%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGL 1112
            MGC     +E    + S +I+K LK +   + + +KLLLLG GESGKSTIVKQMK+I  +G +  +   +R +++SNTIQSL+ I+RAM  L I ++N ER +DA+ +  +   +    P +EEL +AM  LWQD G+QECF RS EYQL DSA+Y+L+ L+RL   +Y PTEQDILRTRVKT GI+E    FK L  K+ DVGGQR+ERKKWIHCF++V AIIF VA++EYD  L ED   NRM ESL+LFDS+CNN  F DT +ILFLNK+DLFE KI+KSPL+ICF EY     Y +A  YI+ +FE+ NK   +K I+ H+TCATDT+N++ VF+ +  ++I   L   GL
Sbjct:    1 MGCTTS-AEERAAIQRSKQIEKNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDFKQYRPVVYSNTIQSLVAILRAMPTLSIQYSNNERESDAKMVFDVCQRMHDTEPFSEELLAAMKRLWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQEYGEAAAYIQAQFEAKNK-STSKEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRGCGL 353          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Fly
Match: Galphao (gene:FBgn0001122 transcript:FBtr0088264)

HSP 1 Score: 375.941 bits (964), Expect = 1.395e-128
Identity = 188/355 (52.96%), Postives = 248/355 (69.86%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGL 1112
            MGC     +E    + S +I+K LK +   + + +KLLLLG GESGKSTIVKQMK+I  +G +  +   +R +++SNTIQSL+ I+RAM  L I ++N ER +DA+ +  +   +    P +EEL +AM  LWQD G+QECF RS EYQL DSA+Y+L+ L+RL   +Y PTEQDILRTRVKT GI+E    FK L  K+ DVGGQR+ERKKWIHCF++V AIIF VA++EYD  L ED   NRM ESL+LFDS+CNN  F DT +ILFLNK+DLFE KI+KSPL+ICF EY     Y +A  YI+ +FE+ NK   +K I+ H+TCATDT+N++ VF+ +  ++I   L   GL
Sbjct:    1 MGCTTS-AEERAAIQRSKQIEKNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDFKQYRPVVYSNTIQSLVAILRAMPTLSIQYSNNERESDAKMVFDVCQRMHDTEPFSEELLAAMKRLWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQEYGEAAAYIQAQFEAKNK-STSKEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRGCGL 353          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Fly
Match: Galphao (gene:FBgn0001122 transcript:FBtr0088268)

HSP 1 Score: 375.941 bits (964), Expect = 1.395e-128
Identity = 188/355 (52.96%), Postives = 248/355 (69.86%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGL 1112
            MGC     +E    + S +I+K LK +   + + +KLLLLG GESGKSTIVKQMK+I  +G +  +   +R +++SNTIQSL+ I+RAM  L I ++N ER +DA+ +  +   +    P +EEL +AM  LWQD G+QECF RS EYQL DSA+Y+L+ L+RL   +Y PTEQDILRTRVKT GI+E    FK L  K+ DVGGQR+ERKKWIHCF++V AIIF VA++EYD  L ED   NRM ESL+LFDS+CNN  F DT +ILFLNK+DLFE KI+KSPL+ICF EY     Y +A  YI+ +FE+ NK   +K I+ H+TCATDT+N++ VF+ +  ++I   L   GL
Sbjct:    1 MGCTTS-AEERAAIQRSKQIEKNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDFKQYRPVVYSNTIQSLVAILRAMPTLSIQYSNNERESDAKMVFDVCQRMHDTEPFSEELLAAMKRLWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQEYGEAAAYIQAQFEAKNK-STSKEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRGCGL 353          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Zebrafish
Match: gnaia (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide a [Source:ZFIN;Acc:ZDB-GENE-030131-2229])

HSP 1 Score: 404.831 bits (1039), Expect = 1.607e-139
Identity = 201/356 (56.46%), Postives = 262/356 (73.60%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC L   D+  Q E S  ID+ L+ + + + R VKLLLLG GESGKSTIVKQMK+I   G+S+ E   +R +++SNTIQS+I IIRAM +L I F +PER +DA+ L  +AG+V+  G +  EL   +  LW+D G++ CF RS EYQL DSA YYLN L+R+SNS+YVPT+QD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V +IIF V+L++YDL L ED E+NRM ES++LFDS+CNN  F DT +ILFLNK+DLFE KI+ SPLSICF EY   + YE+A  YI+ +FE LNK + TK I++H TCATDT NV+ VF+ +  ++I+  L+  GL 
Sbjct:   24 MGCTLSSDDKSAQ-ERSKMIDRNLRDDGEKASREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYRVVVYSNTIQSIIAIIRAMGRLRIDFADPERADDARQLFVMAGSVD-EGFMTSELAGVIKRLWRDEGVRLCFHRSREYQLNDSASYYLNDLDRISNSSYVPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTSIIFCVSLSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRMSPLSICFPEYPGSDVYEEAAAYIQCQFEDLNKRKDTKEIYSHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 377          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Zebrafish
Match: gnaia (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide a [Source:ZFIN;Acc:ZDB-GENE-030131-2229])

HSP 1 Score: 404.831 bits (1039), Expect = 1.607e-139
Identity = 201/356 (56.46%), Postives = 262/356 (73.60%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC L   D+  Q E S  ID+ L+ + + + R VKLLLLG GESGKSTIVKQMK+I   G+S+ E   +R +++SNTIQS+I IIRAM +L I F +PER +DA+ L  +AG+V+  G +  EL   +  LW+D G++ CF RS EYQL DSA YYLN L+R+SNS+YVPT+QD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V +IIF V+L++YDL L ED E+NRM ES++LFDS+CNN  F DT +ILFLNK+DLFE KI+ SPLSICF EY   + YE+A  YI+ +FE LNK + TK I++H TCATDT NV+ VF+ +  ++I+  L+  GL 
Sbjct:   24 MGCTLSSDDKSAQ-ERSKMIDRNLRDDGEKASREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYRVVVYSNTIQSIIAIIRAMGRLRIDFADPERADDARQLFVMAGSVD-EGFMTSELAGVIKRLWRDEGVRLCFHRSREYQLNDSASYYLNDLDRISNSSYVPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTSIIFCVSLSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRMSPLSICFPEYPGSDVYEEAAAYIQCQFEDLNKRKDTKEIYSHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 377          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Zebrafish
Match: gnai3 (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-070713-6])

HSP 1 Score: 404.06 bits (1037), Expect = 1.616e-139
Identity = 203/355 (57.18%), Postives = 257/355 (72.39%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGL 1112
            MGC L   D+    E S  ID+ L+ + + + R VKLLLLG GESGKSTIVKQMK+I  +G+S+ E   ++ +++SNTIQS+I IIRAM +L I F +P R +DA+ L  LAGT E  G +  +L   +  LW+D G+Q CF RS EYQL DSA YYLN LER+S   Y PT+QD+LRTRVKT GI+ET   FKEL  K+ DVGGQR+ERKKWIHCF+ V AIIF VAL++YDL L ED E+NRM ES++LFDS+CNN  F DT +ILFLNK+DLFE KIKKSPL+IC+ EY    TYE+A  YI+ +FE LNK ++TK I+TH TCATDT NV+ VF+ +  ++I+  L   GL
Sbjct:    1 MGCTLSTEDKAAM-EKSKMIDRTLREDGEKASREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGDPARADDARQLFVLAGTAE-EGVMTADLSGVIRRLWKDEGVQMCFVRSREYQLNDSAAYYLNDLERISQPTYTPTQQDVLRTRVKTTGIVETHFTFKELYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSVILFLNKKDLFEDKIKKSPLTICYPEYCGTCTYEEAAAYIQCQFEDLNKRKETKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLIECGL 353          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Zebrafish
Match: gnai1 (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1310])

HSP 1 Score: 403.675 bits (1036), Expect = 2.698e-139
Identity = 200/356 (56.18%), Postives = 259/356 (72.75%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC L   D+    E S  ID+ L+ + + + R VKLLLLG GESGKSTIVKQMK+I   G+S+ E   ++++++SNTIQS+I IIRAM +L I F +  R +DA+ L  LAG+ E  G +  EL   +  LW+D G+Q CF RS EYQL DSA YYLN L+R+S + Y+PT+QD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIF VAL++YDL L ED E+NRM ES++LFDS+CNN  F DT +ILFLNK+DLFE KI+KS L+IC+ EYA  NTYE+A  YI+ +FE LNK + TK I+TH TCATDT NV+ VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCTLSTEDKAAV-ERSKMIDRNLRDDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDAARADDARQLFVLAGSAE-EGFMTAELAGVIKRLWKDGGVQACFSRSREYQLNDSAAYYLNDLDRISQATYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRKSTLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Zebrafish
Match: gnai2b (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5861])

HSP 1 Score: 401.364 bits (1030), Expect = 2.122e-138
Identity = 195/356 (54.78%), Postives = 259/356 (72.75%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC +   D+    E S  IDK L+ + + + R VKLLLLG GESGKSTIVKQMK+I  +G+S+ E   +R++++SNTIQS++ II+AMS L I +    R++DA+ L  L+   E  G L ++L + +  LW D G+Q CF RS EYQL DSA YYLN L+R++ S+Y+PT+QD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIF VAL+ YDL L ED E+NRM ES++LFDS+CNN  F +T +ILFLNK+DLFE KI +SPL+ICF EY+  N Y++A +YI+ KFE LNK + TK I+TH TCATDT NV+ VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCTVSAEDKAAA-ERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYRAVVYSNTIQSIMAIIKAMSNLKIDYGESARVDDARQLFALSAAAEEQGILTDDLANVIRRLWADSGVQGCFSRSREYQLNDSAAYYLNDLDRIARSDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKITRSPLTICFPEYSGANKYDEAASYIQTKFEDLNKKKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 355          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Xenopus
Match: gnai2 (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 [Source:NCBI gene;Acc:394861])

HSP 1 Score: 411.764 bits (1057), Expect = 2.269e-142
Identity = 202/356 (56.74%), Postives = 259/356 (72.75%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC +   D+    E S  IDK L+ + + + R VKLLLLG GESGKSTIVKQMK+I  +G+S+ E   +R+++FSNTIQS++ II+AM  L I F +P R +DA+ L  L+ T E  G L ++L   +  LW D G+Q CF RS EYQL DSA YYLN LER++ S+YVPT+QD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIF VAL+ YDL L ED E+NRM ES++LFDS+CNN  F +T +ILFLNK+DLFE KI +SPLSICF EY+  N Y++A +YI+ KFE LNK R TK I+TH TCATDT NV+ VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCTVSAEDKAAA-ERSKNIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECRQYRAVVFSNTIQSIMAIIKAMGNLKIDFGDPARADDARQLFALSSTAEEQGILPDDLAGVIRRLWADPGVQACFSRSREYQLNDSAAYYLNDLERIARSDYVPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKITRSPLSICFPEYSGANQYDEAASYIQTKFEDLNKRRDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 355          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Xenopus
Match: gnai1 (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 [Source:NCBI gene;Acc:100038283])

HSP 1 Score: 406.371 bits (1043), Expect = 3.380e-140
Identity = 200/356 (56.18%), Postives = 260/356 (73.03%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC L   D+    E S  ID+ L+ + + + R VKLLLLG GESGKSTIVKQMK+I   G+S+ E   ++++++SNTIQS+I IIRAM +L I F +P R +DA+ L  LAG  E  G +  EL   +  LW+D G+Q CF RS EYQL DSA YYLN L+R++ ++Y+PT+QD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIF VAL++YDL L ED E+NRM ES++LFDS+CNN  F DT +ILFLNK+DLFE KIK+SPL+IC+ EY   NTYE+A  YI+ +FE LNK + TK I+TH TCATDT NV+ VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCTLSAEDKAAV-ERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDPSRADDARQLFVLAGAAEE-GFMTAELAGVIKRLWKDGGVQACFNRSREYQLNDSAAYYLNDLDRIAQNSYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYPGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Xenopus
Match: gnai1 (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 [Source:NCBI gene;Acc:100038283])

HSP 1 Score: 405.986 bits (1042), Expect = 1.607e-139
Identity = 200/356 (56.18%), Postives = 260/356 (73.03%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC L   D+    E S  ID+ L+ + + + R VKLLLLG GESGKSTIVKQMK+I   G+S+ E   ++++++SNTIQS+I IIRAM +L I F +P R +DA+ L  LAG  E  G +  EL   +  LW+D G+Q CF RS EYQL DSA YYLN L+R++ ++Y+PT+QD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIF VAL++YDL L ED E+NRM ES++LFDS+CNN  F DT +ILFLNK+DLFE KIK+SPL+IC+ EY   NTYE+A  YI+ +FE LNK + TK I+TH TCATDT NV+ VF+ +  ++I+  L+  GL 
Sbjct:   44 MGCTLSAEDKAAV-ERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDPSRADDARQLFVLAGAAE-EGFMTAELAGVIKRLWKDGGVQACFNRSREYQLNDSAAYYLNDLDRIAQNSYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYPGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 397          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Xenopus
Match: rgp1 (RGP1 homolog, RAB6A GEF complex partner 1 [Source:Xenbase;Acc:XB-GENE-997629])

HSP 1 Score: 397.512 bits (1020), Expect = 7.944e-137
Identity = 196/355 (55.21%), Postives = 258/355 (72.68%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGL 1112
            MGC L   D+    E S  ID+ L+ + + + + VKLLLLG GESGKSTIVKQMK+I  +G+S+ E   ++ +++SNTIQS+I IIRAM +L I F +  R +DA+ L  LA + E  G ++ EL   +  LW+D G+Q CF RS EYQL DSA YYLN +ER++  NY+PT+QD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIF VAL++YDL L ED E+NRM ES++LFDS+CNN  F DT +ILFLNK+DLFE KI +SPL+IC+ EY+  NTYE+A  YI+ +FE LN+ + TK I+TH TCATDT NV+ VF+ +  ++I+  L   GL
Sbjct:    1 MGCTLSAEDKAAA-ERSKMIDRNLREDGEKASKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECRQYKVVVYSNTIQSIIAIIRAMGRLRIDFGDVARADDARQLFVLASSAE-EGVMSPELAGVIQRLWEDPGVQACFSRSREYQLNDSASYYLNDIERIAQVNYIPTQQDVLRTRVKTTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLLLAEDEEMNRMHESMKLFDSICNNKWFIDTSIILFLNKKDLFEEKISRSPLTICYPEYSGSNTYEEAAAYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKSNLMECGL 353          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Xenopus
Match: gnao1 (G protein subunit alpha o1 [Source:NCBI gene;Acc:549749])

HSP 1 Score: 381.333 bits (978), Expect = 2.263e-130
Identity = 192/355 (54.08%), Postives = 251/355 (70.70%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGL 1112
            MGC L   +E    E S +I+K LK +   + + VKLLLLG GESGKSTIVKQMK+I  +G S  +   ++ +++SNTIQSL  I+RAM  L I + + ER  DA+ +  +   +E   P + EL SAM+ LW D GIQECF RS EYQL DSA+YYL+SL+R+  ++Y PTEQDILRTRVKT GI+ET   FK L  ++ DVGGQR+ERKKWIHCF++V AIIF VAL+ YD  L ED   NRM ESL+LFDS+CNN  F DT +ILFLNK+D+F+ KIK SPL+ICF +Y   N++ +AV +I+ ++ES NK  QTK I+TH+TCATDT N++ VF+ +  ++I   L   GL
Sbjct:    1 MGCTLS-AEERAALERSKQIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERRADAKMVCDVVSRMEDTEPFSPELLSAMMRLWADSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLKLFDSICNNKWFTDTSIILFLNKKDIFQEKIKSSPLTICFPDYTGPNSFTEAVAHIQHQYESRNK-SQTKEIYTHVTCATDTQNIQFVFDAVTDVIIANNLRGCGL 353          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Mouse
Match: Gnai1 (guanine nucleotide binding protein (G protein), alpha inhibiting 1 [Source:MGI Symbol;Acc:MGI:95771])

HSP 1 Score: 407.527 bits (1046), Expect = 6.478e-141
Identity = 202/356 (56.74%), Postives = 259/356 (72.75%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC L   D+    E S  ID+ L+ + + + R VKLLLLG GESGKSTIVKQMK+I   G+S+ E   ++++++SNTIQS+I IIRAM +L I F +  R +DA+ L  LAG  E  G +  EL   +  LW+D G+Q CF RS EYQL DSA YYLN L+R++  NY+PT+QD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIF VAL++YDL L ED E+NRM ES++LFDS+CNN  F DT +ILFLNK+DLFE KIKKSPL+IC+ EYA  NTYE+A  YI+ +FE LNK + TK I+TH TCATDT NV+ VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCTLSAEDKAAV-ERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEE-GFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Mouse
Match: Gnai3 (guanine nucleotide binding protein (G protein), alpha inhibiting 3 [Source:MGI Symbol;Acc:MGI:95773])

HSP 1 Score: 405.986 bits (1042), Expect = 3.149e-140
Identity = 199/355 (56.06%), Postives = 259/355 (72.96%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGL 1112
            MGC L   D+    E S  ID+ L+ + + + + VKLLLLG GESGKSTIVKQMK+I  +G+S+ E   ++ +++SNTIQS+I IIRAM +L I F    R +DA+ L  LAG+ E  G +  EL   +  LW+D G+Q CF RS EYQL DSA YYLN L+R+S +NY+PT+QD+LRTRVKT GI+ET   FKEL  K+ DVGGQR+ERKKWIHCF+ V AIIF VAL++YDL L ED E+NRM ES++LFDS+CNN  F DT +ILFLNK+DLFE KIK+SPL+IC+ EY   NTYE+A  YI+ +FE LN+ + TK ++TH TCATDT NV+ VF+ +  ++I+  L+  GL
Sbjct:    1 MGCTLSAEDKAAV-ERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGESARADDARQLFVLAGSAE-EGVMTSELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQTNYIPTQQDVLRTRVKTTGIVETHFTFKELYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEVYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGL 353          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Mouse
Match: Gnai2 (guanine nucleotide binding protein (G protein), alpha inhibiting 2 [Source:MGI Symbol;Acc:MGI:95772])

HSP 1 Score: 404.06 bits (1037), Expect = 1.886e-139
Identity = 197/356 (55.34%), Postives = 257/356 (72.19%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC +   D+    E S  IDK L+ + + + R VKLLLLG GESGKSTIVKQMK+I  +G+S+ E   +R++++SNTIQS++ I++AM  L I F +P+R +DA+ L  L+   E  G L E+L   +  LW D G+Q CF RS EYQL DSA YYLN LER++ S+Y+PT+QD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIF VAL+ YDL L ED E+NRM ES++LFDS+CNN  F DT +ILFLNK+DLFE KI +S L+ICF EY   N Y++A +YI+ KFE LNK + TK I+TH TCATDT NV+ VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCTVSAEDKAAA-ERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPQRADDARQLFALSCAAEEQGMLPEDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITQSSLTICFPEYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 355          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Mouse
Match: Gnai2 (guanine nucleotide binding protein (G protein), alpha inhibiting 2 [Source:MGI Symbol;Acc:MGI:95772])

HSP 1 Score: 404.06 bits (1037), Expect = 1.886e-139
Identity = 197/356 (55.34%), Postives = 257/356 (72.19%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC +   D+    E S  IDK L+ + + + R VKLLLLG GESGKSTIVKQMK+I  +G+S+ E   +R++++SNTIQS++ I++AM  L I F +P+R +DA+ L  L+   E  G L E+L   +  LW D G+Q CF RS EYQL DSA YYLN LER++ S+Y+PT+QD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIF VAL+ YDL L ED E+NRM ES++LFDS+CNN  F DT +ILFLNK+DLFE KI +S L+ICF EY   N Y++A +YI+ KFE LNK + TK I+TH TCATDT NV+ VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCTVSAEDKAAA-ERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPQRADDARQLFALSCAAEEQGMLPEDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITQSSLTICFPEYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 355          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Mouse
Match: Gnao1 (guanine nucleotide binding protein, alpha O [Source:MGI Symbol;Acc:MGI:95775])

HSP 1 Score: 377.481 bits (968), Expect = 4.401e-129
Identity = 194/355 (54.65%), Postives = 245/355 (69.01%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGL 1112
            MGC L   +E    E S  I+K LK +   + + VKLLLLG GESGKSTIVKQMK+I  +G S  +   ++ +++SNTIQSL  I+RAM  L + + + ER  D++ +  +   +E   P + EL SAM+ LW D GIQECF RS EYQL DSA+YYL+SL+R+   +Y PTEQDILRTRVKT GI+ET   FK L  ++ DVGGQR+ERKKWIHCF++V AIIF VAL+ YD  L ED   NRM ESL LFDS+CNN  F DT +ILFLNK+DLF  KIKKSPL+ICF EY   NTYE A  YI+ +FES N+    K I+ H+TCATDT+N++ VF+ +  I+I   L   GL
Sbjct:    1 MGCTL-SAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGVEYGDKERKTDSKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAGDYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYPGSNTYEDAAAYIQTQFESKNR-SPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGL 353          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. UniProt/SwissProt
Match: sp|P30682|GNAI_LYMST (Guanine nucleotide-binding protein G(i) subunit alpha OS=Lymnaea stagnalis OX=6523 PE=2 SV=3)

HSP 1 Score: 423.32 bits (1087), Expect = 3.180e-146
Identity = 205/356 (57.58%), Postives = 267/356 (75.00%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC   + D+    E S +IDK L+++ + + R VKLLLLG GESGKSTIVKQMK+I   G+SQ E L ++ +++SN IQS+I II+AM +L I F +P+R  DA+    LAG  +  G ++ EL   M  LW+D+G+QECF RS EYQL DSAEYYLN+L+R+S   Y+PTEQD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIFIVA++EYDL L ED E+NRMMES++LFDS+CNN  F +T +ILFLNK+DLFE KIKKSPL+ICF EY   NTYE+A  YI+ +FE+LNK + TK I++H TCATDT+NV+ VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCVTSQEDKAAV-ERSKQIDKSLRMDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEKGYSQEECLQYKPVVYSNAIQSMIAIIKAMGQLKIQFGHPDRAEDARQFFALAGHAD-EGEMSAELSGIMKRLWKDVGVQECFSRSREYQLNDSAEYYLNALDRISAPGYIPTEQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFIVAMSEYDLTLAEDQEMNRMMESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKKSPLTICFPEYTGANTYEEAAAYIQLQFENLNKKKDTKEIYSHFTCATDTNNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. UniProt/SwissProt
Match: sp|P51876|GNAI_PLATR (Guanine nucleotide-binding protein G(i) subunit alpha OS=Planorbella trivolvis OX=283763 PE=2 SV=2)

HSP 1 Score: 421.394 bits (1082), Expect = 2.170e-145
Identity = 204/356 (57.30%), Postives = 267/356 (75.00%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC   + D+    E S +IDK L+++ + + R VKLLLLG GESGKSTIVKQMK+I   G+SQ E L +  +++SN IQS+I II+AM +L I F +P+R  +A+    LAG  +  G +++EL   M  LW+D+G+QECF RS EYQL DSAEYYLN+L+R+S   Y+PTEQD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIFIVA++EYDL L ED E+NRMMES++LFDS+CNN  F +T +ILFLNK+DLFE KIKKSPL+ICF EY   NTYE+A  YI+ +FE+LNK + TK I++H TCATDT+NV+ VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCVTSQEDKAAV-ERSKQIDKSLRMDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEKGYSQEECLQYNPVVYSNAIQSMIAIIKAMGQLKIQFGHPDRAEEARQFFALAGHADE-GEMSQELSGIMKRLWKDVGVQECFSRSREYQLNDSAEYYLNALDRISAPGYIPTEQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFIVAMSEYDLTLAEDQEMNRMMESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKKSPLTICFPEYTGANTYEEAAAYIQLQFENLNKKKDTKEIYSHFTCATDTNNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. UniProt/SwissProt
Match: sp|P38401|GNAI1_CAVPO (Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Cavia porcellus OX=10141 GN=GNAI1 PE=2 SV=3)

HSP 1 Score: 408.297 bits (1048), Expect = 2.656e-140
Identity = 202/356 (56.74%), Postives = 259/356 (72.75%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC L   D+    E S  ID+ L+ + + + R VKLLLLG GESGKSTIVKQMK+I   G+S+ E   ++++++SNTIQS+I IIRAM +L I F +  R +DA+ L  LAG  E  G +  EL   +  LW+D G+Q CF RS EYQL DSA YYLN L+R++ SNY+PT+QD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIF VAL++YDL L ED E+NRM ES++LFDS+CNN  F DT +ILFLNK+DLFE KIKKSPL+IC+ EY   NTYE+A  YI+ +FE LNK + TK I+TH TCATDT NV+ VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCTLSAEDKAAV-ERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEE-GFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQSNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. UniProt/SwissProt
Match: sp|P10824|GNAI1_RAT (Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Rattus norvegicus OX=10116 GN=Gnai1 PE=1 SV=3)

HSP 1 Score: 407.912 bits (1047), Expect = 3.604e-140
Identity = 202/356 (56.74%), Postives = 259/356 (72.75%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC L   D+    E S  ID+ L+ + + + R VKLLLLG GESGKSTIVKQMK+I   G+S+ E   ++++++SNTIQS+I IIRAM +L I F +  R +DA+ L  LAG  E  G +  EL   +  LW+D G+Q CF RS EYQL DSA YYLN L+R++  NY+PT+QD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIF VAL++YDL L ED E+NRM ES++LFDS+CNN  F DT +ILFLNK+DLFE KIKKSPL+IC+ EYA  NTYE+A  YI+ +FE LNK + TK I+TH TCATDT NV+ VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCTLSAEDKAAV-ERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDAARADDARQLFVLAGAAEE-GFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. UniProt/SwissProt
Match: sp|P38403|GNAI3_CAVPO (Guanine nucleotide-binding protein G(i) subunit alpha OS=Cavia porcellus OX=10141 GN=GNAI3 PE=2 SV=3)

HSP 1 Score: 407.912 bits (1047), Expect = 4.019e-140
Identity = 200/355 (56.34%), Postives = 260/355 (73.24%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGL 1112
            MGC L   D+    E S  ID+ L+ + + + + VKLLLLG GESGKSTIVKQMK+I  +G+S+ E   ++ +++SNTIQS+I IIRAM +L I F  P R +DA+ L  LAG+ E  G +  EL   +  LW+D G+Q CF RS EYQL DSA YYLN L+R+S +NY+PT+QD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIF VAL++YDL L ED E+NRM ES++LFDS+CNN  F DT +ILFLNK+DLFE KIK+SPL+IC+ EY   NTYE+A  YI+ +FE LN+ + TK I+TH TCATDT NV+ VF+ +  ++I+  L+  GL
Sbjct:    1 MGCTLSAEDKAAV-ERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEPARADDARQLFVLAGSAE-EGLMTSELAGVIRRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQTNYIPTQQDVLRTRVKTTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGL 353          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. TrEMBL
Match: A0A1S3H3V1 (guanine nucleotide-binding protein G(I) subunit alpha isoform X1 OS=Lingula unguis OX=7574 GN=LOC106151815 PE=4 SV=1)

HSP 1 Score: 431.795 bits (1109), Expect = 3.679e-147
Identity = 212/356 (59.55%), Postives = 268/356 (75.28%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC     D+ +Q E S  IDK L+ + + + R VKLLLLG GESGKSTIVKQMK+I + G+SQ E L ++ +++SNTIQS+I IIRAM +L I F +P+R +DA+ L  LAG+   +G L+ +L + M  LW+D G+QECF RS EYQL DSAEYYLN+L+R+S  NYVPTEQD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIFIVA++EYDL L ED E+NRMMES++LFDS+CNN  F DT +ILFLNK+DLF  KIKKSPLSICF EY   NTYE A  YI+ +FE LNK  +TK I+ H TCATDT+NV+ VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCTQSSEDK-QQFERSKAIDKALRADGERAAREVKLLLLGAGESGKSTIVKQMKIIHDKGYSQEECLQYKPVVYSNTIQSMIAIIRAMGQLKIDFGHPDRADDARMLFSLAGS--DDGELSPDLAAVMKRLWKDSGVQECFSRSREYQLNDSAEYYLNALDRISQPNYVPTEQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFIVAMSEYDLTLAEDQEMNRMMESMKLFDSICNNKWFTDTSIILFLNKKDLFSEKIKKSPLSICFSEYQGPNTYEDAAAYIQLQFEKLNKRAETKDIYCHFTCATDTNNVQFVFDAVTDVIIKNNLKDCGLF 353          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. TrEMBL
Match: R7V8M3 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_178654 PE=4 SV=1)

HSP 1 Score: 428.713 bits (1101), Expect = 8.362e-146
Identity = 209/356 (58.71%), Postives = 266/356 (74.72%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC +   D+  Q E S  IDK L+ + + + R VKLLLLG GESGKSTIVKQMK+I   G+S  E L ++ +++SNTIQS+I IIR+M +L I F +P+R  DA+ L  LAG  E  G L ++L + M  LW+D G+QECF RS EYQL DSAEYYLN+L+R+S   YVPTEQD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIFIV ++EYDL L ED E+NRMMES++LFDS+CNN  F DT +ILFLNK+DLFE KIKKSPL+ICF E+   NTYE+A  YI+ +FE+LNK + TK I+TH TCATDT+NV+ VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCAVSNDDKAAQ-ERSKAIDKGLRADGEKASREVKLLLLGAGESGKSTIVKQMKIIHEKGYSSEECLQYKPVVYSNTIQSMIAIIRSMGQLKIDFGHPDRAEDARQLFALAGNAEE-GDLTQDLAAIMKRLWKDSGVQECFSRSREYQLNDSAEYYLNALDRISQQGYVPTEQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFIVGMSEYDLTLAEDQEMNRMMESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICFPEFTGSNTYEEAAAYIQMQFENLNKRKDTKEIYTHFTCATDTNNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. TrEMBL
Match: V4AZH1 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_226384 PE=4 SV=1)

HSP 1 Score: 428.328 bits (1100), Expect = 1.040e-145
Identity = 208/356 (58.43%), Postives = 269/356 (75.56%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC     D++   E S +IDK LK + + S R VKLLLLG GESGKSTIVKQMK+I   G+SQ E L ++ +++SNTIQS+I IIRAM  L I F +P+R  DA+    LAG  +  G L+ E+ + M  LW+D G+QECF RS EYQL DSAEYYLN+++R+S++ Y+PTEQD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIFIVA++EYDL L ED E+NRMMES++LFDS+CNN  F DT +ILFLNK+DLFE KIKKSPL++CF E++  NTYE+A  YI+ +FE+LNK + TK I+TH TCATDT+NV+ VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCVTSSEDKVAM-ERSKQIDKGLKADGEKSSREVKLLLLGAGESGKSTIVKQMKIIHEKGYSQEECLQYKPVVYSNTIQSMIAIIRAMGLLKIDFGHPDRAEDARKFFSLAGNAD-EGELSPEVATIMKKLWKDSGVQECFSRSREYQLNDSAEYYLNAMDRISHTGYIPTEQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFIVAMSEYDLTLAEDQEMNRMMESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTVCFPEFSGSNTYEEAAAYIQMQFENLNKRKDTKEIYTHFTCATDTNNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. TrEMBL
Match: A0A2T7NTY3 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_15090 PE=4 SV=1)

HSP 1 Score: 424.091 bits (1089), Expect = 5.583e-144
Identity = 207/355 (58.31%), Postives = 266/355 (74.93%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGL 1112
            MGC   + D+    E S  IDK L+ + + + R VKLLLLG GESGKSTIVKQMK+I   G++Q E L ++ +++SN  QS+I IIRAM++L I F +P+R  DA+  L LAG  +  G ++ EL + M  LW+D GIQECF R+ EYQL DSAEYYLN+L+R+S   Y+PTEQD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIFIVA++EYDL L ED E+NRMMES++LFDS+CNN  F DT +ILFLNK+DLFE KIKKSPL+ICF EY   NTYE+A  YI+ +FE+LNK + TK I+TH TCATDT+NV+ VF+ +  ++I+  L+  GL
Sbjct:    1 MGCVTSQEDKAAM-ERSKAIDKTLRADGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEKGYTQEECLQYKPVVYSNATQSMIAIIRAMNQLKIEFGHPDRAEDARQFLALAGNADE-GEMSPELAAMMKRLWKDSGIQECFSRAREYQLNDSAEYYLNALDRISAPGYIPTEQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFIVAMSEYDLTLAEDQEMNRMMESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICFPEYTGANTYEEAAAYIQLQFENLNKKKDTKEIYTHFTCATDTNNVQFVFDAVTDVIIKNNLKDCGL 353          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. TrEMBL
Match: A0A2H4WCW2 (Gi-alpha OS=Argopecten irradians OX=31199 GN=Gi-alpha PE=2 SV=1)

HSP 1 Score: 422.935 bits (1086), Expect = 1.212e-143
Identity = 207/356 (58.15%), Postives = 269/356 (75.56%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC +   D+    E S +IDK L+ + + + R VKLLLLG GESGKSTIVKQMK+I   G+SQ E L ++ +++SN IQS++ IIRAM +L I F +P+R  DA+ L  L    +  G L+ EL + M  LW+D G+QECF RS EYQL DSAEYYL+SL+R+S S Y+PTEQD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIFIVA++EYDL L ED E+NRMMES++LFDS+CNN  F DT +ILFLNK+DLFE KI+KSPL+ICF E++ EN YE+A TYI+ +FE+LNK ++TK I+TH TCATDT+NV+ VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCAVSADDKAAV-ERSKQIDKTLRQDREKAAREVKLLLLGAGESGKSTIVKQMKIIHEKGYSQEECLQYKPVVYSNAIQSMMAIIRAMGQLKIEFGHPDRAEDARQLFALTNNTDE-GELSSELAAIMKRLWKDSGVQECFGRSREYQLNDSAEYYLSSLDRISQSGYIPTEQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFIVAMSEYDLTLVEDQEMNRMMESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRKSPLTICFPEFSGENNYEQAATYIQVQFENLNKRKETKEIYTHFTCATDTNNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Cavefish
Match: gnaia (guanine nucleotide-binding protein G(i) subunit alpha-1 [Source:NCBI gene;Acc:103035761])

HSP 1 Score: 409.838 bits (1052), Expect = 7.711e-142
Identity = 201/356 (56.46%), Postives = 264/356 (74.16%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC L   D++ Q E S  ID+ L+ + + + R VKLLLLG GESGKSTIVKQMK+I   G+S+ E   ++++++SNTIQS+I IIRAM +L I F++  R +DA+ L  LAG+ E  G +  EL   +  LW+D G+Q CF RS EYQL DSA YYLN L+R+S++ YVPT+QD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIF V+L++YDL L ED E+NRM ES++LFDS+CNN  F +T +ILFLNK+DLFE KIK+SPL+IC+ EYA  NTYE+A  YI+ +FE LNK + TK I+TH TCATDT NV+ VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCTLSSEDKVAQ-ERSKMIDRNLRDDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFSDAARADDARQLFVLAGSAE-EGYMTGELAGIIQRLWKDGGVQACFSRSREYQLNDSASYYLNDLDRISSAAYVPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVSLSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Cavefish
Match: gnai2b (guanine nucleotide-binding protein G(i) subunit alpha-2 [Source:NCBI gene;Acc:111193748])

HSP 1 Score: 398.667 bits (1023), Expect = 1.915e-137
Identity = 194/356 (54.49%), Postives = 258/356 (72.47%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC +   D+    E S  IDK L+ + + + R VKLLLLG GESGKSTIVKQMK+I  +G+S+ E   +R++++SNTIQS++ II+AM  L I +++  R +DA+ L  L+   E  G L ++L + +  LW D G+Q CF RS EYQL DSA YYLN LER++ ++Y+PT+QD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIF VAL+ YDL L ED E+NRM ES++LFDS+CNN  F +T +ILFLNK+DLFE KI  SPL+ICF EY+  N Y++A +YI+ KFE LNK + TK I+TH TCATDT NV+ VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCTVSAEDKAAA-ERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYRAVVYSNTIQSIMAIIKAMGNLKIEYSDASRADDARQLFALSAAAEEQGILPDDLSNVIRRLWADSGVQGCFGRSREYQLNDSAAYYLNDLERIARADYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKITSSPLNICFPEYSGANKYDEAASYIQTKFEDLNKKKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 355          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Cavefish
Match: gnai2a (guanine nucleotide-binding protein G(i) subunit alpha-2 [Source:NCBI gene;Acc:103033963])

HSP 1 Score: 383.645 bits (984), Expect = 1.777e-131
Identity = 195/356 (54.78%), Postives = 257/356 (72.19%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC + + D+    E S  IDK L+ + + + + VKLLLLG GESGKSTIVKQMK+I  +G+S+ E   +R+++FSNTIQS++ II+AMS L I + +P R +DA+ L  LA   E  G L E+L SA+  LW D G+Q CF RS EYQL DSA YYLN L+R++ SNY+P++ D+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIF VA++ YDL L ED E+NRM ES++LFDS+CNN  F +T +ILFLNK+DLFE KI  SPL+ICF EY   + Y++A  YI+ KFE LNK + TK I++H TCATDT N++ VF+ +  ++I+  L   GL 
Sbjct:    1 MGCTVSQEDKAAA-ERSRHIDKSLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECRQYRAVVFSNTIQSIMAIIKAMSNLKIDYEDPARADDARQLFALAAAAEEQGALPEDLSSAITRLWSDAGVQSCFTRSREYQLNDSAAYYLNDLDRIAMSNYIPSQPDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVAMSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIAHSPLTICFPEYTGASKYDEASEYIRTKFEDLNKKKDTKEIYSHFTCATDTKNIQFVFDAVTDVIIKNNLRDCGLF 355          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Cavefish
Match: ENSAMXT00000018576.2 (pep primary_assembly:Astyanax_mexicanus-2.0:7:25573287:25606043:1 gene:ENSAMXG00000018022.2 transcript:ENSAMXT00000018576.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 375.941 bits (964), Expect = 1.175e-128
Identity = 181/312 (58.01%), Postives = 234/312 (75.00%), Query Frame = 3
Query:  180 SGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            SGKSTIVKQMK+I   G+S+ E   ++++++SNTIQS+I IIRAM +L I F +  R +DA+ L  LAG+ E  G +  EL   +  LW+D G+Q CF RS EYQL DSA YYLN L+R+S + Y+PT+QD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIF VAL++YDL L ED E+NRM ES++LFDS+CNN  F DT +ILFLNK+DLFE KIK+SPL+IC+ EYA  NTYE+A  YI+ +FE LNK + TK I+TH TCATDT NV+ VF+ +  ++I+  L+  GL 
Sbjct:   39 SGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDAARADDARQLFVLAGSAEE-GFMTAELAGVIKRLWKDGGVQACFSRSREYQLNDSAAYYLNDLDRISQTTYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 349          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Cavefish
Match: gnao1a (G protein subunit alpha o1 [Source:NCBI gene;Acc:103039135])

HSP 1 Score: 374.785 bits (961), Expect = 4.564e-128
Identity = 192/355 (54.08%), Postives = 245/355 (69.01%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGL 1112
            MGC L   +E    + S  I+K LK +   + + VKLLLLG GESGKSTIVKQMK+I  +G S  +   ++ +++SNTIQSL  I+RAM  L + + + ER  DA+ +  +   +E   P + EL +AM+ LW D GIQECF R+ EYQL DSA+YYL+SL+R+  ++Y PTEQDILRTRVKT GI+ET   FK L  ++ DVGGQR+ERKKWIHCF++V AIIF VAL+ YD  L ED   NRM ESL LFDS+CNN  F DT +ILFLNK+DLF  KIKKSPLSICF EY   NTY+ A  YI+ +FES N+    K I+ H+TCATDT N++ VF+ +  I+I   L   GL
Sbjct:    1 MGCTLS-AEERAALDRSKAIEKNLKEDGITAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGDDVKQYKPVVYSNTIQSLAAIVRAMDTLGLEYGDKERKADAKMVCDVVSRMEDTEPYSPELLTAMMRLWADSGIQECFSRAREYQLNDSAQYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFAEKIKKSPLSICFPEYTGPNTYDDAAAYIQAQFESKNR-SPNKEIYCHMTCATDTGNIQVVFDAVTDIIIANNLRGCGL 353          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Sea Lamprey
Match: gnai3 (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-070713-6])

HSP 1 Score: 393.66 bits (1010), Expect = 3.204e-136
Identity = 196/356 (55.06%), Postives = 259/356 (72.75%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC L   D+    E S  ID+ L+ + + + R VKLLLLG GESGKSTIVKQMK+I   G+++ E   ++++++SNTIQS+I IIRAM  L I F +  R +DA+ L  LAG+ E +G +  EL   +  LW D G+Q CF+R+ EYQL DSA YYLN LER+S  +YVPT+QD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIF VAL+ YDL L ED E+NRM ES++LFDS+CNN  F +T +ILFLNK+DLFE K+ +SPL+IC+ EY   NTYE+A  YI+ +FE+LNK +++K I+TH TCATDT NV+ VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCTLSTEDKAAV-ERSRMIDRNLREDGEKASREVKLLLLGAGESGKSTIVKQMKIIHEAGYTEEECKQYKAVVYSNTIQSVIAIIRAMGNLRIDFGDAGRADDARQLFVLAGSAE-DGLMTPELAQVIKRLWADPGVQACFRRAREYQLNDSAAYYLNDLERISQPSYVPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFIETSIILFLNKKDLFEEKVIRSPLTICYPEYTGGNTYEEAAAYIQTQFENLNKRKESKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004355.1 (pep scaffold:Pmarinus_7.0:GL477714:209323:228779:-1 gene:ENSPMAG00000003914.1 transcript:ENSPMAT00000004355.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 377.867 bits (969), Expect = 1.967e-130
Identity = 185/320 (57.81%), Postives = 232/320 (72.50%), Query Frame = 3
Query:  156 LLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
             +  G GESGKSTIVKQMK+I  +G+S+ E   + +++FSN IQS+I IIRAM KL I F +  R  DA+ L  LAG  E  G +  +L   +  LW D G+Q CF+RS EYQL DSA YYLN LER+SN +Y+PT+QD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIF VAL+ YDL L ED E NRM ES++LFDS+CNN  F +T +ILFLNK+DLFE KI KSPLSICF EY   NTYE+A  YI+ +FE LNK + TK I++H TCATDT NV+ VF+ +  ++I+  L+  GL 
Sbjct:    4 FVFAGAGESGKSTIVKQMKIIHEDGYSEDECKQYTAVVFSNAIQSIIAIIRAMGKLKIDFGDVSRAEDARQLFVLAGVAE-EGVMTPDLSEVIKRLWSDSGVQACFRRSREYQLNDSAAYYLNDLERISNLSYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEETNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKINKSPLSICFAEYIGSNTYEEAAAYIQCQFEDLNKRKDTKEIYSHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 322          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Sea Lamprey
Match: gnat2 (guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-011128-10])

HSP 1 Score: 367.851 bits (943), Expect = 2.826e-126
Identity = 181/340 (53.24%), Postives = 246/340 (72.35%), Query Frame = 3
Query:   96 SHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            S +++K+L  +A+   R VKLLLLG GESGKSTIVKQMK+I  NG+S+AE L F+++I+SNT+QS++ I+RAM    I + +P R  D + L  LA ++E  G +  EL + ++ LW+D G+Q  F R++EYQL DSA YYLN L+RL N +Y+P EQD+LR+RVKT GIIE +  FK+L  ++ DVGGQR+ERKKWIHCF+ V  IIF  AL+ YD+ L ED EVNRM ESL LF+S+CN+  F DT ++LFLNK+DLFE K+KK  L+ICF +Y   NT++ A  YIK +F  LN  ++ K I++H+TCATDT NVK VF+ +  I+I+  L+  GL 
Sbjct:    3 SKELEKKLAEDAEKEARTVKLLLLGAGESGKSTIVKQMKIIHKNGYSEAECLEFKAIIYSNTLQSILAIVRAMETFSIDYGDPARAADGRQLFNLADSLEE-GSMPNELSAIIIRLWKDTGVQASFDRASEYQLNDSASYYLNDLDRLMNPSYLPNEQDVLRSRVKTTGIIEDSFCFKDLQFRMFDVGGQRSERKKWIHCFEGVTCIIFCGALSAYDMVLVEDDEVNRMHESLHLFNSICNHRYFNDTSIVLFLNKKDLFEEKVKKVHLNICFPDYDGPNTFDDAGAYIKNQFLDLNLRKEAKEIYSHLTCATDTQNVKFVFDAVTDIIIKNNLKDCGLF 341          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007349.1 (pep scaffold:Pmarinus_7.0:GL488470:4533:13151:-1 gene:ENSPMAG00000006632.1 transcript:ENSPMAT00000007349.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 260.766 bits (665), Expect = 1.056e-84
Identity = 140/322 (43.48%), Postives = 205/322 (63.66%), Query Frame = 3
Query:  156 LLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEK--AVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            L  +GTGESGKST +KQM++I  +G+++ ++  F  L+  N   ++  +IRAM  L I + N      AQ L ++   VE    L++    A+  LW D GI+EC+ R  E+QL DSA+YYLN L R+S  NY+PT+QDILR R+ T GIIE   + + +I ++VDVGGQR+ER+KWIHCF+NV +I+F+VAL+EYD  L E    NRM ES  LF ++     F+++ +ILFLNK+DL E KI  S L   F ++   N ++   A  +I   F  LN   + K+I++H TCATDT+N++ VF  +K  ++Q  L+ + L+
Sbjct:    1 LFCVGTGESGKSTFIKQMRIIHGSGYTEDDKRSFIKLVHQNVFSAMQAMIRAMETLGIPYANAGNQAHAQLLREV--DVEKICSLDKPYIEAVRCLWADPGIEECYDRRREFQLTDSAKYYLNDLARISAVNYLPTQQDILRVRIPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDSENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIIHSHLVDYFPDFDVRNQFDPQAAREFILRMFVELNPDTE-KVIYSHFTCATDTENIRFVFAAVKDAILQLNLKEYNLV 319          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007354.1 (pep scaffold:Pmarinus_7.0:GL488470:4533:13151:-1 gene:ENSPMAG00000006632.1 transcript:ENSPMAT00000007354.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 259.996 bits (663), Expect = 2.299e-84
Identity = 139/321 (43.30%), Postives = 204/321 (63.55%), Query Frame = 3
Query:  156 LLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEY-ADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            L  +GTGESGKST +KQM++I  +G+++ ++  F  L+  N   ++  +IRAM  L I + N      AQ L ++   VE    L++    A+  LW D GI+EC+ R  E+QL DSA+YYLN L R+S  NY+PT+QDILR R+ T GIIE   + + +I ++VDVGGQR+ER+KWIHCF+NV +I+F+VAL+EYD  L E    NRM ES  LF ++     F+++ +ILFLNK+DL E KI  S L   F ++   +   + A  +I   F  LN   + K+I++H TCATDT+N++ VF  +K  ++Q  L+ + L+
Sbjct:    1 LFCVGTGESGKSTFIKQMRIIHGSGYTEDDKRSFIKLVHQNVFSAMQAMIRAMETLGIPYANAGNQAHAQLLREV--DVEKICSLDKPYIEAVRCLWADPGIEECYDRRREFQLTDSAKYYLNDLARISAVNYLPTQQDILRVRIPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDSENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIIHSHLVDYFPDFDGPQQDPQAAREFILRMFVELNPDTE-KVIYSHFTCATDTENIRFVFAAVKDAILQLNLKEYNLV 318          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Yeast
Match: GPA2 (Nucleotide binding alpha subunit of the heterotrimeric G protein; interacts with the receptor Gpr1p, has signaling role in response to nutrients; required for the recruitment of Ras-GTP at the plasma membrane and in the nucleus [Source:SGD;Acc:S000000822])

HSP 1 Score: 226.098 bits (575), Expect = 8.390e-70
Identity = 125/327 (38.23%), Postives = 197/327 (60.24%), Query Frame = 3
Query:  150 VKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESN--GPLNEELYSAMLNLWQDLGIQECFQ--RSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEF-KELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            +K+LLLG GESGKST+++Q+K++  NG S+ E   +  LI+ N ++    +I+A ++ +++      L        ++  + +N  G   E++   +  LW     Q+      ++++ L+DS  Y++ +  R+++ NY PT+QDILR+R  T+GI +T ++   ++ M I DVGGQR+ERKKWIHCFDNV  +IF V+L+EYD  L ED   NR  ESL LFD++ N+  F  T ++LFLNK DLF  K+ K P+   F +Y   +   KA  YI ++F  LN  R    I+ H+T ATDT N++ VF  IK  +++  L+  G++
Sbjct:  124 LKVLLLGAGESGKSTVLQQLKILHQNGFSEQEIKEYIPLIYQNLLEIGRNLIQARTRFNVNLEPECELTQQDLSRTMSYEMPNNYTGQFPEDIAGVISTLWALPSTQDLVNGPNASKFYLMDSTPYFMENFTRITSPNYRPTQQDILRSRQMTSGIFDTVIDMGSDIKMHIYDVGGQRSERKKWIHCFDNVTLVIFCVSLSEYDQTLMEDKNQNRFQESLVLFDNIVNSRWFARTSVVLFLNKIDLFAEKLSKVPMENYFPDYTGGSDINKAAKYILWRFVQLN--RANLSIYPHVTQATDTSNIRLVFAAIKETILENTLKDSGVL 448          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Yeast
Match: GPA1 (Subunit of the G protein involved in pheromone response; GTP-binding alpha subunit of the heterotrimeric G protein; negatively regulates the mating pathway by sequestering G(beta)gamma and by triggering an adaptive response; activates Vps34p at the endosome; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001047])

HSP 1 Score: 206.453 bits (524), Expect = 4.669e-62
Identity = 107/238 (44.96%), Postives = 154/238 (64.71%), Query Frame = 3
Query:  408 LNEELYSAMLNLWQ-DLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADE-NTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            ++E++  A+  LW  D GI++CF RS E+QL  SA YY +++E+ ++ NYV T++DIL+ R+KT GI ET         K++D GGQR+ERKKWIHCF+ + A++F++A++EYD  L ED  VNRM ES+ LFD++ N+  FKDT  ILFLNK DLFE K+K  P+   F +Y       E  + Y +  F SLNK    K I+   TCATDT  +K V   +  ++IQ+ L+  G++
Sbjct:  237 IHEDIAKAIKQLWNNDKGIKQCFARSNEFQLEGSAAYYFDNIEKFASPNYVCTDEDILKGRIKTTGITETEFNIGSSKFKVLDAGGQRSERKKWIHCFEGITAVLFVLAMSEYDQMLFEDERVNRMHESIMLFDTLLNSKWFKDTPFILFLNKIDLFEEKVKSMPIRKYFPDYQGRVGDAEAGLKYFEKIFLSLNK--TNKPIYVKRTCATDTQTMKFVLSAVTDLIIQQNLKKIGII 472          

HSP 2 Score: 70.4774 bits (171), Expect = 1.375e-13
Identity = 41/111 (36.94%), Postives = 66/111 (59.46%), Query Frame = 3
Query:   48 MGCPLG------KPDEIEQNEISHK-IDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLND 359
            MGC +       + D   QN+ ++  I++ L+LE +     +KLLLLG GESGKST++KQ+KL+   G S  ERL +  +I+++ IQS+ ++I    KL I     + +N+
Sbjct:    1 MGCTVSTQTIGDESDPFLQNKRANDVIEQSLQLEKQRDKNEIKLLLLGAGESGKSTVLKQLKLLHQGGFSHQERLQYAQVIWADAIQSMKILIIQARKLGIQLDCDDPINN 111          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Yeast
Match: ARF1 (ADP-ribosylation factor; GTPase of the Ras superfamily involved in regulation of coated vesicle formation in intracellular trafficking within the Golgi; ARF1 has a paralog, ARF2, that arose from the whole genome duplication; arf1 arf2 double null mutation is complemented by human ARF1, ARF4, ARF5, or ARF6 [Source:SGD;Acc:S000002351])

HSP 1 Score: 50.8322 bits (120), Expect = 4.635e-8
Identity = 29/100 (29.00%), Postives = 48/100 (48.00%), Query Frame = 3
Query:  582 TRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEV 881
            T + T G    TV++K +   + DVGGQ   R  W H + N + +IF+V  N+           +R+ E+  +   M N    ++   ++F NK+DL E 
Sbjct:   44 TTIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDR----------SRIGEAREVMQRMLNEDELRNAAWLVFANKQDLPEA 133          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Yeast
Match: ARF2 (ADP-ribosylation factor; GTPase of the Ras superfamily involved in regulation of coated formation vesicles in intracellular trafficking within the Golgi; ARF2 has a paralog, ARF1, that arose from the whole genome duplication; arf1 arf2 double null mutation is complemented by human ARF1, ARF4, ARF5, or ARF6 [Source:SGD;Acc:S000002296])

HSP 1 Score: 50.0618 bits (118), Expect = 8.410e-8
Identity = 28/100 (28.00%), Postives = 48/100 (48.00%), Query Frame = 3
Query:  582 TRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEV 881
            T + T G    TV++K +   + DVGGQ   R  W H + N + +IF++  N+           +R+ E+  +   M N    ++   ++F NK+DL E 
Sbjct:   44 TTIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVIDSNDR----------SRIGEAREVMQRMLNEDELRNAVWLVFANKQDLPEA 133          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Yeast
Match: ARF3 (Glucose-repressible ADP-ribosylation factor; GTPase of Ras superfamily involved in regulating cell polarity and invasive growth; localizes to dynamic spots at plasma membrane and modulates PtdIns(4,5)P2 levels to facilitate endocytosis; required for localization of endocytic protein Lsb5p to correct cortical site in cells; also has mRNA binding activity; homolog of mammalian Arf6 [Source:SGD;Acc:S000005620])

HSP 1 Score: 45.0542 bits (105), Expect = 5.245e-6
Identity = 29/99 (29.29%), Postives = 47/99 (47.47%), Query Frame = 3
Query:  576 LRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDL 872
            ++T   T G    TV +K +   + DVGGQ+  R  W H F    A+IF++     D   R     NRM E+     S+      ++  ++++ NK+DL
Sbjct:   42 IKTSTPTVGFNVETVTYKNVKFNMWDVGGQQRLRPLWRHYFPATTALIFVI-----DSSAR-----NRMEEAKEELYSIIGEKEMENVVLLVWANKQDL 130          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Nematostella
Match: EDO49692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG04])

HSP 1 Score: 414.461 bits (1064), Expect = 4.713e-144
Identity = 205/355 (57.75%), Postives = 261/355 (73.52%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGL 1112
            MGC L   D+    E S  IDK L+ + + + R VKLLLLG GESGKSTIVKQMK+I  +G+S+ E   ++ +++SNTIQS+I IIRAM  L I F +P+R +DA+ +  LAG++E +     EL S M  LW D GIQ CF RS EYQL DSA YYLN+L+RL + +YVPTEQD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIF VAL+ YDL L ED E+NRMMES++LFDS+CNN  F DT +ILFLNK+DLF  KI KSPL+ICF EY   NTYE+A  YI+ +FE+LNK + TK I+TH TCATDT+N++ VF+ +  ++I+  L+  GL
Sbjct:    1 MGCTLSAEDKAAA-ERSKMIDKNLRADGERAAREVKLLLLGAGESGKSTIVKQMKIIHEHGYSKEECTQYKQVVYSNTIQSMIAIIRAMGTLKIEFGHPDRADDAREMFALAGSME-DVKFTAELISIMKRLWSDSGIQACFARSREYQLNDSASYYLNALDRLGSPDYVPTEQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMMESMKLFDSICNNKWFTDTSIILFLNKKDLFAEKIVKSPLTICFPEYTGSNTYEEAAAYIQMQFENLNKRKDTKEIYTHFTCATDTNNIQFVFDAVTDVIIKNNLKDCGL 353          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Nematostella
Match: EDO32540 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUS4])

HSP 1 Score: 365.155 bits (936), Expect = 9.982e-125
Identity = 188/355 (52.96%), Postives = 242/355 (68.17%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGL 1112
            MGC L   +E      S  I+K LKLE   + R VKLLLLG GESGKSTIVKQM++I ++G S  + + +R L+FSNTI SL+ IIRAM KL I F N  RL DA+ +  +    +   P   EL  +M  LW+D G+Q+CF RS EYQL DSA+YYL+SL+R+   NY  TEQD+LRTRVKT GI+E   ++K L  K+ DVGGQR+ERKKWIHCF++V AII+ VAL+ YDL L ED   NRM ESL+LF+S+ NN  F DT +ILFLNK+DLFE KI K PL++CF EY+  +T+++   YI+ +FES N     K I+TH+TCATDT N+  VF  +   +I   L+  GL
Sbjct:    1 MGCTLS-AEERAAIARSKAIEKNLKLEGARAERDVKLLLLGAGESGKSTIVKQMRIIHDHGFSPEDYIQYRPLVFSNTIYSLLTIIRAMDKLRIDFENDARLMDAKLVFDVIARADDTEPFTPELTESMERLWKDAGVQQCFHRSREYQLGDSAKYYLDSLQRIGAPNYEATEQDLLRTRVKTTGIVEVQFDYKRLHFKLFDVGGQRSERKKWIHCFEDVTAIIYCVALSAYDLTLEEDESTNRMEESLKLFESIINNKWFVDTSVILFLNKKDLFEEKISKFPLTLCFPEYSGPSTFDEGAKYIRKQFESKN-LNDEKEIYTHLTCATDTQNINFVFNAVTDTIIANNLKGCGL 353          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Nematostella
Match: EDO41465 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S470])

HSP 1 Score: 276.174 bits (705), Expect = 6.506e-90
Identity = 151/359 (42.06%), Postives = 225/359 (62.67%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNG--PLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEY-ADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            M C L + +  E+  I+ +I+K+++ + ++  R +KLLLLGTGESGKST +KQM++I   G+S  ++ G+  L++ N I ++  + RAM  L I + +   L  A  +     TV+         E Y A  +LW D G+QEC+ R  EYQL DSA+YYL  L+RL+  +Y+PTEQD+LR R  T+GIIE   + + +I ++VDVGGQR+ER+KWIHCF+NV +I+F+VAL+EYD  L E    NRM ES  LF ++     F+++ +ILFLNK+DL E KI  S L   F E+   +   + A  +I   F  LN     K+I++H TCATDT+N++ VF  +K  ++Q  L+ + L+
Sbjct:    1 MDCCLSE-EAKERKRINAEIEKQIRQDKRNQRRELKLLLLGTGESGKSTFIKQMRIIHGQGYSDEDKRGYIPLVYQNIITAMHSLTRAMETLKIPYKDSSNLEKASYI----RTVDPKNVTTFEREYYEATKSLWSDAGMQECYDRRREYQLSDSAKYYLTDLDRLAKPDYLPTEQDVLRARAPTSGIIEYPFDLETIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDSENRMEESKALFRTIITYPWFQNSSIILFLNKKDLLEEKIMFSHLVEYFPEFDGPQCDAQAAREFILKMFVDLNP-DTDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV 353          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Nematostella
Match: EDO47993 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKI8])

HSP 1 Score: 241.506 bits (615), Expect = 1.952e-76
Identity = 131/349 (37.54%), Postives = 202/349 (57.88%), Query Frame = 3
Query:   45 FMGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEY-ADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQ 1088
            F GC L + +E EQ   S KIDK++  E     R VK+LLLG GESGKST +KQM++I            ++ +++SN ++ + V+  A  KL I +  P+    A+ +L L      +     +   ++  LW D GI++ F R  E+QL DS  Y+L+ L+R+  ++Y+PT+QD+L +R  T GI+E     K +  K+VDVGGQR++R KW  CFD V +I+F+V+ + YD  L ED   NR++ES  +F+++ NN  F +  +ILFLNK DL   K+K + +   F  +  D +  E    +I   F+S  + R +K +F H T A DT+N+K VF  +K  ++Q
Sbjct:    3 FEGCCLTQ-EEAEQRAQSQKIDKQIAQEKAQLRRQVKILLLGAGESGKSTFLKQMRIIYGKDFDADALQEYKPVVYSNILKGMKVLADARRKLRIDWDAPDNEMHAERILTLQAPPRIDTEFFLQYAESVRRLWTDAGIRDSFDRRREFQLGDSTRYFLDHLDRICRADYIPTKQDMLHSRKATKGIVEHEFMIKSIPFKMVDVGGQRSQRAKWFQCFDEVTSILFLVSSSAYDQVLMEDRTTNRLVESCNIFETIVNNKFFANVSIILFLNKTDLLTEKVKHTNIKDFFPAFQGDPHKLEDVQNFILQMFDSKRRER-SKALFHHFTTAVDTENIKFVFHAVKDTILQ 349          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Nematostella
Match: EDO49193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHA6])

HSP 1 Score: 234.572 bits (597), Expect = 2.083e-73
Identity = 142/351 (40.46%), Postives = 208/351 (59.26%), Query Frame = 3
Query:  105 IDKELKLEAKHSYRIV-KLLLLGTGESGKSTIVKQMKLIVN-NGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKL--DISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIK--KSPLSICFEEYA-------------DENTYEKAVTYIKFKFESLNKYR--QTKLIFTHITCATDTDNVKNVFEDIKTIMIQRL 1094
            I+++LK E K +YR   +LLLLG GESGKSTIVKQM+++ + +G ++ E+      I  N   +++ I  AMS L   +   NP        + ++A   + + P   E Y     LWQD G+ EC++RS EYQLID A+Y+L+ ++ +   +Y+PTEQD+LR RV T+GIIET  E   +   + DVGGQR ER+KWI CF++V AIIF+VA + Y+L LRED   NR+ ESL LF S+ NN   +   +ILFLNK+DL + K++  KS +   F ++A             DE    +A  +I+ +F  ++          + H TCA DT+N++ VF D + I IQR+
Sbjct:   26 IERQLK-EDKIAYRATHRLLLLGAGESGKSTIVKQMRILHDVHGFTELEKRQKIEDIKKNIRDAILTITGAMSTLTPPVKLANPNNQFRLDYVHEVATAPDFDYP--PEFYEHTKILWQDAGVLECYERSNEYQLIDCAQYFLDRVDTIQQQDYLPTEQDLLRCRVLTSGIIETRFEVDRVKFHMFDVGGQRDERRKWIQCFNDVTAIIFVVACSSYNLVLREDASQNRLKESLELFKSIWNNRWLRTISVILFLNKQDLLKDKVRAGKSKIEDYFPDFARYRTPPDATAEPGDEEAVTRAKYFIRDEFLRISTASGDGKHYCYPHFTCAVDTENIRRVFNDCRDI-IQRM 372          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Medaka
Match: gnai3 (Gi1 alpha subunit [Source:NCBI gene;Acc:100144384])

HSP 1 Score: 412.535 bits (1059), Expect = 6.957e-143
Identity = 204/356 (57.30%), Postives = 263/356 (73.88%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC L   D+  Q E S  ID+ L+ + + + R VKLLLLG GESGKSTIVKQMK+I   G+S+ E   ++++++SNTIQS+I IIRAM +L I F +  R +DA+ L  LAG+ E  G +  EL   +  LW+D G+Q CF RS EYQL DSA YYLN L+R+S+++YVPT+QD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIF VAL++YDL L ED E+NRM ES++LFDS+CNN  F DT +ILFLNK+DLFE KIKKSPL+ICF EYA  NTYE+A  Y++ +FE LNK + TK I+TH TCATDT NV+ VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCTLSTDDKAAQ-ERSKMIDRNLRDDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFADQARADDARQLFILAGSTE-EGFMTGELAGVIQRLWKDGGVQACFSRSREYQLNDSAAYYLNDLDRISHASYVPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICFPEYAGSNTYEEAAAYVQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Medaka
Match: ENSORLT00000020087.2 (guanine nucleotide-binding protein G(i) subunit alpha-1 [Source:NCBI gene;Acc:101157265])

HSP 1 Score: 411.379 bits (1056), Expect = 2.070e-142
Identity = 204/356 (57.30%), Postives = 259/356 (72.75%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC L   D+    E S  ID+ L+ + + + R VKLLLLG GESGKSTIVKQMK+I   G+S+ E   ++++++SNTIQS+I IIRAM +L I F +  R  DA+ L  LAG+ E  G +  EL   +  LW D G+Q CF RS EYQL DSA YYLN L+R+S +NY+PT+QD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIF VAL++YDL L ED E+NRM ES++LFDS+CNN  F DT +ILFLNK+DLFE KIK+SPLSIC+ EYA  NTYE+A  YI+ +FE LNK R TK I+TH TCATDT NV+ VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCTLSTEDKAAV-ERSKMIDRNLRDDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFKDSSRAEDARQLFVLAGSAE-EGSMTTELAGVIKRLWSDDGVQACFSRSREYQLNDSAAYYLNDLDRISQANYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLSICYPEYAGSNTYEEAAAYIQCQFEDLNKRRDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Medaka
Match: gnai2b (guanine nucleotide-binding protein G(i) subunit alpha-2 [Source:NCBI gene;Acc:105358374])

HSP 1 Score: 407.142 bits (1045), Expect = 8.007e-141
Identity = 197/356 (55.34%), Postives = 260/356 (73.03%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC +   D+    E S  IDK L+ + + + R VKLLLLG GESGKSTIVKQMK+I  +G+S+ E   +R++++SNTIQS++ I++AM+ L I +++P R++DAQ L  L+   E  G L ++L + M  LW D GIQ CF RS EYQL DSA YYLN LER++ ++Y+PT+QD+LRTRVKT GI+ET   FKEL  K+ DVGGQR+ERKKWIHCF+ V AIIF VAL+ YDL L ED E+NRM ES++LFDS+CNN  F +T +ILFLNK+DLFE KI  SPLSICF EY+  N +++A +YI+ KFE LNK + T  I+TH TCATDT NV+ VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCTVSAEDKAAA-ERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYRAVVYSNTIQSIMAIVKAMASLKIDYSDPARMDDAQQLFALSAAAEEQGILPDDLANVMRRLWADSGIQSCFTRSREYQLNDSAAYYLNDLERIAKADYIPTQQDVLRTRVKTTGIVETHFTFKELHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKITHSPLSICFPEYSGANKFDEAASYIQTKFEDLNKKKDTNEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 355          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Medaka
Match: gnai2 (guanine nucleotide-binding protein G(i) subunit alpha 2 [Source:NCBI gene;Acc:100125814])

HSP 1 Score: 397.897 bits (1021), Expect = 3.466e-137
Identity = 194/356 (54.49%), Postives = 258/356 (72.47%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC + + D+   +  S  IDK L+ + + + R VKLLLLG GESGKSTIVKQMK+I  +G+S+ E   +R++++SNT+QS++ II+AM+ L + +  PER  DA+ L ++A   E  G L EEL + + +LW D GIQ C  R+ EYQL DSA YYL  LER+S  +Y+PT+QD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIF VA++ YDL L ED E+NRM ES++LFDS+CNN  F +T +ILFLNK+DLFE KI  SPL+ICF EY   NTY++A  YI+ KFE LNK ++TK I+TH TCATDT NV+ VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCTVSQEDKAAADR-SKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYRAVVYSNTVQSIMAIIKAMTILHLDYERPEREEDAKRLFKMAAEAEERGDLPEELANIIKDLWADSGIQHCLTRAREYQLNDSAAYYLKDLERISKPDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVAMSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEQKIAHSPLTICFPEYEGPNTYQEAQAYIQTKFEDLNKKKETKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 355          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Medaka
Match: gnai2 (guanine nucleotide-binding protein G(i) subunit alpha 2 [Source:NCBI gene;Acc:100125814])

HSP 1 Score: 397.897 bits (1021), Expect = 3.466e-137
Identity = 194/356 (54.49%), Postives = 258/356 (72.47%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC + + D+   +  S  IDK L+ + + + R VKLLLLG GESGKSTIVKQMK+I  +G+S+ E   +R++++SNT+QS++ II+AM+ L + +  PER  DA+ L ++A   E  G L EEL + + +LW D GIQ C  R+ EYQL DSA YYL  LER+S  +Y+PT+QD+LRTRVKT GI+ET   FK+L  K+ DVGGQR+ERKKWIHCF+ V AIIF VA++ YDL L ED E+NRM ES++LFDS+CNN  F +T +ILFLNK+DLFE KI  SPL+ICF EY   NTY++A  YI+ KFE LNK ++TK I+TH TCATDT NV+ VF+ +  ++I+  L+  GL 
Sbjct:    1 MGCTVSQEDKAAADR-SKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYRAVVYSNTVQSIMAIIKAMTILHLDYERPEREEDAKRLFKMAAEAEERGDLPEELANIIKDLWADSGIQHCLTRAREYQLNDSAAYYLKDLERISKPDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVAMSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEQKIAHSPLTICFPEYEGPNTYQEAQAYIQTKFEDLNKKKETKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 355          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Planmine SMEST
Match: SMESG000005418.1 (SMESG000005418.1)

HSP 1 Score: 734.176 bits (1894), Expect = 0.000e+0
Identity = 356/356 (100.00%), Postives = 356/356 (100.00%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM
Sbjct:    1 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 356          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Planmine SMEST
Match: SMESG000055191.1 (SMESG000055191.1)

HSP 1 Score: 377.096 bits (967), Expect = 4.326e-129
Identity = 189/355 (53.24%), Postives = 248/355 (69.86%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGL 1112
            MGC + K DE +  + S  IDK+LK +   + + VKLLLLG GESGKSTIVKQMK+I   G +Q +   ++ +++SNT QS+I I+RAM+ L ISF + +R  DA+ +  +   +E   P +EEL  AM  LW D G+QECF RS EYQL DSA+Y+L+ L+RL   +Y+PTEQDILRTRVKT GI+E    FK +  K+ DVGGQR+ERKKWIHCF++V AIIF VA++EYD  L ED   NRM ESL+LFDS+CNN  F  T +ILFLNK+DLF+ KIKKSPL++CF EY  + TYE+A  YI+  FE+ N     K I+ H TCATDT+N++ VF+ +  ++I   L   GL
Sbjct:    1 MGCTMSK-DERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNN-SPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGL 353          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Planmine SMEST
Match: SMESG000026676.1 (SMESG000026676.1)

HSP 1 Score: 376.326 bits (965), Expect = 7.705e-129
Identity = 187/355 (52.68%), Postives = 246/355 (69.30%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGL 1112
            MGC L K DE E  + S  IDK+LK +   + + VKLLLLG GESGKSTIVKQMK+I   G +  +   ++ +++SNT QS+I I+RAM+ L+ISF +P+R  DA+ +  +   +E   P +EEL  A   LW D G+QECF RS EYQL DSA+Y+L+ ++RL   +Y+PTEQDILRTR+KT GI+E    FK +  K+ DVGGQR+ERKKWIHCF++V AIIF VA++EYD  L ED   NRM ESL+LFDS+CNN  F  T +ILFLNK+DLF  KIK+SPL++CF EY    TYE+A  YI+  FE+ N     K I+ H TCATDT+N++ VF+ +  ++I   L   GL
Sbjct:    1 MGCALSK-DEREALDKSRNIDKKLKEDGVQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTNEDNKQYKPVVYSNTTQSMIAILRAMTTLNISFGDPDRSADAKIVSDVIQAMEDTEPFSEELLEATKRLWADSGVQECFNRSNEYQLNDSAKYFLDDIDRLGAGDYMPTEQDILRTRIKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTQTSIILFLNKKDLFAEKIKRSPLTVCFSEYTGRQTYEEAAAYIQASFEAKNN-SPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGL 353          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Planmine SMEST
Match: SMESG000055191.1 (SMESG000055191.1)

HSP 1 Score: 372.089 bits (954), Expect = 3.619e-127
Identity = 185/347 (53.31%), Postives = 243/347 (70.03%), Query Frame = 3
Query:   72 DEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGL 1112
            DE +  + S  IDK+LK +   + + VKLLLLG GESGKSTIVKQMK+I   G +Q +   ++ +++SNT QS+I I+RAM+ L ISF + +R  DA+ +  +   +E   P +EEL  AM  LW D G+QECF RS EYQL DSA+Y+L+ L+RL   +Y+PTEQDILRTRVKT GI+E    FK +  K+ DVGGQR+ERKKWIHCF++V AIIF VA++EYD  L ED   NRM ESL+LFDS+CNN  F  T +ILFLNK+DLF+ KIKKSPL++CF EY  + TYE+A  YI+  FE+ N     K I+ H TCATDT+N++ VF+ +  ++I   L   GL
Sbjct:    4 DERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNN-SPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGL 349          
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Planmine SMEST
Match: SMESG000081983.1 (SMESG000081983.1)

HSP 1 Score: 367.466 bits (942), Expect = 2.375e-125
Identity = 185/357 (51.82%), Postives = 251/357 (70.31%), Query Frame = 3
Query:   48 MGCPLGKPDEIEQNE-ISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTIVKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPERLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQLIDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKIVDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLRLFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEKAVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLLELHGLM 1115
            MGC     +E+  NE  S +IDK +  + +     +K+LLLG GESGKSTIVKQMK+I NNG+++ E L ++ ++FSNT+QSL  IIRAM +L I F + E + DA+ L  L   +E    L+E++++AM  LW D G+  CF RS EYQL DSAEY+LNS+ RLSN +Y+PTEQD+L TRVKT GI+ET V FK L +KIVDVGGQR+ER+KWIHCF+ V  +I++ +++EYD  L ED E+NRM ES++LFDS+CNN  F    +ILFLNK DLF++KI KSPL++CF EY   N +E A  Y++  FE LNK ++ K+I++H TCATDT N+  VF  I   +I + +   G+ 
Sbjct:    1 MGCI--PSNEVRANENKSKEIDKLISRDFQRESSTIKILLLGAGESGKSTIVKQMKIINNNGYTKDECLQYKPIVFSNTLQSLTAIIRAMGQLKIDFASLESIEDARKLFSLGKNIEE-AVLSEDIFAAMQRLWNDDGVLVCFTRSREYQLNDSAEYFLNSIGRLSNPDYIPTEQDVLHTRVKTTGIVETLVTFKGLNLKIVDVGGQRSERRKWIHCFEGVMTMIYVASISEYDQFLIEDNEINRMFESIKLFDSVCNNQWFSKCSIILFLNKTDLFKLKIVKSPLTVCFPEYKGNNNFEDASEYVRMTFEMLNK-KKEKIIYSHFTCATDTSNINYVFNVITDSIIVKNINAIGIF 353          
The following BLAST results are available for this feature:
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GNAI19.436e-14156.74G protein subunit alpha i1 [Source:HGNC Symbol;Acc... [more]
GNAI19.436e-14156.74G protein subunit alpha i1 [Source:HGNC Symbol;Acc... [more]
GNAI19.436e-14156.74G protein subunit alpha i1 [Source:HGNC Symbol;Acc... [more]
GNAI19.436e-14156.74G protein subunit alpha i1 [Source:HGNC Symbol;Acc... [more]
GNAI19.436e-14156.74G protein subunit alpha i1 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
goa-12.488e-12852.96Guanine nucleotide-binding protein G(o) subunit al... [more]
gpa-71.679e-12150.86Guanine nucleotide-binding protein alpha-7 subunit... [more]
gpa-161.221e-12051.40Guanine nucleotide-binding protein alpha-16 subuni... [more]
gpa-42.935e-11849.45Guanine nucleotide-binding protein alpha-4 subunit... [more]
gpa-152.652e-10341.97Guanine nucleotide-binding protein alpha-15 subuni... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Galphai2.379e-13655.90gene:FBgn0001104 transcript:FBtr0076934[more]
Galphao1.395e-12852.96gene:FBgn0001122 transcript:FBtr0088267[more]
Galphao1.395e-12852.96gene:FBgn0001122 transcript:FBtr0088269[more]
Galphao1.395e-12852.96gene:FBgn0001122 transcript:FBtr0088264[more]
Galphao1.395e-12852.96gene:FBgn0001122 transcript:FBtr0088268[more]
back to top
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnaia1.607e-13956.46guanine nucleotide binding protein (G protein), al... [more]
gnaia1.607e-13956.46guanine nucleotide binding protein (G protein), al... [more]
gnai31.616e-13957.18guanine nucleotide binding protein (G protein), al... [more]
gnai12.698e-13956.18guanine nucleotide binding protein (G protein), al... [more]
gnai2b2.122e-13854.78guanine nucleotide binding protein (G protein), al... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnai22.269e-14256.74guanine nucleotide binding protein (G protein), al... [more]
gnai13.380e-14056.18guanine nucleotide binding protein (G protein), al... [more]
gnai11.607e-13956.18guanine nucleotide binding protein (G protein), al... [more]
rgp17.944e-13755.21RGP1 homolog, RAB6A GEF complex partner 1 [Source:... [more]
gnao12.263e-13054.08G protein subunit alpha o1 [Source:NCBI gene;Acc:5... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gnai16.478e-14156.74guanine nucleotide binding protein (G protein), al... [more]
Gnai33.149e-14056.06guanine nucleotide binding protein (G protein), al... [more]
Gnai21.886e-13955.34guanine nucleotide binding protein (G protein), al... [more]
Gnai21.886e-13955.34guanine nucleotide binding protein (G protein), al... [more]
Gnao14.401e-12954.65guanine nucleotide binding protein, alpha O [Sourc... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P30682|GNAI_LYMST3.180e-14657.58Guanine nucleotide-binding protein G(i) subunit al... [more]
sp|P51876|GNAI_PLATR2.170e-14557.30Guanine nucleotide-binding protein G(i) subunit al... [more]
sp|P38401|GNAI1_CAVPO2.656e-14056.74Guanine nucleotide-binding protein G(i) subunit al... [more]
sp|P10824|GNAI1_RAT3.604e-14056.74Guanine nucleotide-binding protein G(i) subunit al... [more]
sp|P38403|GNAI3_CAVPO4.019e-14056.34Guanine nucleotide-binding protein G(i) subunit al... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3H3V13.679e-14759.55guanine nucleotide-binding protein G(I) subunit al... [more]
R7V8M38.362e-14658.71Uncharacterized protein OS=Capitella teleta OX=283... [more]
V4AZH11.040e-14558.43Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A2T7NTY35.583e-14458.31Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A2H4WCW21.212e-14358.15Gi-alpha OS=Argopecten irradians OX=31199 GN=Gi-al... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnaia7.711e-14256.46guanine nucleotide-binding protein G(i) subunit al... [more]
gnai2b1.915e-13754.49guanine nucleotide-binding protein G(i) subunit al... [more]
gnai2a1.777e-13154.78guanine nucleotide-binding protein G(i) subunit al... [more]
ENSAMXT00000018576.21.175e-12858.01pep primary_assembly:Astyanax_mexicanus-2.0:7:2557... [more]
gnao1a4.564e-12854.08G protein subunit alpha o1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnai33.204e-13655.06guanine nucleotide binding protein (G protein), al... [more]
ENSPMAT00000004355.11.967e-13057.81pep scaffold:Pmarinus_7.0:GL477714:209323:228779:-... [more]
gnat22.826e-12653.24guanine nucleotide binding protein (G protein), al... [more]
ENSPMAT00000007349.11.056e-8443.48pep scaffold:Pmarinus_7.0:GL488470:4533:13151:-1 g... [more]
ENSPMAT00000007354.12.299e-8443.30pep scaffold:Pmarinus_7.0:GL488470:4533:13151:-1 g... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
GPA28.390e-7038.23Nucleotide binding alpha subunit of the heterotrim... [more]
GPA14.669e-6244.96Subunit of the G protein involved in pheromone res... [more]
ARF14.635e-829.00ADP-ribosylation factor; GTPase of the Ras superfa... [more]
ARF28.410e-828.00ADP-ribosylation factor; GTPase of the Ras superfa... [more]
ARF35.245e-629.29Glucose-repressible ADP-ribosylation factor; GTPas... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO496924.713e-14457.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325409.982e-12552.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414656.506e-9042.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479931.952e-7637.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491932.083e-7340.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnai36.957e-14357.30Gi1 alpha subunit [Source:NCBI gene;Acc:100144384][more]
ENSORLT00000020087.22.070e-14257.30guanine nucleotide-binding protein G(i) subunit al... [more]
gnai2b8.007e-14155.34guanine nucleotide-binding protein G(i) subunit al... [more]
gnai23.466e-13754.49guanine nucleotide-binding protein G(i) subunit al... [more]
gnai23.466e-13754.49guanine nucleotide-binding protein G(i) subunit al... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(i) subunit alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005418.10.000e+0100.00SMESG000005418.1[more]
SMESG000055191.14.326e-12953.24SMESG000055191.1[more]
SMESG000026676.17.705e-12952.68SMESG000026676.1[more]
SMESG000055191.13.619e-12753.31SMESG000055191.1[more]
SMESG000081983.12.375e-12551.82SMESG000081983.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032172 ID=SMED30032172|Name=Guanine nucleotide-binding protein G(i) subunit alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=1292bp
TTATAATCACTAAATTACATTTTAATTAATATAAAACTTCTTAATTTATG
GGTTGTCCATTGGGTAAACCAGACGAAATAGAACAGAATGAAATTTCCCA
CAAAATCGACAAAGAATTAAAGCTGGAAGCCAAACACAGTTATCGAATTG
TAAAGCTTTTACTTTTAGGAACTGGGGAATCTGGAAAAAGCACAATTGTT
AAACAAATGAAATTAATTGTAAATAATGGTCATTCACAAGCTGAGAGATT
GGGTTTTCGATCACTGATTTTTAGCAATACCATTCAAAGCCTCATTGTTA
TCATAAGGGCAATGTCAAAGCTCGACATAAGTTTTACCAATCCAGAGCGA
TTGAATGATGCTCAAACTCTTCTTCAATTGGCTGGAACCGTGGAGTCTAA
TGGACCACTGAATGAAGAACTGTATAGTGCCATGCTCAACCTTTGGCAGG
ATCTCGGAATCCAAGAATGTTTTCAACGATCCGCCGAGTATCAGTTAATC
GATTCAGCAGAATACTACCTAAATTCACTTGAAAGGCTCAGTAATTCAAA
TTACGTACCAACTGAACAGGATATCCTACGAACCAGGGTGAAAACCGCGG
GAATTATCGAGACAACAGTTGAATTTAAAGAGTTAATTATGAAAATAGTC
GATGTCGGTGGTCAGCGCGCAGAAAGGAAAAAATGGATTCATTGTTTTGA
CAATGTCGATGCTATAATCTTCATAGTTGCATTGAATGAGTATGATCTGA
GATTACGCGAAGATCCCGAAGTTAACAGAATGATGGAATCTCTGAGATTA
TTCGACAGTATGTGTAACAATGTCGTATTTAAAGATACTTGTATGATATT
ATTCCTGAATAAAAGAGACCTGTTTGAAGTAAAAATTAAAAAGTCACCTC
TCAGTATTTGTTTTGAAGAATATGCAGACGAAAACACCTACGAAAAGGCA
GTGACGTATATAAAATTCAAATTCGAATCGCTAAATAAATATCGCCAGAC
CAAGCTCATATTCACTCACATTACTTGCGCAACAGATACTGATAACGTCA
AAAACGTATTTGAAGATATAAAAACGATTATGATTCAAAGACTTCTTGAA
CTGCACGGATTGATGTAATTTTGTTAATTATCTTTTTAGTGAATGACAAG
GGCTTCATCGACTTCGCTGTGTTTTGCCATACAATATTTGTTAGATTTAT
TTTTCTTTTATAATTAAAAAAAAATTAAATTTTTGCAATTTGTCGTATTT
TTAATATATTTTTAGAATTTCTTTTTTTAATTAAGCATGAAA
back to top

protein sequence of SMED30032172-orf-1

>SMED30032172-orf-1 ID=SMED30032172-orf-1|Name=SMED30032172-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=357bp
MGCPLGKPDEIEQNEISHKIDKELKLEAKHSYRIVKLLLLGTGESGKSTI
VKQMKLIVNNGHSQAERLGFRSLIFSNTIQSLIVIIRAMSKLDISFTNPE
RLNDAQTLLQLAGTVESNGPLNEELYSAMLNLWQDLGIQECFQRSAEYQL
IDSAEYYLNSLERLSNSNYVPTEQDILRTRVKTAGIIETTVEFKELIMKI
VDVGGQRAERKKWIHCFDNVDAIIFIVALNEYDLRLREDPEVNRMMESLR
LFDSMCNNVVFKDTCMILFLNKRDLFEVKIKKSPLSICFEEYADENTYEK
AVTYIKFKFESLNKYRQTKLIFTHITCATDTDNVKNVFEDIKTIMIQRLL
ELHGLM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0031683G-protein beta/gamma-subunit complex binding
GO:0003924GTPase activity
GO:0004871signal transducer activity
GO:0019001guanyl nucleotide binding
GO:0000166nucleotide binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0007188adenylate cyclase-modulating G-protein coupled receptor signaling pathway
GO:0007165signal transduction
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: INTERPRO
TermDefinition
IPR001019Gprotein_alpha_su
IPR001408Gprotein_alpha_I
IPR027417P-loop_NTPase
IPR011025GproteinA_insert
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001408G-protein alpha subunit, group IPRINTSPR00441GPROTEINAIcoord: 280..292
score: 75.57
coord: 187..197
score: 45.14
coord: 298..309
score: 47.95
coord: 80..89
score: 68.95
IPR001019Guanine nucleotide binding protein (G-protein), alpha subunitPRINTSPR00318GPROTEINAcoord: 198..215
score: 70.28
coord: 266..275
score: 75.84
coord: 36..51
score: 85.96
coord: 220..248
score: 56.71
coord: 169..191
score: 61.97
IPR001019Guanine nucleotide binding protein (G-protein), alpha subunitSMARTSM00275galpha_1coord: 14..355
e-value: 1.8E-171
score: 585.6
IPR001019Guanine nucleotide binding protein (G-protein), alpha subunitPFAMPF00503G-alphacoord: 15..344
e-value: 3.2E-107
score: 358.8
IPR001019Guanine nucleotide binding protein (G-protein), alpha subunitPANTHERPTHR10218GTP-BINDING PROTEIN ALPHA SUBUNITcoord: 1..355
IPR001019Guanine nucleotide binding protein (G-protein), alpha subunitCDDcd00066G-alphacoord: 35..350
e-value: 3.757E-170
score: 474.322
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 19..347
e-value: 3.6E-129
score: 432.5
NoneNo IPR availablePANTHERPTHR10218:SF73GUANINE NUCLEOTIDE-BINDING PROTEIN G(I) SUBUNIT ALPHA-2coord: 1..355
NoneNo IPR availablePROSITEPS51882G_ALPHAcoord: 33..356
score: 93.062
IPR011025G protein alpha subunit, helical insertionGENE3DG3DSA:1.10.400.10coord: 63..182
e-value: 3.6E-129
score: 432.5
IPR011025G protein alpha subunit, helical insertionSUPERFAMILYSSF47895Transducin (alpha subunit), insertion domaincoord: 63..183
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 33..347